Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR292C30930415670.0
Scas_665.293223217981e-106
KLLA0B08195g3302807731e-102
Kwal_26.92183103167631e-101
CAGL0M11330g2962647011e-91
AFR568C3152346134e-78
YLR251W1971311422e-10
KLLA0F22924g1951331342e-09
AFR120C1821211342e-09
Scas_639.202081371334e-09
Sklu_1738.32001351324e-09
Kwal_14.26321991471325e-09
CAGL0B03465g2101341292e-08
CAGL0J07634g158758672.2
CAGL0C02321g31452627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR292C
         (304 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member...   608   0.0  
Scas_665.29                                                           311   e-106
KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyce...   302   e-102
Kwal_26.9218                                                          298   e-101
CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743 S...   274   1e-91
AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)...   240   4e-78
YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mp...    59   2e-10
KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomy...    56   2e-09
AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [...    56   2e-09
Scas_639.20                                                            56   4e-09
Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement         55   4e-09
Kwal_14.2632                                                           55   5e-09
CAGL0B03465g complement(343994..344626) highly similar to tr|Q06...    54   2e-08
CAGL0J07634g complement(740943..745706) similar to sp|P53855 Sac...    30   2.2  
CAGL0C02321g complement(234788..235732) similar to sp|P40025 Sac...    28   7.9  

>YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member of
           the Mpv17 and PMP22 family, which are peroxisomal
           proteins, has moderate similarity to uncharacterized C.
           albicans Orf6.6217p [930 bp, 309 aa]
          Length = 309

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/304 (96%), Positives = 293/304 (96%)

Query: 1   MPLQLFGRDQIVVHYDNGNMSNDDQNHQSVLGSWXXXXXXXXXXXMNKRIQRITLTHWLL 60
           MPLQLFGRDQIVVHYDNGNMSNDDQNHQSVLGSW           MNKRIQRITLTHWLL
Sbjct: 1   MPLQLFGRDQIVVHYDNGNMSNDDQNHQSVLGSWTRRAAAALRTLMNKRIQRITLTHWLL 60

Query: 61  LVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPIPQIL 120
           LVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPIPQIL
Sbjct: 61  LVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPIPQIL 120

Query: 121 NDTFHHVQNNRDVENGGGYESDELSIFNDFTSEHSSYTDNDDYPELDRPLATFKTDTFDF 180
           NDTFHHVQNNRDVENGGGYESDELSIFNDFTSEHSSYTDNDDYPELDRPLATFKTDTFDF
Sbjct: 121 NDTFHHVQNNRDVENGGGYESDELSIFNDFTSEHSSYTDNDDYPELDRPLATFKTDTFDF 180

Query: 181 FRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFS 240
           FRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFS
Sbjct: 181 FRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFS 240

Query: 241 NYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNC 300
           NYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNC
Sbjct: 241 NYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNC 300

Query: 301 FLSM 304
           FLSM
Sbjct: 301 FLSM 304

>Scas_665.29
          Length = 322

 Score =  311 bits (798), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 170/321 (52%), Positives = 218/321 (67%), Gaps = 26/321 (8%)

Query: 1   MPLQLFGRDQIVVHYDNGNMSNDDQNHQSVLGSWXXXXXXXXXXXMNK-------RIQRI 53
           M L+L G D I          NDD   + V+ S            + K       RI RI
Sbjct: 1   MALELAGEDSITAF-------NDDSETRGVIKSSFKNIRTFEENAVGKVKRFFTIRIYRI 53

Query: 54  TLTHWLLLVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHV 113
           TLTH ++L+IWV+ L K+TS+Y ++YA +A+ ATL  N +LFGISD LAQSI CF+S  +
Sbjct: 54  TLTHLIILIIWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPL 113

Query: 114 DPIPQILNDTFHHVQN--------NRDVENGGGYESDELSIFNDF--TSEHSSYTDNDDY 163
           DP+P+I++DT  H+ N        + D+ENG  YESD LS+FND+  +   SS  + + +
Sbjct: 114 DPVPKIVDDTARHIMNQFRSPAHESLDLENG--YESDTLSVFNDYGLSPASSSIGNEEGF 171

