Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR296W1289126664400.0
Scas_665.251272127020500.0
ABL016C1328130319770.0
CAGL0G07579g1277127617720.0
Kwal_55.2030271067211511e-142
KLLA0B13002g13778125741e-59
YDR244W (PEX5)61295696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR296W
         (1266 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR296W (YOR296W) [5080] chr15 (870199..874068) Protein containi...  2485   0.0  
Scas_665.25                                                           794   0.0  
ABL016C [576] [Homologous to ScYOR296W - SH] (367026..371012) [3...   766   0.0  
CAGL0G07579g 716580..720413 similar to tr|Q08748 Saccharomyces c...   687   0.0  
Kwal_55.20302                                                         447   e-142
KLLA0B13002g complement(1134173..1138306) weakly similar to sgd|...   225   1e-59
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...    31   6.7  

>YOR296W (YOR296W) [5080] chr15 (870199..874068) Protein containing a
            C2 domain, which may be involved in calcium-dependent
            phospholipid binding, has low similarity to
            uncharacterized C. albicans Orf6.5092p [3870 bp, 1289 aa]
          Length = 1289

 Score = 2485 bits (6440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1207/1266 (95%), Positives = 1207/1266 (95%)

Query: 1    MNRXXXXXXXXXXXXXXEIPSICNVINTELPTSDVYLYTLKLILLDYINEPRFKEAALLS 60
            MNR              EIPSICNVINTELPTSDVYLYTLKLILLDYINEPRFKEAALLS
Sbjct: 1    MNRTVSTLSSTVSDVSVEIPSICNVINTELPTSDVYLYTLKLILLDYINEPRFKEAALLS 60

Query: 61   NRTGTSRVLSDKTNHQQTQHGKKLVVDKQDDMSERDIVQATLRILKGKLAQISGNKNLAP 120
            NRTGTSRVLSDKTNHQQTQHGKKLVVDKQDDMSERDIVQATLRILKGKLAQISGNKNLAP
Sbjct: 61   NRTGTSRVLSDKTNHQQTQHGKKLVVDKQDDMSERDIVQATLRILKGKLAQISGNKNLAP 120

Query: 121  NEMHWKSIVKMYYSMLDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSE 180
            NEMHWKSIVKMYYSMLDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSE
Sbjct: 121  NEMHWKSIVKMYYSMLDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSE 180

Query: 181  VAYFIDLVIDVLPDSCANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTIS 240
            VAYFIDLVIDVLPDSCANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTIS
Sbjct: 181  VAYFIDLVIDVLPDSCANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTIS 240

Query: 241  NKQPSFKVQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNG 300
            NKQPSFKVQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNG
Sbjct: 241  NKQPSFKVQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNG 300

Query: 301  TLTASDFSSDREYNLWKNYELLEIANLMDRFEIGEKVTSHGNRLIPKDAKSVFVRLIGLV 360
            TLTASDFSSDREYNLWKNYELLEIANLMDRFEIGEKVTSHGNRLIPKDAKSVFVRLIGLV
Sbjct: 301  TLTASDFSSDREYNLWKNYELLEIANLMDRFEIGEKVTSHGNRLIPKDAKSVFVRLIGLV 360

Query: 361  LKKECSNAVNAINLSQEALFFFHKSARYWRIEYPSTISSLVYSAANLSVLGDEELNIPIT 420
            LKKECSNAVNAINLSQEALFFFHKSARYWRIEYPSTISSLVYSAANLSVLGDEELNIPIT
Sbjct: 361  LKKECSNAVNAINLSQEALFFFHKSARYWRIEYPSTISSLVYSAANLSVLGDEELNIPIT 420

Query: 421  ENLFSVIRNKYLCSEDNLDPSAWNAQDRYLWAANLFHTTDQSMRTINNLLTAIFSGTKPK 480
            ENLFSVIRNKYLCSEDNLDPSAWNAQDRYLWAANLFHTTDQSMRTINNLLTAIFSGTKPK
Sbjct: 421  ENLFSVIRNKYLCSEDNLDPSAWNAQDRYLWAANLFHTTDQSMRTINNLLTAIFSGTKPK 480

Query: 481  FSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKASEDYFVSLLQDMLKANA 540
            FSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKASEDYFVSLLQDMLKANA
Sbjct: 481  FSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKASEDYFVSLLQDMLKANA 540

Query: 541  IEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLCEVYGSDSLNLIKTAEKS 600
            IEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLCEVYGSDSLNLIKTAEKS
Sbjct: 541  IEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLCEVYGSDSLNLIKTAEKS 600

Query: 601  TMKMTGQKLGPIDALDMYDVLKELRQIYLQVKPKGKFFFNLENYFIKYLTRLCDDVSRNV 660
            TMKMTGQKLGPIDALDMYDVLKELRQIYLQVKPKGKFFFNLENYFIKYLTRLCDDVSRNV
Sbjct: 601  TMKMTGQKLGPIDALDMYDVLKELRQIYLQVKPKGKFFFNLENYFIKYLTRLCDDVSRNV 660

Query: 661  QKVIKSSLESENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITVILK 720
            QKVIKSSLESENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITVILK
Sbjct: 661  QKVIKSSLESENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITVILK 720

Query: 721  AFSDGMLSYSAQLMELIQRDLQEGDEPXXXXXXXXXXXXXXXNNANVNHEKSRSSRLFED 780
            AFSDGMLSYSAQLMELIQRDLQEGDEP               NNANVNHEKSRSSRLFED
Sbjct: 721  AFSDGMLSYSAQLMELIQRDLQEGDEPSYSLESSDTRSSLSLNNANVNHEKSRSSRLFED 780

