Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR293W (RPS10A)1051045491e-74
YMR230W (RPS10B)1051045386e-73
Scas_665.28*1051045092e-68
CAGL0M04873g1051044849e-65
AFR569W1051044597e-61
Scas_594.3*1161044572e-60
KLLA0B08173g1061044466e-59
KLLA0E02398g19080670.16
AEL187C20835611.3
YDR373W (FRQ1)190109601.3
Sklu_2083.241143602.0
AFR097W27756592.3
Kwal_26.797235833583.2
Kwal_55.2139119080573.6
Sklu_1986.219080557.9
KLLA0B11517g50731557.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR293W
         (104 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR293W (RPS10A) [5077] chr15 (867095..867146,867584..867849) Ri...   216   1e-74
YMR230W (RPS10B) [4186] chr13 (732413..732464,732875..733140) Ri...   211   6e-73
Scas_665.28*                                                          200   2e-68
CAGL0M04873g 532872..533189 highly similar to sp|P46784 Saccharo...   191   9e-65
AFR569W [3761] [Homologous to ScYOR293W (RPS10A) - SH; ScYMR230W...   181   7e-61
Scas_594.3*                                                           180   2e-60
KLLA0B08173g complement(722254..722574) highly similar to sp|Q08...   176   6e-59
KLLA0E02398g 223247..223819 highly similar to sp|Q06389 Saccharo...    30   0.16 
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...    28   1.3  
YDR373W (FRQ1) [1199] chr4 (1222747..1223319) Essential N-myrist...    28   1.3  
Sklu_2083.2 YGR210C, Contig c2083 2540-3775 reverse complement         28   2.0  
AFR097W [3289] [Homologous to ScYKR022C - SH] complement(609919....    27   2.3  
Kwal_26.7972                                                           27   3.2  
Kwal_55.21391                                                          27   3.6  
Sklu_1986.2 YDR373W, Contig c1986 4821-5393                            26   7.9  
KLLA0B11517g 1011211..1012734 some similarities with sp|P39925 S...    26   7.9  

>YOR293W (RPS10A) [5077] chr15 (867095..867146,867584..867849)
           Ribosomal protein S10 (rat S10), nearly identical to
           Rps10Bp [318 bp, 105 aa]
          Length = 105

 Score =  216 bits (549), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104

>YMR230W (RPS10B) [4186] chr13 (732413..732464,732875..733140)
           Ribosomal protein S10 (rat S10), nearly identical to
           Rps10Ap [318 bp, 105 aa]
          Length = 105

 Score =  211 bits (538), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLMPK++RNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMPKQERNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNP+QRPQRR
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPSQRPQRR 104

>Scas_665.28*
          Length = 105

 Score =  200 bits (509), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLM KEDR KIH+YLFQ GVVVAKKDFNQ+KHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQ+R+ TQRPQRR
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRR 104

>CAGL0M04873g 532872..533189 highly similar to sp|P46784
           Saccharomyces cerevisiae YMR230w RPS10B or sp|Q08745
           Saccharomyces cerevisiae YOR293w RPS10A, start by
           similarity
          Length = 105

 Score =  191 bits (484), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLMPKE+R KIH++LFQEGVVVAKKDFNQ KH+EIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMPKEERTKIHRHLFQEGVVVAKKDFNQPKHDEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQ     QRP RR
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQNAQQAQRPNRR 104

>AFR569W [3761] [Homologous to ScYOR293W (RPS10A) - SH; ScYMR230W
           (RPS10B) - SH]
           complement(1460872..1460923,1461002..1461267) [318 bp,
           105 aa]
          Length = 105

 Score =  181 bits (459), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 84/104 (80%), Positives = 97/104 (93%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           ML+PKE+R KIH+ LFQ+GV+VAKKDFNQ KH+EIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLIPKEERTKIHRKLFQDGVLVAKKDFNQPKHDEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGVEYLR YL LPE+++PGTY+ +R+ +QRPQRR
Sbjct: 61  WQYYYYTLTEEGVEYLRNYLGLPENVIPGTYMADRSQSQRPQRR 104

>Scas_594.3*
          Length = 116

 Score =  180 bits (457), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 87/104 (83%), Positives = 94/104 (90%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLM KEDR KIH+YLFQ GVVVAKKDFNQ KHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQPKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGVEYLREYL+LPEHIVPGT IQ+R+   +  ++
Sbjct: 61  WQYYYYTLTEEGVEYLREYLHLPEHIVPGTSIQDRSHHHKTTKK 104

>KLLA0B08173g complement(722254..722574) highly similar to sp|Q08745
           Saccharomyces cerevisiae YOR293w RPS10A ribosomal
           protein S10.e, start by similarity
          Length = 106

 Score =  176 bits (446), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 84/104 (80%), Positives = 94/104 (90%)

Query: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           ML+PKEDR KI+Q+LFQEGV+VAKKDFNQ KHEEIDTKNL+VIKALQSLTSKG+VKTQFS
Sbjct: 1   MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRR 104
           WQYYYYTLTEEGV YLREYLNLPEHI P TY+  ++  QRPQ +
Sbjct: 61  WQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQSGDQRPQGK 104

