Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR291W1472144670890.0
CAGL0M11308g1452144247500.0
Scas_665.301439120546200.0
Kwal_26.92071469116844200.0
KLLA0B08217g1439118442090.0
AFR567W1449117241760.0
KLLA0E22352g12068048311e-91
AFR354C12107998176e-90
CAGL0L01419g12147548132e-89
YEL031W (SPF1)12157998034e-88
Scas_583.14*8755505863e-62
CAGL0A00517g11228413292e-30
Kwal_14.14989399413022e-27
Kwal_23.316011009402981e-26
YGL006W (PMC1)11738682909e-26
YDR038C (ENA5)10918622828e-25
YDR039C (ENA2)10918622818e-25
YDR040C (ENA1)10918622721e-23
Kwal_47.1754712408422721e-23
AEL301W9578232665e-23
KLLA0E14630g10828592657e-23
CAGL0I04312g9518752593e-22
YIL048W (NEO1)11516062541e-21
KLLA0A08910g12808362514e-21
YGL167C (PMR1)9509482495e-21
KLLA0F20658g10828642496e-21
KLLA0A03157g9388312477e-21
AGL097C10968392442e-20
ADL079C11666332353e-19
Kwal_23.578911337252343e-19
Scas_707.48*7418022201e-17
CAGL0L00715g11445352183e-17
KLLA0A04015g13438812075e-16
KLLA0C08393g11485302075e-16
Sklu_2193.111435552041e-15
Scas_704.3811615311969e-15
Scas_499.33461461909e-15
CAGL0K12034g10873221923e-14
Kwal_26.707013153061914e-14
CAGL0J01870g9463651861e-13
ADR350W13113121781e-12
CAGL0G06270g13283051719e-12
AFL011W12423231645e-11
KLLA0C17644g15763221655e-11
Scas_297.18002151602e-10
Scas_710.419043671565e-10
YDR093W (DNF2)16123291541e-09
YAL026C (DRS2)13553891522e-09
KLLA0A09031g8993561512e-09
YGL008C (PMA1)9182551476e-09
Scas_89.12712161409e-09
AGL085C9093721459e-09
Scas_576.815913361451e-08
CAGL0L11814g15763331441e-08
Kwal_23.355615974201432e-08
YER166W (DNF1)15713361432e-08
AGR120C15473271423e-08
Kwal_47.175228993631342e-07
YPL036W (PMA2)9473711342e-07
KLLA0E01650g15502561342e-07
CAGL0G08085g15783311333e-07
CAGL0H04477g16262611323e-07
Scas_688.19132261288e-07
AFL191W15752091271e-06
YMR162C (DNF3)16562631253e-06
Scas_569.0d4681431171e-05
Scas_636.1615543301181e-05
Scas_669.316382571172e-05
CAGL0A00495g9021441072e-04
KLLA0D04092g11523021020.001
KLLA0F07447g975501000.002
YBR295W (PCA1)1216234930.013
ACR086C81050910.021
Kwal_55.2157598950880.045
CAGL0M08602g101251880.054
Scas_505.41025209860.073
YDR270W (CCC2)100472820.28
Scas_615.994250790.60
AGL041C123346771.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR291W
         (1446 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...  2735   0.0  
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...  1834   0.0  
Scas_665.30                                                          1784   0.0  
Kwal_26.9207                                                         1707   0.0  
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...  1625   0.0  
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...  1613   0.0  
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...   324   1e-91
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...   319   6e-90
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...   317   2e-89
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...   313   4e-88
Scas_583.14*                                                          230   3e-62
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   131   2e-30
Kwal_14.1498                                                          120   2e-27
Kwal_23.3160                                                          119   1e-26
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   116   9e-26
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   113   8e-25
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   112   8e-25
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   109   1e-23
Kwal_47.17547                                                         109   1e-23
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   107   5e-23
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   106   7e-23
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   104   3e-22
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   102   1e-21
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   101   4e-21
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   100   5e-21
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...   100   6e-21
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   100   7e-21
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    99   2e-20
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    95   3e-19
Kwal_23.5789                                                           95   3e-19
Scas_707.48*                                                           89   1e-17
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    89   3e-17
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    84   5e-16
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    84   5e-16
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          83   1e-15
Scas_704.38                                                            80   9e-15
Scas_499.3                                                             78   9e-15
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    79   3e-14
Kwal_26.7070                                                           78   4e-14
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    76   1e-13
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    73   1e-12
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    70   9e-12
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    68   5e-11
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    68   5e-11
Scas_297.1                                                             66   2e-10
Scas_710.41                                                            65   5e-10
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    64   1e-09
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    63   2e-09
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    63   2e-09
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    61   6e-09
Scas_89.1                                                              59   9e-09
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    60   9e-09
Scas_576.8                                                             60   1e-08
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    60   1e-08
Kwal_23.3556                                                           60   2e-08
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    60   2e-08
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    59   3e-08
Kwal_47.17522                                                          56   2e-07
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    56   2e-07
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    56   2e-07
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    56   3e-07
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    55   3e-07
Scas_688.1                                                             54   8e-07
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    54   1e-06
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    53   3e-06
Scas_569.0d                                                            50   1e-05
Scas_636.16                                                            50   1e-05
Scas_669.3                                                             50   2e-05
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    46   2e-04
KLLA0D04092g complement(344666..348124) some similarities with s...    44   0.001
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    43   0.002
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    40   0.013
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    40   0.021
Kwal_55.21575                                                          39   0.045
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    39   0.054
Scas_505.4                                                             38   0.073
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    36   0.28 
Scas_615.9                                                             35   0.60 
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    34   1.0  