Query: 164 PELDRPLATFKTDTFDFFRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLS 223
              +  + T +T  F+F R+  FMFWGFFISFFQ PWYK LNFFYTEDPTV+QV ERVLS
Sbjct: 172 LPSEEEVGTTRTYLFNFRRFFSFMFWGFFISFFQVPWYKILNFFYTEDPTVIQVLERVLS 231

Query: 224 DQLLYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMP 283
           DQL YSP+ LY FFM++NY+MEGG+ +T   KI+ +YISTLGCNYLVWP VQFINFL++P
Sbjct: 232 DQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLP 291

Query: 284 RDFQAPFSSSVGVVWNCFLSM 304
           + FQ PFSSSVGV+WNCFLSM
Sbjct: 292 KPFQVPFSSSVGVLWNCFLSM 312

>KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyces
           cerevisiae YOR292c, start by similarity
          Length = 330

 Score =  302 bits (773), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/280 (53%), Positives = 192/280 (68%), Gaps = 24/280 (8%)

Query: 49  RIQRITLTHWLLLVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACF 108
           +I +IT+ HW +L  W+  L  FTS Y  LY +SA+ AT+CTN+LLFG SD LAQ I+CF
Sbjct: 44  KILKITIIHWSILSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCF 103

Query: 109 YSYHVDPIPQILNDTFHHVQNN---RDVENGGGYESDELSIFNDFTSEHSSYTDNDDY-- 163
            SY VDP+P++++    ++      R  E+     SD +SIFND+  E  S+    D   
Sbjct: 104 LSYKVDPVPEVVDKVTRNLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQTDTRN 163

Query: 164 --PELDRPL-----------------ATFKTDTFDFFRWGCFMFWGFFISFFQAPWYKFL 204
             P +D  L                 ++   + F F+RW CFM WG+F+SFFQ PWYKFL
Sbjct: 164 ASPGIDSELRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFL 223

Query: 205 NFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTL 264
           N+FYTEDPTVVQV ERVLSDQL+YSPISLYCFFM+SNY+ME GD ++   KI+ +YI+TL
Sbjct: 224 NYFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTL 283

Query: 265 GCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNCFLSM 304
           GCNYLVWP+VQFINFL++P+  Q PFSSSVGV+WNCFLSM
Sbjct: 284 GCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSM 323

>Kwal_26.9218
          Length = 310

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 200/316 (63%), Gaps = 26/316 (8%)

Query: 1   MPLQLFGRDQIVVHYDNGNMSND-----DQNHQSVLGSWXXXXXXXXXXXMNKRIQRITL 55
           MP+QLF RDQI V Y + +M         +N +  L  W           ++ +IQ  TL
Sbjct: 1   MPIQLFDRDQIAVSYGDDDMERGWTRRASRNVREKLLEWARR--------VDDKIQGYTL 52

Query: 56  -----THWLLLVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYS 110
                 HW LL IWV  L K  S Y ++Y  SA+F TLCTN +LFG SDILAQ I  +  
Sbjct: 53  LHVGIVHWTLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYTW 112

Query: 111 YHVDPIPQILNDTFHHVQNNRDV--ENGGGYESDELSIFNDFTSEHSSYTDNDDYPELDR 168
             VDP P  L+ T H++ +   +  +     E+D +S++N++    ++ +    +     
Sbjct: 113 DPVDPTPAALDATAHNLVSRYALFGDQDSDAENDSISLYNEYGPGATAQSPVPYHQSAQH 172

Query: 169 PLATFKTDTFDFFRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLY 228
           P        FDFFRW CFM WG F+SFFQ PWYK LNFFYTEDPTVVQV ERVLSDQL+Y
Sbjct: 173 P------PRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVY 226

