Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR294W (RRS1)2032009521e-133
CAGL0G07535g2031967791e-106
ABL014C2051997501e-102
Kwal_55.203102051987461e-101
KLLA0B13046g2042007341e-99
Sklu_1837.32081997298e-99
Scas_665.272032007211e-97
YDL095W (PMT1)81731624.7
YDL093W (PMT5)74321616.0
CAGL0I02464g81659608.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR294W
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR294W (RRS1) [5078] chr15 (868337..868948) Regulator of riboso...   371   e-133
CAGL0G07535g 714360..714971 highly similar to sp|Q08746 Saccharo...   304   e-106
ABL014C [578] [Homologous to ScYOR294W (RRS1) - SH] (372112..372...   293   e-102
Kwal_55.20310                                                         291   e-101
KLLA0B13046g complement(1139556..1140170) similar to sp|Q08746 S...   287   1e-99
Sklu_1837.3 YOR294W, Contig c1837 3113-3739 reverse complement        285   8e-99
Scas_665.27                                                           282   1e-97
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...    28   4.7  
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...    28   6.0  
CAGL0I02464g 217697..220147 similar to sp|P38863 Saccharomyces c...    28   8.7  

>YOR294W (RRS1) [5078] chr15 (868337..868948) Regulator of ribosome
           synthesis [612 bp, 203 aa]
          Length = 203

 Score =  371 bits (952), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/200 (93%), Positives = 187/200 (93%)

Query: 1   MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQL 60
           MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQL
Sbjct: 1   MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQL 60

Query: 61  LINQLLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAK 120
           LINQLLSLPMKTTTESVGGTGGQSSVM             REKPLPKAKAMTKWEKFAAK
Sbjct: 61  LINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAK 120

Query: 121 KGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLN 180
           KGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLN
Sbjct: 121 KGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLN 180

Query: 181 RAERKRLVKKNEKQQRRNMK 200
           RAERKRLVKKNEKQQRRNMK
Sbjct: 181 RAERKRLVKKNEKQQRRNMK 200

>CAGL0G07535g 714360..714971 highly similar to sp|Q08746
           Saccharomyces cerevisiae YOR294w RRS1 regulator of
           ribosome synthesis, hypothetical start
          Length = 203

 Score =  304 bits (779), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 167/196 (85%)

Query: 5   DYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLLINQ 64
           +YKNLPVTVEKPIPV YDLGNL+ FD+NV+D+ND+DSSNA+REE IKS+TRDNVQLLINQ
Sbjct: 3   EYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLINQ 62

Query: 65  LLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAKKGIK 124
           LLSLP+K TTE  GG  GQ + +             REKPLPK KA+TKW+KFAAKKGIK
Sbjct: 63  LLSLPIKKTTEHTGGNSGQGATVALLQLPEPSSELPREKPLPKPKALTKWQKFAAKKGIK 122

Query: 125 PKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAER 184
           PKERAGKM++DEA+G+W PKWGY G NKKLDDQWLVEVDD  KGT+NELIDPR+LNRAER
Sbjct: 123 PKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAER 182

Query: 185 KRLVKKNEKQQRRNMK 200
           KRLVKKNE+QQ++N+K
Sbjct: 183 KRLVKKNERQQKKNLK 198

>ABL014C [578] [Homologous to ScYOR294W (RRS1) - SH]
           (372112..372729) [618 bp, 205 aa]
          Length = 205

 Score =  293 bits (750), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 165/199 (82%), Gaps = 2/199 (1%)

Query: 2   SAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLL 61
           S+ +   LPVTVEKPIPV YDLGNLA FDSN LD+NDLDSSNA REE +++LTRDNVQLL
Sbjct: 4   SSAEKSELPVTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANREEHLRALTRDNVQLL 63

Query: 62  INQLLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAKK 121
           INQ+LSLP+K+TT+S G   GQSS +             REKPLPK KA TKWE FAAKK
Sbjct: 64  INQILSLPIKSTTDSTGS--GQSSSIALVRLPEPTTDLPREKPLPKPKAPTKWELFAAKK 121

Query: 122 GIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNR 181
            IKPKE++GKM+YDEA+GEWVPKWGYKGANKKLDDQWLVEVDDKVKGT+ ELIDPRTL+R
Sbjct: 122 NIKPKEKSGKMVYDEAAGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTEEELIDPRTLSR 181

Query: 182 AERKRLVKKNEKQQRRNMK 200
           AERK+L+KKNE Q +RN+K
Sbjct: 182 AERKKLIKKNELQHKRNLK 200

>Kwal_55.20310
          Length = 205

 Score =  291 bits (746), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%)

Query: 3   AEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLLI 62
           AE+ K+LPVTVEKPIPV YDLGNLA FD N LD+ND DSSNA+RE+ IKS+TR+NVQL+I
Sbjct: 5   AEEKKSLPVTVEKPIPVAYDLGNLAVFDPNTLDRNDFDSSNAQREKNIKSVTRENVQLMI 64

Query: 63  NQLLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAKKG 122
           NQ+LSLP+K+TTES GGT GQS+ M             REKPLPK KA TKWEKFAA KG
Sbjct: 65  NQILSLPIKSTTESAGGTSGQSASMTLVQLPEPTTELPREKPLPKPKAPTKWEKFAAIKG 124

Query: 123 IKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRA 182
           IK KER+GKM+YDE +G+WVPKWGYKGANKKLD QWLVEVDDK K  +NELIDPR+L+RA
Sbjct: 125 IKAKERSGKMVYDEDAGQWVPKWGYKGANKKLDKQWLVEVDDKPKKAENELIDPRSLSRA 184