Query: 781  LKNVVKSTPKMVAPAPYQFKKRTCVXXXXXXXXXXXXESFEEKADPSKISSVIAQYHSSH 840
            LKNVVKSTPKMVAPAPYQFKKRTCV            ESFEEKADPSKISSVIAQYHSSH
Sbjct: 781  LKNVVKSTPKMVAPAPYQFKKRTCVLLNDLDKTLFLLESFEEKADPSKISSVIAQYHSSH 840

Query: 841  NLEDNGKSFDDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTKIVAR 900
            NLEDNGKSFDDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTKIVAR
Sbjct: 841  NLEDNGKSFDDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTKIVAR 900

Query: 901  SITPKWDEEFVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLKDDGF 960
            SITPKWDEEFVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLKDDGF
Sbjct: 901  SITPKWDEEFVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLKDDGF 960

Query: 961  PIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDFIAFA 1020
            PIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDFIAFA
Sbjct: 961  PIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDFIAFA 1020

Query: 1021 FSRTTLKTVCGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLFMVMLRAWXX 1080
            FSRTTLKTVCGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLFMVMLRAW  
Sbjct: 1021 FSRTTLKTVCGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLFMVMLRAWNL 1080

Query: 1081 XXXXXXXXXXXXXXXXKVNILRSAKKSLWENTLSTTKTVSGYGRPLTQAEIEAVFKWLDA 1140
                            KVNILRSAKKSLWENTLSTTKTVSGYGRPLTQAEIEAVFKWLDA
Sbjct: 1081 VLENADLLLLPALNSAKVNILRSAKKSLWENTLSTTKTVSGYGRPLTQAEIEAVFKWLDA 1140

Query: 1141 LCVDFFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYLRWFYL 1200
            LCVDFFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYLRWFYL
Sbjct: 1141 LCVDFFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYLRWFYL 1200

Query: 1201 KKTPITFTNKSAGTISRKKSLVANIVKEPKEQLERDAEVMNIILRILIAKGQHDYVHRIL 1260
            KKTPITFTNKSAGTISRKKSLVANIVKEPKEQLERDAEVMNIILRILIAKGQHDYVHRIL
Sbjct: 1201 KKTPITFTNKSAGTISRKKSLVANIVKEPKEQLERDAEVMNIILRILIAKGQHDYVHRIL 1260

Query: 1261 HDRKEL 1266
            HDRKEL
Sbjct: 1261 HDRKEL 1266

>Scas_665.25
          Length = 1272

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1270 (35%), Positives = 718/1270 (56%), Gaps = 58/1270 (4%)

Query: 19   IPSICN----VINTELPTSDVYLYTLKLILLDYINEPRFK----EAALLSNRTGTSRVLS 70
            +P IC+       T+      Y + L+++LL+Y +EPRF+    +   LS R   S +  
Sbjct: 16   LPIICSNPSPFKTTDEERRTAYRHALQIVLLEYSHEPRFQKQYMQQGALSERKDVSNITL 75

Query: 71   DKTNHQQTQHGKKLVVDKQDDMSERDIVQATLRILKGKLAQISGNKNLAPNEMHWKSIVK 130
              T   +               SE   +   L +L+  + +I   +    NE   +S  +
Sbjct: 76   SMTQSNRDPMATTF--------SEEQALNYVLTLLREYIYKIIIREVDLQNENLRRSYSR 127

Query: 131  MYYSMLDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSEVAYFIDLVID 190
             Y ++L        +    +EE++  F+  ASNEL K+ IK+   E+  E   F++ ++ 
Sbjct: 128  FYGNILAGGPPSAMT----VEELIMQFSKAASNELCKLPIKDVSKEVTKETEEFVNFLLS 183

Query: 191  VLPDSCANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTISNKQPSFKVQD 250
            ++P     + +++ + + +++K    V  +R      +P+ + + G+ I+  +P+F V  
Sbjct: 184  LVPKEAPTLSQKIKNIR-DIQKVRKPVSNRRP-----LPR-QQLDGTQIN--RPNFTVSS 234

Query: 251  ISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNGTLTASDFSSD 310
            I+H KYF  LFE ++  L +D+  +  + T+ I+C EL  L   +KK  G+L+ +DF ++
Sbjct: 235  ITHAKYFANLFEVEDDYLQRDIDVILPNVTSKIYCWELSRLSNNLKKGKGSLSRNDFHNE 294

Query: 311  REYNLWKNYELLEIANLMDRFEIGEKVTSHGN--RLIPKDAKSVFVRLIGLVLKKECSNA 368
            REYN WKNYE  EIA+ +DRF +  +  +  N   +IP+  +  FV L+  V +KEC   
Sbjct: 295  REYNSWKNYEQGEIASQLDRFGVESRDLASMNFPNIIPQYPRETFVALLCFVFRKECPAD 354

Query: 369  VNAINLSQEALFFFHKSARYWRIEYPSTISSLVYSAANLSVLGDEELNIPITENLFSVIR 428
              +INLSQ A+FF  K ++YWR+++P+T+++LVYSAAN S+L  + LN  +TENLFS+IR
Sbjct: 355  SKSINLSQAAMFFLTKCSKYWRVDFPTTLAALVYSAANKSILSQDFLNPELTENLFSMIR 414

Query: 429  NKYLCSEDNLDPSAWNAQDRYLWAANLFHTTDQSMRTINNLLTAIFSGTKPKFSPVLSFY 488
             + L S+DN+D S WN  DR  W  NL  T  Q + ++  L++ ++   KP FSP+L FY
Sbjct: 415  RRILKSDDNIDTSIWNTTDRDQWILNLLTTGKQCINSLCGLISQLYEEPKPTFSPILRFY 474