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 2735 bits (7089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1340/1446 (92%), Positives = 1340/1446 (92%)

Query: 1    MDIPSSNQIQHGQRSERNRRMPRXXXXXXXXXXXXXXXXXXMVLDQNNSEPYAGATFEAV 60
            MDIPSSNQIQHGQRSERNRRMPR                  MVLDQNNSEPYAGATFEAV
Sbjct: 1    MDIPSSNQIQHGQRSERNRRMPRASFSSTATTSTAATLTSAMVLDQNNSEPYAGATFEAV 60

Query: 61   PSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVLXXXXXXXXXXXXXXXXXX 120
            PSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVL                  
Sbjct: 61   PSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVLSSAEQSRSSSRNPSHFRF 120

Query: 121  XTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGTGLXXXXXXXXXXXXXXXXXNAK 180
             TQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGTGL                 NAK
Sbjct: 121  FTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGTGLSSRRSSIRSFSRASSLSNAK 180

Query: 181  XXXXXXXXXXXXXXAPQRLGENSDTGFVYHXXXXXXXXXXXXXXXXXIPIELESQTDEIX 240
                          APQRLGENSDTGFVYH                 IPIELESQTDEI 
Sbjct: 181  SYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSSSSLSRYTTRERIPIELESQTDEIL 240

Query: 241  XXXXXXXXXXXXXXXXXXXXNNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQR 300
                                NNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQR
Sbjct: 241  EDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQR 300

Query: 301  FYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKA 360
            FYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKA
Sbjct: 301  FYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKA 360

Query: 361  EWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVP 420
            EWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVP
Sbjct: 361  EWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVP 420

Query: 421  ILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQIN 480
            ILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQIN
Sbjct: 421  ILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQIN 480

Query: 481  LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVS 540
            LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVS
Sbjct: 481  LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVS 540

Query: 541  RNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNE 600
            RNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNE
Sbjct: 541  RNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNE 600

Query: 601  SMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAAL 660
            SMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAAL
Sbjct: 601  SMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAAL 660

Query: 661  AMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGL 720
            AMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGL
Sbjct: 661  AMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGL 720

Query: 721  DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCF 780
            DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCF
Sbjct: 721  DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCF 780

Query: 781  DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFF 840
            DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFF
Sbjct: 781  DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFF 840