>KLLA0E02398g 223247..223819 highly similar to sp|Q06389
           Saccharomyces cerevisiae YDR373w FRQ1 regulator of
           phosphatidylinositol-4-OH kinase protein, start by
           similarity
          Length = 190

 Score = 30.4 bits (67), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 27  FNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHI 86
           F++  +  ID K    I AL S TS+G ++ +  W +  Y L  +GV    E L +   I
Sbjct: 72  FDKDNNGSIDFKEF--ITAL-STTSRGSLEEKLVWAFQLYDLNHDGVISYEEMLTIVSSI 128

Query: 87  --VPGTYIQERNPTQRPQRR 104
             + G  ++  +    P+ R
Sbjct: 129 YKMIGNMVKLSDDEATPELR 148

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 69  TEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQR 103
           T EG+E L  ++++ +H+ P  ++ +  P + PQR
Sbjct: 159 TGEGIEEL--FMDIAKHVKPERFVLQAEPQESPQR 191

>YDR373W (FRQ1) [1199] chr4 (1222747..1223319) Essential
           N-myristoylated calcium-binding protein that binds Pik1p
           and stimulates its activity in vitro, member of the
           recoverin/frequenin branch of the EF-hand superfamily
           [573 bp, 190 aa]
          Length = 190

 Score = 27.7 bits (60), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 44/109 (40%), Gaps = 10/109 (9%)

Query: 3   MPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIK-----ALQSLTSKGYVKT 57
           + +ED  KI++  F  G   + +DF        D  N   I       + S TS+G ++ 
Sbjct: 43  LAREDFVKIYKQFFPFG---SPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEE 99

Query: 58  QFSWQYYYYTLTEEGVEYLREYLNLPEHI--VPGTYIQERNPTQRPQRR 104
           + SW +  Y L  +G     E L +   +  + G+ +        P+ R
Sbjct: 100 KLSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMR 148

>Sklu_2083.2 YGR210C, Contig c2083 2540-3775 reverse complement
          Length = 411

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 12/43 (27%)

Query: 46  LQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVP 88
           L+ L+ +G+VK             EEG E++  Y + PEH+ P
Sbjct: 262 LRKLSKQGFVKY------------EEGTEFIDTYEDDPEHLKP 292

>AFR097W [3289] [Homologous to ScYKR022C - SH]
           complement(609919..610752) [834 bp, 277 aa]
          Length = 277

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 30  AKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEH 85
           +K E +D K L   +  Q   +   V  QFS + Y   L  E  E L+E L  P H
Sbjct: 88  SKQEILDIKKLRAERQ-QEAAAGSAVDQQFSEKSYVRMLDREDKEDLQELLGRPLH 142

>Kwal_26.7972
          Length = 358

 Score = 26.9 bits (58), Expect = 3.2,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 38  KNLYVIKALQSLTSKGYVKTQFS-WQYYYYTLT 69
           K +Y  +A +SLTSK YV   F+ W  +Y   T
Sbjct: 170 KQIYTERASESLTSKSYVPRWFAHWCNFYRGFT 202

>Kwal_55.21391
          Length = 190

 Score = 26.6 bits (57), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 27  FNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHI 86
           F++  +  ID K    I AL S TS+G ++ +  W +  Y L   G     E L +   I
Sbjct: 72  FDKDDNGTIDFKEF--ISAL-STTSRGTLEEKLVWAFQLYDLNHNGSISYDEMLTIVSSI 128

Query: 87  --VPGTYIQERNPTQRPQRR 104
             + G+ ++  +    P+ R
Sbjct: 129 YKMIGSMVKLDDNEATPELR 148

>Sklu_1986.2 YDR373W, Contig c1986 4821-5393
          Length = 190

 Score = 25.8 bits (55), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 27  FNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHI 86
           F++  +  ID +    I AL S TS+G ++ +  W +  Y L  +G     E L +   I
Sbjct: 72  FDKDDNGTIDFREF--ITAL-STTSRGTLEEKLVWAFQLYDLNHDGYISYDEMLTIVSSI 128

Query: 87  --VPGTYIQERNPTQRPQRR 104
             + G+ ++       P+ R
Sbjct: 129 YKMIGSMVKLNEDEATPELR 148

>KLLA0B11517g 1011211..1012734 some similarities with sp|P39925
           Saccharomyces cerevisiae YER017c AFG3 protease of the
           SEC18/CDC48/PAS1 family of ATPases (AAA), hypothetical
           start
          Length = 507

 Score = 25.8 bits (55), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 70  EEGVEYLREYLNLPEHI-VPGTYIQERNPTQ 99
           EE ++ +++ LN+PEH  +P TY ++ +P Q
Sbjct: 211 EEQMDQIQDKLNIPEHDRIPITYAEKVSPLQ 241

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,791,222
Number of extensions: 145723
Number of successful extensions: 472
Number of sequences better than 10.0: 27
Number of HSP's gapped: 472
Number of HSP's successfully gapped: 27
Length of query: 104
Length of database: 16,596,109
Length adjustment: 75
Effective length of query: 29
Effective length of database: 13,999,759
Effective search space: 405993011
Effective search space used: 405993011
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)