Query: 489  YSNIVGDP-VMEFYETQSVAVKKYWIKLFKKTLFKASEDYFVSLLQDMLKANAIEIQNVQ 547
            +  I  DP +    E+     K  WIK  +K L   S D+++S ++ + + N IE Q+ Q
Sbjct: 475  FQYIEEDPFISSLLESNKFTEKSKWIKKLRKKLKDTSVDFYMSQIRKIPRDNTIEFQHYQ 534

Query: 548  NLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLCEVYGSDSLNLIKTAEKSTMKMTGQ 607
            ++VE+I   IK +QK+Y+KPLLD I++P  CA  L +V+ +D + ++ T EK   K    
Sbjct: 535  DVVESIYRQIKLLQKKYSKPLLDMINIPVSCADILLKVFCTDVVKILGTIEKKGKK---D 591

Query: 608  KLGPIDALDMYDVLKELRQIYLQVKPKGKFFFNLENYFIKYLTRLCDDVSRNVQKVIKSS 667
             LGP +ALD+Y  +K+LR IY+QV+ +  F   LE++F KYL RLC++ +    K+IK S
Sbjct: 592  SLGPSNALDLYKSMKDLRFIYVQVETEEDFPIKLEDFFNKYLRRLCNEATLTEDKIIKKS 651

Query: 668  LESENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITVILKAFSDGML 727
            L+ E W+ ++D    S SV DIFK IN++  M ++  W +E+Q+A+++T +L +F DG+ 
Sbjct: 652  LKDEKWESIHDDARISFSVTDIFKSINQNIKMFQEIEWGDEYQIAKVLTKLLNSFLDGLQ 711

Query: 728  SYSAQLMELIQRDLQEGDEPXXXXXXXXXXXXXXXNNANVNHEKSRSSRLFEDLKNVVKS 787
             YS  +++LIQRD+Q                         N     SS L   L+ VV  
Sbjct: 712  FYSKFVLDLIQRDMQGNS--------ATMAPEGTTRTTEKNVSARPSSTLLHGLRKVVGG 763

Query: 788  TPKMV---APAPYQFKKRTCVXXXXXXXXXXXXESFEEKADPSKISSVIAQYHSSHNLED 844
            +        P PYQ+K +TCV             + E+  +P ++SS+I  +  S     
Sbjct: 764  SSSSSSSNVPPPYQYKVQTCVMLNDLYQMKSNISTIEDLVNPERLSSIIKNHEKSTKTLK 823

Query: 845  NGKSFDDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTKIVARSITP 904
               S     M Q YT+R++ A +IKGFS  GLSNT V+++NI  + EIG+T+I+ +S+ P
Sbjct: 824  RHSSVTPSVMHQFYTIRVVEANDIKGFSNDGLSNTSVTLQNIDARMEIGSTQIIHKSVNP 883

Query: 905  KWDEEFVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLKDDGFPIDF 964
            KWD+EF  + P+ K+  I    WHHP +R K+L  D++CG A +   P++ KDDG+P D 
Sbjct: 884  KWDQEFEVDLPYNKACSISIKFWHHPTNRFKSLGGDEICGTAMLTLDPKRFKDDGYPNDV 943

Query: 965  SLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDFIAFAFSRT 1024
            SL LN QG +Y Q+SLESEK D   S+G+ YR+  R+ DR ++LIV KF+ FI F+FSR 
Sbjct: 944  SLPLNDQGMIYLQVSLESEKDDVSFSLGKSYRTLDRTCDRVLDLIVEKFTLFIKFSFSRE 1003

Query: 1025 TLKTVCGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLFMVMLRAWXXXXXX 1084
            TL ++ G  G+   +++ + DAI+PL++Y++ NLNIL S +S  LL  ++L+ W      
Sbjct: 1004 TLVSLHGSEGTNQVTEDQIGDAIVPLYNYIDLNLNILGSGVSTELLNAIILKVWLVIMTS 1063

Query: 1085 XX-XXXXXXXXXXKVNILRSAKKSLWENTLSTTKTVSGYGRPLTQAEIEAVFKWLDALCV 1143
                         + +  +S++ SLW      +  +SGYGRPLT  EI+ +F+WL ++ V
Sbjct: 1064 ADFLMLPSLSTAEQKHRSKSSRMSLWG---GHSHDISGYGRPLTFNEIKTIFRWLRSISV 1120

Query: 1144 DFFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYLRWF---YL 1200
            DF +N G+GPPL EL N YY+N+ +I  +YDK+V  LK +V++L+   ++ ++     Y 
Sbjct: 1121 DFLYNNGQGPPLKELHNHYYENLQIILKYYDKNVHSLKKKVEKLMAQLDDQVKKLGKDYS 1180

Query: 1201 KKTPITFTNKS----AGTISRKKSLVANIVK-EPKEQLERDAEVMNIILRILIAKGQHDY 1255
             K  +T   +       + S+K+  + N VK E     E+  E+++I+LRILIAKG+  Y
Sbjct: 1181 PKRYVTVLQRQKTIMGNSSSKKRMELENQVKIEQNTPYEKTTELLDIVLRILIAKGEGKY 1240

Query: 1256 VHRILHDRKE 1265
            V      RK+
Sbjct: 1241 VRACQATRKK 1250

>ABL016C [576] [Homologous to ScYOR296W - SH] (367026..371012) [3987
            bp, 1328 aa]
          Length = 1328

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1303 (35%), Positives = 730/1303 (56%), Gaps = 78/1303 (5%)