Query: 229 SPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQA 288
           SPISLYCFFM+SNY+M+ GD  +   KIQ++Y+ TLGCNYLVWP VQFINFL++P+  Q 
Sbjct: 227 SPISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQV 286

Query: 289 PFSSSVGVVWNCFLSM 304
           PFSSSVGVVWNCFLSM
Sbjct: 287 PFSSSVGVVWNCFLSM 302

>CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743
           Saccharomyces cerevisiae YOR292c, hypothetical start
          Length = 296

 Score =  274 bits (701), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 139/264 (52%), Positives = 187/264 (70%), Gaps = 19/264 (7%)

Query: 53  ITLTHWLLLVIWVTSLWKFT-SHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSY 111
           I+LTHW L+  W+  +W++  +HY+ LY  + + A+  +N +LFG+SDILAQ I C++S 
Sbjct: 35  ISLTHWFLMFCWLNLMWRYYFNHYKDLYKYNRLIASQLSNCMLFGLSDILAQCITCYFSR 94

Query: 112 HVDPIPQILNDTFHH-VQNNRDVENGGGYESDE----------LSIFNDFTSEHSSYTDN 160
            +DP+P+I+++T  + +  N     GG +E++E          LS+FND+      Y ++
Sbjct: 95  EMDPVPRIIDETVQNLIPYNVMPLPGGIFEANEELLDSDNDDNLSVFNDY----GEYDNS 150

Query: 161 DDYPELDRPLATFKTDTFDFFRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFER 220
           +D  E +    T K  TF F RW  FM WG FISFFQ PWY  LN  YTEDPTVVQV ER
Sbjct: 151 NDEIEYNH---TEKVATFHFRRWLGFMGWGGFISFFQVPWYIILNTIYTEDPTVVQVLER 207

Query: 221 VLSDQLLYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFL 280
           VL+DQLLYSP+SLY FFM+SNYV+E GD+ T   KI+RLY++TLGCNY++WPM+QFINFL
Sbjct: 208 VLTDQLLYSPVSLYFFFMYSNYVIEQGDRYTFSMKIRRLYVTTLGCNYMIWPMMQFINFL 267

Query: 281 IMPRDFQAPFSSSVGVVWNCFLSM 304
           ++P+ +Q PFSSSVGVVWNCFLSM
Sbjct: 268 VIPKHYQVPFSSSVGVVWNCFLSM 291

>AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)
           [948 bp, 315 aa]
          Length = 315

 Score =  240 bits (613), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 152/234 (64%), Gaps = 6/234 (2%)

Query: 71  FTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPIPQILNDTFHHVQNN 130
            T  Y  LY  S + AT C+N+LLFG+SD  AQ +AC  +         L  T   +   
Sbjct: 77  LTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLAC-AATEASRAGGPLAATRELLVQL 135

Query: 131 RDVENGGGYESDELSIFNDFTSEHSSYTDNDDYPELDRPLATFKTDTFDFFRWGCFMFWG 190
           R        E DEL  F+D+     S+    +   ++      +   FDF+RWGCFM WG
Sbjct: 136 RPQPPVRLDEEDELRAFSDYGPRPESHMTESEGVWVEE-----EPRRFDFYRWGCFMLWG 190

Query: 191 FFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFSNYVMEGGDKD 250
             ++ FQ PWY+ LN+ YT+DPTVVQV ERVLSDQLLYSP+SLYCFF +SNYV+EGG ++
Sbjct: 191 PVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEE 250

Query: 251 TLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNCFLSM 304
           T   KIQR+Y+STLGCNY VWP+VQF+NFL++P+  Q PFSSSVGV+WN FLS+
Sbjct: 251 TFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLSL 304

>YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mpv17
           and PMP22 family, which are peroxisomal proteins, has
           low similarity to mouse Mpv17, which functions in
           peroxisomal reactive oxygen metabolism and is associated
           with glomerulosclerosis and inner ear defects [594 bp,
           197 aa]
          Length = 197