Query: 841  MSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSE 900
            MSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSE
Sbjct: 841  MSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSE 900

Query: 901  IIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGA 960
            IIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGA
Sbjct: 901  IIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGA 960

Query: 961  PEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLE 1020
            PEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLE
Sbjct: 961  PEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLE 1020

Query: 1021 FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI 1080
            FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI
Sbjct: 1021 FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI 1080

Query: 1081 NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFR 1140
            NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFR
Sbjct: 1081 NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFR 1140

Query: 1141 DENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADV 1200
            DENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADV
Sbjct: 1141 DENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADV 1200

Query: 1201 GISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITIL 1260
            GISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITIL
Sbjct: 1201 GISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITIL 1260

Query: 1261 YSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFL 1320
            YSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFL
Sbjct: 1261 YSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFL 1320

Query: 1321 VFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYRE 1380
            VFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYRE
Sbjct: 1321 VFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYRE 1380

Query: 1381 PMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQL 1440
            PMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQL
Sbjct: 1381 PMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQL 1440

Query: 1441 YIPPSI 1446
            YIPPSI
Sbjct: 1441 YIPPSI 1446

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 1834 bits (4750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 893/1442 (61%), Positives = 1080/1442 (74%), Gaps = 25/1442 (1%)

Query: 10   QHGQRSERNRRMPRXXXXXXXXXXXXXXXXXXMVLDQNNSEPYAGATFEAVPSSIVSFHH 69
            QHG  S   R   R                  +++D NNSE YAGA FEAVPSSIVSFH 
Sbjct: 5    QHGSSSHAQRT--RASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHR 62

Query: 70   PHSFQSSNL-PSPHSSGNLEQRGRRLTESEPLVLXXXXXXXXXXXXXXXXXXXTQEQISN 128
            PHSFQSS++  S  +S  LE+    + E+EPL                     T EQ+S 
Sbjct: 63   PHSFQSSHMMGSSLNSNMLERTTGAIHETEPLY--QGNDHSRSSSNNRNFRFFTDEQVSQ 120

Query: 129  AEGASTLENTDYDMAWDATPAYEQDRIYGTGLXXXXXXXXXXXXXXXXXNAKXXXXXXXX 188
            AEG +TLENTDYD+ WDA PAYEQ+   G+ +                  +         
Sbjct: 121  AEGIATLENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIRDISRRSSLSTSPYGSIDHRG 180

Query: 189  XXXXXXAPQRLGENSDTGFVYHXXXXXXXXXXXXXXXXXIPIELESQTDEIXXXXXXXXX 248
                   P+          VY                  IP+E+E Q D           
Sbjct: 181  RSASKSRPRY-------DQVYQTSTHSSSSLSRYSVRERIPVEVEDQDDNSLDVHSSDQS 233

Query: 249  XXXXXXXXXXXXNNRGSFSGHDDVHNQ----HSEYLKPDYHEKFYPQYAPNLHYQRFYIA 304
                         N GS + HDD   +    H E+LKP YH+KFYP++  + H QR YI+
Sbjct: 234  LASSHSNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYIS 293

Query: 305  EEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKAEWVV 364
            EED+VI IA Y+TSKF  ++YNL C  T G ++L+ +WLP  KV++ G K PLAKAEW+V
Sbjct: 294  EEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLV 353

Query: 365  IENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVPILIT 424
            +ENE GEF I+   R+WYNR LST+L  ++    + E       HHH +E NPN+PILI+
Sbjct: 354  LENEHGEFTIEEPTREWYNRTLSTILMLDS-KTETEEFEHGFQRHHHTSEENPNLPILIS 412

Query: 425  FEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQINLRMK 484
            F+YRYIKF+YSPLDD+FKTNNNW+D DWVDL T S GL+ G+QEDR LAF KNQINL+MK
Sbjct: 413  FQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMK 472

Query: 485  TTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLA 544
            TTS+ILF+EVLHPFY+FQV SIILW +DEYYYYA CIFLIS+LSI D+L E KK+SR LA
Sbjct: 473  TTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLA 532