Query: 19   IPSICNVINTELPTSDVYLYTLKLILLDYINEPRFKEAALLSNRTGTSRVLSDKTNHQQT 78
            +PS+      ++  +++Y   LK++LL+YINEPRF+      N   T  +   +    ++
Sbjct: 22   LPSVEESYKPDVSKAELYQSLLKVVLLEYINEPRFRRQYQRLNDVETGELFPRERQPVRS 81

Query: 79   QHGKKLVV----DKQDDMSERDIVQATLRILKGKLAQISGNKNLAPNEMHWKSIVKMYYS 134
            +  +K       + + + +E + ++    IL+G+L+ I+  K    ++   +S++K+Y  
Sbjct: 82   RDDRKRATWFWPNGELESTEGNALKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYND 141

Query: 135  M-LDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSEVAYFIDLVIDVLP 193
            + LD + ++    MG+ EE++  F   AS E+ K+ +++++ EL+ +V+ FID++ID+L 
Sbjct: 142  LYLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLA 201

Query: 194  D---SCANIIKRLLDYKINLKK--GETTVKKKRAASPATVPQYRSISGSTIS-NKQPSFK 247
                S    + +L  Y  + K   GE ++   R+ S   VP   ++ G+ I    +P+F 
Sbjct: 202  RCEVSTPEFVSKLRSYTDSFKPEDGEGSI---RSRSSQGVP---AVGGNCIEVTVKPAFT 255

Query: 248  VQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNGTLTASDF 307
            V +ISH  Y M+LF  DE +   DV+ +KD   N  +  EL  ++  IK  NG  TA DF
Sbjct: 256  VSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIKHSIKS-NGGFTADDF 314

Query: 308  SSDREYNLWKNYELLEIANLMDRFEIGEKVTSH--------GNRLIPKDAKSVFVRLIGL 359
             +   Y  WK YEL  I +L++R E  E    H        G ++IP +++ + V+L+ +
Sbjct: 315  PTKELYEQWKEYELHAIDDLINRLE--ENKARHNESLSKKAGVKVIPANSRGMLVKLLCI 372

Query: 360  VLKKECSNAVNAINLSQEALFFFHKSARYWRIEYPSTISSLVYSAANLSVLGDEELNIPI 419
            +L++E  +  +   LS +A F   K ARYWR++Y ST  SL Y+A NL++L D E+    
Sbjct: 373  LLEREQPSQTSP--LSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTLLDDGEMLKDD 430

Query: 420  TENLFSVIRNKYL-CSEDNLDPSAWNAQDRYLWAANLFHTTDQSMRTINNLLTAIFSGTK 478
             E+L    ++K    S+   + + WNA DR+ W  NL HT    M  ++ +L+ I+S  K
Sbjct: 431  IEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHLMLSGIYSKPK 490

Query: 479  PKFSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKASEDYFVSLLQDMLKA 538
            PKFSPVL+ YY+ +  DP+M  Y          W+K  K+ L   SEDY+ SL++   K 
Sbjct: 491  PKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDYYASLVKQA-KK 549

Query: 539  NAIEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLCEVYGSDSLNLIKTAE 598
                + ++Q++ E I++ +K IQKRY KPLLDEI++ R CAV   + + +D    I  AE
Sbjct: 550  EPFGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFLADLPEFINDAE 609

Query: 599  KSTMKMTGQKLGPIDALDMYDVLKELRQIYLQVKPKG-KFFFNLENYFIKYLTRLCDDVS 657
            ++ +    + L P  AL+ Y  ++EL+ I++Q+KPK   F   + N F KYL RLC D  
Sbjct: 610  QNALAENTEVL-PAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYLVRLCADTC 668

Query: 658  RNVQKVIKSSLESENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITV 717
              V +VI +SL+ E W+P+++  H+S SVLDIFKM+NES  + EK  W+NE+++A+  T 
Sbjct: 669  VRVHEVIHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTR 728

Query: 718  ILKAFSDGMLSYSAQLMELIQRDLQEGDEPXXXXXXXXXXXXXXXNNANVNHEKSRSSRL 777
            +LK+FSDG+  Y+A+++ +I+ DL + D                   A    E+ +++ L
Sbjct: 729  LLKSFSDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTA----ERMKNTWL 784

Query: 778  FEDLKNVVKSTPKMVAPA-PYQFKKRTCVXXXXXXXXXXXXESFEEKADPSKISSVIAQY 836
            F +++N +   P +  P   Y+FK+RTCV               EE  +  KIS  I+++
Sbjct: 785  FNEMRNAL--MPALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKH 842

Query: 837  HSSHNLEDNGKSFDDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTK 896
                 +ED  K   D+ + Q+YT+RI+ AENI  F+  G SN+ V++ + ++QREI  TK
Sbjct: 843  QV--KVEDK-KDRSDKAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTK 899

Query: 897  IVARSITPKWDEEFVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLK 956
            +V +++ P WDE F    P G++  I  T+WHH  +++  ++   +CGK ++   P   +
Sbjct: 900  VVRKTVNPMWDELFELVVPAGEARMISATVWHH-SAKINPVSSYKVCGKCSLLLDPTVYR 958

Query: 957  DDGFPIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDF 1016
             DG+P + +L L+ QG L  Q+SLESE+ DA+  +GR +R+ SR+ DRAI L+V+KF+ F
Sbjct: 959  SDGYPQETNLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAF 1018

Query: 1017 IAFAFSRTTLKTVCGHH-----GSALASDEAVYDAILPLFDYLNANLNILASELSQRLLF 1071
            + F+ SR  LKTV         G A      VYDAILPLFDYLN+NL ILA+EL++ LL 
Sbjct: 1019 VNFSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLH 1078