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 6/131 (4%)

Query: 178 FDFFRWGCFMFWGFFI-SFFQAPWYKFLN--FFYTEDPTV--VQVFERVLSDQLLYSPIS 232
           +D+ R    + +G  I SF    WYK LN   +    P      +  RV  DQL ++P+ 
Sbjct: 47  YDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLG 106

Query: 233 LYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSS 292
           L  +F   + +MEG   D    KI+  +  TL  N+ VWP+ Q INF ++P   +    +
Sbjct: 107 LPFYFTCMS-IMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVN 165

Query: 293 SVGVVWNCFLS 303
            V + WN +LS
Sbjct: 166 VVAIFWNTYLS 176

>KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomyces
           cerevisiae YLR251w, hypothetical start
          Length = 195

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 62/133 (46%), Gaps = 4/133 (3%)

Query: 174 KTDTFDFFRWGCFMFWGFFI-SFFQAPWYKFLNFFYTEDPTV--VQVFERVLSDQLLYSP 230
           K   +D  R    + +G  I S     WYKFLN      P         RV  DQLL++P
Sbjct: 43  KGQKYDLARTVRAVVYGSLIFSIIGDSWYKFLNQKVIVKPGKHWTNTAARVGCDQLLFAP 102

Query: 231 ISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPF 290
           + +  ++   + ++EG       KKI+  +  TL  N+ VWP  Q INF ++P   +   
Sbjct: 103 VGIPMYYGVMS-ILEGKSLVDAKKKIEDNWWPTLVTNWYVWPAFQLINFSLVPVHHRLFS 161

Query: 291 SSSVGVVWNCFLS 303
            + + + WN FLS
Sbjct: 162 VNIISIFWNAFLS 174

>AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [549
           bp, 182 aa]
          Length = 182

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 186 FMFWGFFISFFQAPWYKFLNFFYTED-PTV--VQVFERVLSDQLLYSPISLYCFFMFSNY 242
           F++     S     WY+FL+       P      V  RV  DQL+++PI +  ++  +  
Sbjct: 55  FLYGAVLFSLVGDKWYRFLSTVRLGRLPQAHWANVLARVACDQLIFAPIGVPLYYT-AMA 113

Query: 243 VMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNCFL 302
           +MEGG  + +  ++   + STL  N++VWP  Q  NF ++P   +    + + + WN +L
Sbjct: 114 LMEGGSLEDVRIRLSEKWWSTLLANWIVWPAFQLCNFSLVPVQHRLLTVNVLSIFWNTYL 173

Query: 303 S 303
           S
Sbjct: 174 S 174

>Scas_639.20
          Length = 208

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 9/137 (6%)

Query: 174 KTDTFDFFRWGCFMFWGFFI-SFFQAPWYKFLN------FFYTEDPTVVQVFERVLSDQL 226
           K   FD+ R    + +G  I SF    WYK L         +  + ++  ++ +V  DQL
Sbjct: 53  KKKNFDWHRTSRAVIYGSMIFSFIGDKWYKILQNNVKLPLRFQHNKSLSMLY-KVSVDQL 111

Query: 227 LYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDF 286
            ++P+ +  F+     +MEGG    +  KI+  +  TL  N+ VWP+ Q +NF  +P   
Sbjct: 112 AFAPLGV-PFYFSCMTIMEGGTMKDVETKIKTQWWRTLVTNWCVWPLFQMVNFTWVPLQH 170

Query: 287 QAPFSSSVGVVWNCFLS 303
           +    + V + WN +LS
Sbjct: 171 RLLAVNVVAIFWNTYLS 187

>Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement
          Length = 200

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 6/135 (4%)

Query: 174 KTDTFDFFRWGCFMFWG-FFISFFQAPWYKFLNFFYTEDPTVVQVFE----RVLSDQLLY 228
           K++ +D  R    + +G  F SF    WYKFLN         +  +     RV  DQL +
Sbjct: 45  KSEGYDIKRTLRSVAYGSLFFSFVGDKWYKFLNNKIRLPHRPINHWSNTVCRVGVDQLGF 104