Query: 183 ERKRLVKKNEKQQRRNMK 200
           ERK+++KKNE QQ+RN+K
Sbjct: 185 ERKKIIKKNEVQQKRNLK 202

>KLLA0B13046g complement(1139556..1140170) similar to sp|Q08746
           Saccharomyces cerevisiae YOR294w RRS1 regulator of
           ribosome synthesis singleton, start by similarity
          Length = 204

 Score =  287 bits (734), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 166/200 (83%)

Query: 1   MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQL 60
           MS   Y   PVTVEK IPV YDLGNLA FD+NVLD+ND DSSNA RE  IK LTRDNVQL
Sbjct: 1   MSTTKYSERPVTVEKAIPVTYDLGNLAVFDTNVLDRNDFDSSNAARESNIKDLTRDNVQL 60

Query: 61  LINQLLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAK 120
           LINQ+LSLP++ TTES GG+ GQSS M             REKPLPK KA TKWE+FAAK
Sbjct: 61  LINQILSLPIRATTESAGGSSGQSSSMTLVQLPEPTTELPREKPLPKPKAPTKWEQFAAK 120

Query: 121 KGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLN 180
           KGIKPKER+GKMIYDEA+GEWVPKWGYKG+NK+LDDQWLVEVDDKV+GT++ELIDPRTLN
Sbjct: 121 KGIKPKERSGKMIYDEAAGEWVPKWGYKGSNKELDDQWLVEVDDKVQGTEDELIDPRTLN 180

Query: 181 RAERKRLVKKNEKQQRRNMK 200
           RAERKRL+KKN+ QQ+RN+K
Sbjct: 181 RAERKRLIKKNQLQQKRNLK 200

>Sklu_1837.3 YOR294W, Contig c1837 3113-3739 reverse complement
          Length = 208

 Score =  285 bits (729), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 169/199 (84%)

Query: 2   SAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLL 61
           +A+ +K+LPVTV+KPIPV YDLGNLA FDSNVLDK++LDSSNA+REE IK +TRDNVQL+
Sbjct: 4   TADKFKSLPVTVDKPIPVSYDLGNLAVFDSNVLDKDELDSSNAKREEHIKGMTRDNVQLM 63

Query: 62  INQLLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAKK 121
           INQ+LSLP+K+TTES G + GQ+S M             REKPLPK KA TKWE FAAKK
Sbjct: 64  INQILSLPIKSTTESAGSSSGQASSMTLVQLPEPTSELPREKPLPKPKAPTKWELFAAKK 123

Query: 122 GIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNR 181
           GIK KER+GKM+YDEASGEW PKWGYKG NKKLDDQWLVEVDDKVKGT++ELIDPRTL+R
Sbjct: 124 GIKSKERSGKMVYDEASGEWAPKWGYKGTNKKLDDQWLVEVDDKVKGTEDELIDPRTLHR 183

Query: 182 AERKRLVKKNEKQQRRNMK 200
           AERK+L+KKNE Q +RN++
Sbjct: 184 AERKKLIKKNELQNKRNLR 202

>Scas_665.27
          Length = 203

 Score =  282 bits (721), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 170/200 (85%)

Query: 1   MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQL 60
           MSAE+YK LPVTVEKPI V YDLGNLA FDSNVL+K+D D+SN +REE IK++TRDNVQL
Sbjct: 1   MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQL 60

Query: 61  LINQLLSLPMKTTTESVGGTGGQSSVMXXXXXXXXXXXXXREKPLPKAKAMTKWEKFAAK 120
           LINQLLSLP+KTTT+S GG+ GQ+S M             REKPLPK KA TKWE+FAAK
Sbjct: 61  LINQLLSLPIKTTTDSTGGSTGQNSSMTLLQLPVPITELPREKPLPKPKAPTKWEQFAAK 120

Query: 121 KGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLN 180
           KGI+PK ++GKM+YDEA+GEWVPKWGYKG NKKLDDQWLVEVDDKV+GT +ELIDPRTL 
Sbjct: 121 KGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLG 180

Query: 181 RAERKRLVKKNEKQQRRNMK 200
           R ERK+L+KKNE+QQ+RN+K
Sbjct: 181 RNERKQLIKKNERQQKRNLK 200

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score = 28.5 bits (62), Expect = 4.7,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 138 SGEW---VPKWGYKGANKKLDDQWLVEVDDK 165
           S +W   V  +GY G +   +D W+VE+D K
Sbjct: 420 SSDWQKEVSCYGYSGFDGDANDDWVVEIDKK 450

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score = 28.1 bits (61), Expect = 6.0,   Method: Composition-based stats.
 Identities = 8/21 (38%), Positives = 15/21 (71%)

Query: 145 WGYKGANKKLDDQWLVEVDDK 165
           +GY+G    ++D W++E+D K
Sbjct: 426 YGYEGFEGDINDDWIIEIDKK 446

>CAGL0I02464g 217697..220147 similar to sp|P38863 Saccharomyces
           cerevisiae YHR172w SPC97 spindle pole body component,
           start by similarity
          Length = 816

 Score = 27.7 bits (60), Expect = 8.7,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 26  LAAFDSNVLDKNDLDSSNARREEKIKSLTR--DNVQLLINQLLSLPMKTTTESVGGTGG 82
           L   D+ +  +  ++    R  E +  L R  ++V +    L+S   ++ TES+GG+GG
Sbjct: 742 LVQLDAQLCHRAQVEYDEDRALESVPRLVRYTEDVFVTTRSLVSALTESMTESIGGSGG 800

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,491,518
Number of extensions: 271236
Number of successful extensions: 848
Number of sequences better than 10.0: 25
Number of HSP's gapped: 847
Number of HSP's successfully gapped: 25
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)