Query: 1072 MVMLRAWXXXXXXXXXXXX--XXXXXXKVNILRSAKKSLWENTLSTTK-----------T 1118
             VML+AW                    +  ++ S   +LWEN +S  K           T
Sbjct: 1079 KVMLQAWNTILHSADALLLPNLSCARSRKKVMSSKSMTLWENAMSMAKGDSSDSAAAAAT 1138

Query: 1119 VSGYGRPLTQAEIEAVFKWLDALCVDFFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVS 1178
            + G+G  LT  EI+ VF WL ALCVDFFHN GEGPPL +LKN++YQN+LL+P FYDK+  
Sbjct: 1139 IPGFGSALTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAAD 1198

Query: 1179 ELKDEVQRLIPLYEEYL---RWFYLKKTPITFTNKSAGTISRKKSLVANIVKEPK----- 1230
            EL+ EV+RL+P YE+YL    +F   +   +      G+++RK S+ A+  +  +     
Sbjct: 1199 ELQAEVERLMPFYEQYLDRRNYFDFGRHTASRPALPKGSLARKDSVWAHSSRRKRAQVAA 1258

Query: 1231 --EQLERD-----AEVMNIILRILIAKGQHDYVHRILHDRKEL 1266
               QLE D     A   +I+LRIL+ +G+  YV   L  R EL
Sbjct: 1259 AVRQLEHDPLEVAAVTQDILLRILLLRGRAAYVQDTLSRRAEL 1301

>CAGL0G07579g 716580..720413 similar to tr|Q08748 Saccharomyces
            cerevisiae YOR296w, start by similarity
          Length = 1277

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1276 (32%), Positives = 699/1276 (54%), Gaps = 58/1276 (4%)

Query: 19   IPSICNVINTELPTSDVYLYTLKLILLDYINEPRFKEAALLSNRTGTSRVLSDKTNHQQT 78
            I S  N  + E    + Y YTL +ILL+Y+ EPRF       N TG  + L D+ N Q++
Sbjct: 11   IYSEVNSADDESILKETYHYTLIVILLEYMAEPRFH-----VNSTGAPQPLRDEMN-QKS 64

Query: 79   QHGKKLVVDK------QDDMSERDIVQATLRILKGKLAQISGNKNLAPNEMHWKSIVKMY 132
            + G+ L+ ++      Q+  S +D +   L  L  +L+ I+ N+    +    + ++K Y
Sbjct: 65   KSGEFLLREQSSIGSYQNSSSAKDYL---LVALTERLSLITRNQIKVTDPNFKRCLLKFY 121

Query: 133  YS-MLDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSEVAYFIDLVIDV 191
                LD +      +   +E++V YF+  A+ EL K+ + N   EL+ +VA F++L+I+ 
Sbjct: 122  NDYFLDPNMKIKLKQTSNIEDIVAYFSQSANKELNKVLLDNFSLELYRQVASFLELLINC 181

Query: 192  LPDSCANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTI---SNKQPSFKV 248
             P+      K + D+K  L+  ++T +  R   P T  +Y     S +   + +QPS+ +
Sbjct: 182  TPE------KYMADFKPKLEAMKSTFEPNRY-RPLT-KRYSLDMNSNVPITAQRQPSWNL 233

Query: 249  QDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNGTLTASDFS 308
             DISH+ YFM+LF  D+ K+  DV  +    +   +  EL  LR K+K  + +L+ SDF 
Sbjct: 234  DDISHIGYFMKLFAMDKMKIQYDVNDILKHLSLSSYKNELLELRVKVKNSSFSLSVSDFP 293

Query: 309  SDREYNLWKNYELLEIANLMDRFEIGEKVTS--HGNRLIPKDAKSVFVRLIGLVLKKECS 366
            ++REY  W+NY   E   L+D+F   E++++       IP + K++  +L  L+++ E  
Sbjct: 294  TEREYRNWQNYIFGETTQLIDKFS-SEQISNINAPTPCIPSNRKAIISKLFELIIQSEYK 352

Query: 367  NAVNAINLSQEALFFFHKSARYWRIEYPSTISSLVYSAANLSVLGDEELNIPITENLFSV 426
            N    + LS+E+ FF  K A+YW  ++PSTI+SL ++A N  +  ++ LN+   E    +
Sbjct: 353  NDEKVLALSKESTFFIFKCAKYWLSDFPSTIASLFFAAMNKVLFTNDMLNVEFVEKSIMM 412

Query: 427  IRNKYLCSEDNLDPSAWNAQDRYLWAANLFHTTDQSMRTINNLLTAIFSGTKPKFSPVLS 486
            + N +L S +  + + WN  DR LW   L     ++ ++I+ LL+ +F    P FSP LS
Sbjct: 413  VSNLFLRSRETKELTTWNNYDRILWVKTLRVICSKTFKSISILLSKLFDPNLPSFSPYLS 472

Query: 487  FYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKASEDYFVSLLQDMLKANAIEIQNV 546
            FY++    D   E Y  +S + +K W +  +  + +A + Y+ SL+  + +   +EIQ++
Sbjct: 473  FYFTIKYTDRYTEDY-LKSTSFEKKWAESLRNNINRACQTYYQSLVSTLPRDETLEIQHI 531

Query: 547  QNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLCEVYGSDSLNLIKTAEKSTMKMTG 606
            Q++ E I + I+ +QK+Y KP+ +++++    A FL   +  D   +++   K   K+  
Sbjct: 532  QDIAEKIYKMIEKLQKKYPKPMFEDVNIAFVVADFLINAFLVDLETMLRFV-KHYHKIAS 590

Query: 607  QKLGPIDALDMYDVLKELRQIYLQVKPKGKFFFNLENYFIKYLTRLCDDVSRNVQKVIKS 666
            + + P+D L+ Y  + +LR+IY+Q+KP   F  NLE+ F ++L  L DD+ + +  V+KS
Sbjct: 591  KSIAPVDGLECYKAIVDLREIYVQIKPNELFPINLESMFGQFLQALNDDIKKRIMHVVKS 650