Query: 229 SPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQA 288
           SPI +  +F     ++EG + D    +I   +  TL  N+ VWP  Q +NF ++P   + 
Sbjct: 105 SPIGVPLYFGIMT-ILEGRNIDEARTRISDNWWPTLVTNWAVWPAFQLVNFSLVPLSHRL 163

Query: 289 PFSSSVGVVWNCFLS 303
              + V + WN FLS
Sbjct: 164 LAVNVVSIFWNTFLS 178

>Kwal_14.2632
          Length = 199

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 5/147 (3%)

Query: 161 DDYPELDRPLATFKTDTFDFFRWGCFMFWGFFI-SFFQAPWYKFLNFFYTEDPTV---VQ 216
           D   +L  P     T  +D  R    + +G  I SF    W+K LN              
Sbjct: 32  DAIAQLCFPGDKSATRQYDIARTVRAVTYGSLIFSFIGDKWFKTLNKIKLASFPANHWSN 91

Query: 217 VFERVLSDQLLYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQF 276
           +  RV +DQLL++P+ +  +F     +MEG        KI+ ++   L  N++VWP VQ 
Sbjct: 92  LALRVGTDQLLFAPLCVPFYFGILT-LMEGKSPKHAENKIRNVWWDILKTNWMVWPAVQI 150

Query: 277 INFLIMPRDFQAPFSSSVGVVWNCFLS 303
           INF ++P   +    + V + WN FLS
Sbjct: 151 INFSLVPVQHRLLAVNLVAIFWNTFLS 177

>CAGL0B03465g complement(343994..344626) highly similar to tr|Q06563
           Saccharomyces cerevisiae YLR251w, hypothetical start
          Length = 210

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 5/134 (3%)

Query: 174 KTDTFDFFRWGCFMFWGFFI-SFFQAPWYKFL-NFFYTEDPTV--VQVFERVLSDQLLYS 229
           K   +D  R    + +G  I SF    WY+FL    ++  P      +  RV  DQL ++
Sbjct: 56  KRGKYDIPRTVRAVVYGSMIFSFIGDRWYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFA 115

Query: 230 PISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAP 289
           P+ L  F+     ++EG       +KI+  +  TL  N+ VWP+ Q +NF ++P   +  
Sbjct: 116 PLGL-PFYFGCMSLLEGHGLGAAREKIKLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLL 174

Query: 290 FSSSVGVVWNCFLS 303
            ++ V + WN FLS
Sbjct: 175 AANVVAIFWNTFLS 188

>CAGL0J07634g complement(740943..745706) similar to sp|P53855
           Saccharomyces cerevisiae YNL242w SPO72 required for
           sporulation, start by similarity
          Length = 1587

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 115 PIPQILNDTFHHVQ---------NNRDVENGGGYESDELSIFNDFTSEHSSYTDNDDY 163
           P+P +  D F  ++         +N+D++   G +SD L I N F  E   +  ++DY
Sbjct: 929 PVPSVAVDLFETIEENEFNLSNLDNKDIDKSIGSDSDSLHIVNSFLDEVEDFQFHEDY 986

>CAGL0C02321g complement(234788..235732) similar to sp|P40025
           Saccharomyces cerevisiae YER037w PHM8, hypothetical
           start
          Length = 314

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 9/52 (17%)

Query: 65  VTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPI 116
           VT LW FT+ Y+         A  C  IL  GI+D+      C+YS   D I
Sbjct: 181 VTKLWLFTNAYK-------THAIRCIRIL--GIADLFDGITYCYYSAPPDSI 223

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.141    0.467 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,735,897
Number of extensions: 486699
Number of successful extensions: 1606
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1618
Number of HSP's successfully gapped: 36
Length of query: 304
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 203
Effective length of database: 13,099,691
Effective search space: 2659237273
Effective search space used: 2659237273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)