Query: 667  SLESENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITVILKAFSDGM 726
            S+++E W  +ND  ++S S++DIF+++NE+  +  KF W++++++A + T IL  F++G+
Sbjct: 651  SIKAEKWVRMNDATYYSTSIVDIFRLVNEAVQIFTKFDWEDQYEIAYLTTNILSEFTEGL 710

Query: 727  LSYSAQLMELIQRDLQEGDEPXXXXXXXXXXXXXXXNNANVNHEKSRSSRLFEDLKNVVK 786
              Y ++L  L + DLQ                    ++     +K   +  F  +K  +K
Sbjct: 711  KYYCSKLQNLAENDLQMD----VINLITVTPESTPLSSGIEKLDKKGKTWSFHQMKRALK 766

Query: 787  STPKMVAPAPYQFKKRTCVXXXXXXXXXXXXESFEEKADPSKISSVIAQYHSSHNLEDNG 846
            S P ++ PAPY++  RTCV               +E   P ++S    +Y S    + N 
Sbjct: 767  SKPSIMVPAPYEYTVRTCVILNNLDAMLGMITRLDELVKPQELS----KYLSEAKAKPNR 822

Query: 847  KSFDDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTKIVARSITPKW 906
             + +  N+  ++T+R++    +   +  G SN  V++ +   + E+G+T+I+  S+ P W
Sbjct: 823  STENSNNINHIFTIRVLNTMEVHADTNDGFSNLRVTLNDSNRKSELGSTRIIEDSLNPIW 882

Query: 907  DEEFVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLKDDGFPIDFSL 966
            DEEF       +   I F +WH  HS  KN    +LC K ++   P++  D+G P + S+
Sbjct: 883  DEEFELRISNKEKAYIDFLVWH--HSDAKNTKMVELCAKGHVVLDPKRFSDNGLPSEMSI 940

Query: 967  TLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDFIAFAFSRTTL 1026
             ++P+G L   ++LE+EK+D +  +G  YR+  RS+++ +N+IV KFS  +A   S+ TL
Sbjct: 941  AMSPKGHLNIHVTLETEKMDPLFCIGNAYRTALRSKEKLLNMIVTKFSTVVAHIISKNTL 1000

Query: 1027 KTVCGHHGSALASD--EAVYDAILPLFDYLNANLNILASELSQRLLFMVMLRAW-XXXXX 1083
            K V     + +  D  E VYDAI+PLFDYLN+NL+ILASEL + LLF V+L+AW      
Sbjct: 1001 KFVKAEKKNYVGKDAEEVVYDAIVPLFDYLNSNLSILASELPKELLFEVILKAWDVILLR 1060

Query: 1084 XXXXXXXXXXXXXKVNILRSAKKSLWENTLSTTKTVSGYGRPLTQAEIEAVFKWLDALCV 1143
                            ++ SA+KS+W N++S+  T+SG+G+PLT+ +I  VFKWLDALC+
Sbjct: 1061 ADSMLLPSLSSISSSGLVNSARKSIWRNSISSNPTISGFGKPLTEEDISIVFKWLDALCI 1120

Query: 1144 DFFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYLRWFYLK-K 1202
            DFFHN+G GP +  LKN  Y ++L IP FY  SV ELK  + +L   Y++YL   Y +  
Sbjct: 1121 DFFHNEGAGPSIENLKNVKYTSMLNIPKFYGTSVPELKKLILQLEKSYDQYLDHIYNQDH 1180

Query: 1203 TPITFTNKSAGTISRKKSLVANIVKEPKEQL-------ERD-----AEVMNIILRILIAK 1250
              I         +SR  +++ +  K  +EQL       E D     A+ M++ILRIL+AK
Sbjct: 1181 ATIQLIRTQTMGVSRHATIMGSSTKATREQLKDIIKEEEHDPLKISADKMDVILRILLAK 1240

Query: 1251 GQHDYVHRILHDRKEL 1266
            G+  +V++ L  RK+L
Sbjct: 1241 GEFHFVYKNLERRKKL 1256

>Kwal_55.20302
          Length = 710

 Score =  447 bits (1151), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/672 (36%), Positives = 377/672 (56%), Gaps = 33/672 (4%)

Query: 611  PI-DALDMYDVLKELRQIYLQVKPKGKFFFNLENYFIKYLTRLCDDVSRNVQKVIKSSLE 669
            PI DA + Y  L+EL  IY QV+P   F F LE YFIKYL+ LCD+   +   VI+++LE
Sbjct: 18   PIYDATETYKSLRELADIYAQVEPSKSFPFKLERYFIKYLSELCDEACSSTLGVIQTALE 77

Query: 670  SENWQPVNDQDHFSRSVLDIFKMINESTSMLEKFGWQNEFQLAQMITVILKAFSDGMLSY 729
             E W+P+     +S SV+D+FKMI+ES  +  K  W N +Q++++ T +LKA +DG+  Y
Sbjct: 78   KETWEPIEYSTGYSTSVVDVFKMIHESFDLFLKLNWGNGYQISKIYTFLLKAVADGLSLY 137

Query: 730  SAQLMELIQRDLQEGDEPXXXXXXXXXXXXXXXNNANVNHEKSRSSRLFEDLKNVVKSTP 789
            ++ + +LI+ +++                      +     K + + L+ ++KN +KS  
Sbjct: 138  ASNVAKLIEDEVKSTQSEETEAESYGNENKRLSILSQTAAAKMKKTWLYGEMKNALKSN- 196

Query: 790  KMVAPAPYQFKKRTCVXXXXXXXXXXXXESFEEKADPSKISSVIAQYHSSHNLEDNGKSF 849
            ++  P P++F+ +TCV               EE+ +P ++S  + ++  S+         
Sbjct: 197  EISIPKPFKFQNKTCVCLSNLDRMMQMVTELEERVNPDEVSKAVNKHEISNAKSRKKAEM 256

Query: 850  DDQNMKQVYTLRIIGAENIKGFSKTGLSNTYVSMRNITLQREIGTTKIVARSITPKWDEE 909
             ++ ++ +YT+++I AENI+  +    + + +S+ +   +RE  TT+ V +   P W+EE
Sbjct: 257  QNRGLRHIYTVKVIRAENIRVAANDSNTLSSISIIDTNNRREFATTREVLKVTRPIWNEE 316

Query: 910  FVFESPFGKSNDIMFTIWHHPHSRLKNLAEDDLCGKANMKFTPRKLKDDGFPIDFSLTLN 969
            F  E P        F +WHH  S   N     + G++ +   P K++DDG+P D SL L+
Sbjct: 317  FEIEIPMDDVRPFNFILWHHKQSF--NSVNSKVYGRSFLYLNPHKMRDDGYPQDISLNLD 374

Query: 970  PQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDFIAFAFSRTTLKTV 1029
              G +  Q+S+E+EK+DA+ SMGR YRS +R+ DR+I LIV+KF  F+ FAFS+ TL+ V
Sbjct: 375  TTGQVLLQVSVETEKVDALFSMGRAYRSLNRALDRSIELIVSKFQVFVHFAFSKATLRAV 434

Query: 1030 CGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLFMVMLRAWXXXXXXXXXXX 1089
            CG +G   A   AVYD+ILPLFDYLNANL+ILA+ L + LL+ +ML AW           
Sbjct: 435  CGPNGQIRADKTAVYDSILPLFDYLNANLDILATRLPRELLYKIMLEAWDEILIQADDLL 494

Query: 1090 XXXXXXXKVNILRSAK-KSLWENTLSTTK----TVSGYGRPLTQAEIEAVFKWLDALCVD 1144
                        R+ K KSLWEN +   K    + S   RPLTQ EI+ +F WL ALC+D
Sbjct: 495  LPLSSDAPKLRNRNIKNKSLWENAVGAAKLGISSNSSSERPLTQIEIDTIFDWLRALCID 554

Query: 1145 FFHNKGEGPPLAELKNEYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYLRWFYLKK-- 1202
            FFHN GEGP L++LKN +YQ +LL+P FYD++V EL  EV RL   Y + +  F   K  
Sbjct: 555  FFHNNGEGPSLSDLKNAHYQKLLLVPVFYDRTVHELMSEVDRLNKEYRDSM--FAQNKIS 612

Query: 1203 ----TPITFTNKSAGTISRKKSLVANIVKEPKEQLERDAEV--------------MNIIL 1244
                       +   TI+R+K+++AN  +  K ++E D E+               +++L
Sbjct: 613  TKGSAETNLIKRRVNTIARRKTIIANSSR--KRRMELDKEIKAAEENPIENIISTQDVLL 670

Query: 1245 RILIAKGQHDYV 1256
            RIL+AKG+ ++V
Sbjct: 671  RILMAKGETEFV 682

>KLLA0B13002g complement(1134173..1138306) weakly similar to
           sgd|S0005822 Saccharomyces cerevisiae YOR296w,
           hypothetical start
          Length = 1377

 Score =  225 bits (574), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 207/812 (25%), Positives = 387/812 (47%), Gaps = 95/812 (11%)

Query: 35  VYLYTLKLILLDYINEPRFKE---------------AALLSNRTGTSRVLSDKTNHQQTQ 79
           VY   LK++L  YINEPRF+                    S+  G++R LS   +H  + 
Sbjct: 40  VYSNVLKVVLFAYINEPRFRRKWKRVGSNVNSQRLRVKGASHDNGSNR-LSTWFSHDPSD 98

Query: 80  HGKKLVVDKQD---DMSERDIVQATLRILKGKLAQISGNKNLAPNEMHWKSIVKMYYSM- 135
              +   ++         ++ ++  L+ L+ KL +I+ N+++  + M  +S++K Y  + 
Sbjct: 99  DEDEDDNNRSSIGGSSYNKESMKQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVF 158

Query: 136 LDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSEVAYFIDLVIDVLPDS 195
           LDS    T   M + E+++  F   A+ EL K+  K+ + +LF +++ FI+++ID+  D+
Sbjct: 159 LDSQFKQTLGTMTKPEDLIILFVKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDT 218

Query: 196 --CANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTISNK----------- 242
                 +KRL  YK +LK+G+     KR+ SP        I+G+ +++K           
Sbjct: 219 KMGPTYVKRLNAYKNSLKQGDNN---KRSPSP--------INGNVMTSKDEESKLVDDTL 267

Query: 243 QPSFKVQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNGTL 302
           QP+F++ +I+H K    +F  DE KL +DV+ +     N ++  EL    + I KD   L
Sbjct: 268 QPTFRLSEITHSKILTTIFGVDELKLQRDVIRLSLSVKNDLYLHELSQYEQAIMKDEAEL 327

Query: 303 TASDFSSDREYNLWKNYELLEIANLMDRFEIG-------EKVTSHGNRLIPKDAKSVFVR 355
              DF +  +Y+ WK+++L  ++ L D+ + G        K  +   +LIP D + +F  
Sbjct: 328 KPIDFGTMDQYSDWKDHQLKHLSELKDKVKHGFSGHNESGKNITKDMQLIPNDPRLIFQT 387

Query: 356 LIGLVLKKEC--SNAVNAINLSQEALFFFHKSARYWRIEYPS-----TISSLVYSAANLS 408
           L+ L+LK +       N  ++S ++ F   +  RYW I+Y S      +S  ++   NL 
Sbjct: 388 LVNLILKHDFVRQERDNEASISLDSKFLLSRCLRYWLIDYGSAVFVNAVSGCLHLIRNL- 446

Query: 409 VLGDEELNIPITENLFSVIRNKY-LCSEDNLDPSAWNAQDRYLWAAN----LFHTTDQSM 463
              D    + +T+ +F  +  +  + + ++ DP  WN +D+  W+ N        TD+  
Sbjct: 447 ---DFPEGMKMTQYVFGFMETRLSVEAPEHTDPLGWNKKDQDQWSTNQVTIFLWLTDEVY 503

Query: 464 RTINNLLTAIFSGTKPKFSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKA 523
           R I  + ++    TK K   V+S Y++ +  D V+   + Q   + K  I   KK  F  
Sbjct: 504 RCIECMFSSKTRDTKLK--SVISTYHALVEHDSVLIERDFQKSDMYKKQIHKLKKKTFLT 561

Query: 524 SEDYFVSLLQDMLKANAIEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLC 583
            E  ++SL++ +   + I I+++  L E+I++ I  I+ +Y KPL +  S  +   + + 
Sbjct: 562 IEQRYISLIRHVPTDSEISIKHLHGLCESILDDIALIETKY-KPLTNLSSRYKFVGIIIH 620

Query: 584 EVYGSDSLNLIKTAEKSTMKMTGQKLGPI--DALDMYDVLKELR-QIYLQVKPKGKFFFN 640
             + +   +L     K  M+   +   PI  DALD Y +L ELR + Y +          
Sbjct: 621 TYFSALFRDL-----KILMQRIKKYNKPIDTDALDTYKLLNELRWKNYEESGSISSEGSI 675

Query: 641 LENYFIKYLTRLCDDVSRNVQKVIKSSLESENWQPVNDQ--DHFSRSVLDIFKMINESTS 698
           LE  F KYL   C++    V++  +  +  E W+P++ +    +SRS  DI ++I+++  
Sbjct: 676 LEPIFYKYLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYSRSAYDISRLISDTLR 735

Query: 699 MLEKFGWQNEFQLAQMITVILKAFSDGMLSYSAQLMELIQRDL--QEGDEPXXXXXXXXX 756
           ++E+  W +  QL    +V+L   S+ +L Y+  + ++++ DL   E DE          
Sbjct: 736 LVEQLQWNDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCISENDE---------- 785

Query: 757 XXXXXXNNANVNHEKSRSSRLFEDLKNVVKST 788
                     + H       +F+D+K+ ++S+
Sbjct: 786 ---QNGQGQGMGHRLGNDVSIFKDMKSAIQSS 814

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 129/278 (46%), Gaps = 49/278 (17%)

Query: 957  DDGFPIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDF 1016
            + G      L L+ QG ++ ++ LE E+ +    +G+  R  +R   +++  + N+F   
Sbjct: 1058 ESGLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPC 1117

Query: 1017 IAFAFSRTTLKT-----VCGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLF 1071
            I  +FS+ +L       V G       +D+ +YD+++PLFD+LN NL +LA  L   LL 
Sbjct: 1118 INDSFSKKSLSMSLSSSVPGQR----PTDDDIYDSLVPLFDHLNENLTVLAQALPTALLH 1173

Query: 1072 MVMLRAWXXXXXXXXXXXXXXXXXXKVNILRSAK-------------------KSLWENT 1112
             +ML+ W                   ++   +++                    S+W+  
Sbjct: 1174 QIMLQVWNKILVAADALLLPPLQLASISSSANSEYNFGSRGNRMSYSGSTRGSSSVWDTA 1233

Query: 1113 LSTTKTV------SGYGRPL-----------TQAEIEAVFKWLDALCVDFFHNKGEGPPL 1155
            +S  + V      +G+  P            T  E+E VF W+D LC DFFHN GEGPPL
Sbjct: 1234 VSGFQKVLQKPGFTGWSSPFSNNSNYNNTVGTSLEVEIVFMWIDILCRDFFHNNGEGPPL 1293

Query: 1156 AELKNEYYQNILLIPAFYDKSVSELK----DEVQRLIP 1189
             +LKN+ YQ ++LI + +D    ELK    +E QR +P
Sbjct: 1294 DKLKNDQYQQLMLIASLFDNETCELKQTIEEEDQRSVP 1331

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 96  DIVQATLRILKGKLAQISGNKNLAPNEMH---WKSIVKMYYSMLDSSSADTFSKMGQMEE 152
           + +QA  R L+ K + +    NLA + M+   +K       S+L     +T +K G +  
Sbjct: 509 EAIQAYHRALQLKPSFVRARYNLAVSSMNIGCFKEAAGYLLSVLSMHEVNTNNKKGDVGS 568

Query: 153 VVGYFTNIASNELKKMTIKNSRDELFSEVAYFIDL 187
           ++  + +     LK++ I  +RD+L  EV   +DL
Sbjct: 569 LLNTYNDTVIETLKRVFIAMNRDDLLQEVKPGMDL 603

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 38,842,109
Number of extensions: 1683822
Number of successful extensions: 5568
Number of sequences better than 10.0: 27
Number of HSP's gapped: 5697
Number of HSP's successfully gapped: 29
Length of query: 1266
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1153
Effective length of database: 12,684,275
Effective search space: 14624969075
Effective search space used: 14624969075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)