Query: 545  EMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLT 604
            EMSHF+C+VRVLR+ FW++I SSELVPGDIYE+SDPN+ +LPCDSILLS DCIVNESMLT
Sbjct: 533  EMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLT 592

Query: 605  GESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVV 664
            GESVPVSK+PA+EET+ QL DDFQSTQIS+F+SKSFL+NGT +IRA+I  G + ALAM V
Sbjct: 593  GESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAV 652

Query: 665  RTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKT 724
            RTGFSTTKGSL+RSMVFPKP+GFKFY DSFKYIGFM++IA FGF +SC+ FIKLGLDK+T
Sbjct: 653  RTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRT 712

Query: 725  MILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTG 784
            MILRALDIITIVVPPALPATLTIGT+FAL+RLKEKGIFCI+PTR+NI GKIDVMCFDKTG
Sbjct: 713  MILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTG 772

Query: 785  TLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLL 844
            TLTEDGLDVLGV++S         F +L+SD   +FPKFSL DCS+P D+K RNF +SLL
Sbjct: 773  TLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLL 832

Query: 845  TCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPA 904
            TCHSLR VDG LLGDPLDFKMFQFTGWS+EEDFQ   FHSLYE RHE   FPEN++IIPA
Sbjct: 833  TCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPA 892

Query: 905  VVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVI 964
            +VHP+ ++  N F  NDP+N LG++RSFEFLSELRRMSVIVK NN++VYW++TKGAPEVI
Sbjct: 893  IVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVI 952

Query: 965  SEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGF 1024
             +ICN +TLP+D++++L  YTH+GYRVIACAGKTLPK TWLYSQKV REEVESN+EFLGF
Sbjct: 953  IDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGF 1012

Query: 1025 IIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTP 1084
            IIFQNKLK  TS TL  L+ ANIRT+MCTGDN+LTAISVG+E  LI   RVYVP++  + 
Sbjct: 1013 IIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSD 1072

Query: 1085 LHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENE 1144
            +  +PVI W +++  + ILDT TL+P+   +          YTLA++G+VFR++F +++ 
Sbjct: 1073 MTVQPVIHWNEISNAEHILDTFTLQPIDDYSGP--------YTLAITGEVFRIIFSNQDN 1124

Query: 1145 IPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISL 1204
              EEY+NEILL  SI+ARMSPDEKHEL+ QLQK+DYTVGFCGDGANDCGALKAADVGISL
Sbjct: 1125 YSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISL 1184

Query: 1205 SEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYSRG 1264
            SEAEASVAAPFTSKIF+I+CVLDVI+EGRA+LVTSFACFQYMSLYSAIQFI+ITILYSRG
Sbjct: 1185 SEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRG 1244

Query: 1265 SNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFLF 1324
            SNLGDFQFLYIDLLLI+PIA+ MSWSK Y ++ KKRPSANLVSPKILVPL++ +  +FLF
Sbjct: 1245 SNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLF 1304

Query: 1325 QFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYREPMSK 1384
            QF+PWI +Q   WYIKPIVGGDDAVQSSDNTVLF++SNFQYILT++VLS+GPPYREP+  
Sbjct: 1305 QFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHH 1364

Query: 1385 NFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQLYIPP 1444
            N +++ DI +S+  S ++M ++ +S LG +LQLT I     + I +W +LNYY   ++PP
Sbjct: 1365 NVQYVRDIALSVLVSFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPP 1424

Query: 1445 SI 1446
             +
Sbjct: 1425 KV 1426

>Scas_665.30
          Length = 1439

 Score = 1784 bits (4620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 852/1205 (70%), Positives = 1015/1205 (84%), Gaps = 30/1205 (2%)

Query: 262  NRGSFSGHDDVHNQH-----------SEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVI 310
            N G+    +D H+ H           +EYLKP YHEKFYP    +L+YQRFYI EEDLV+
Sbjct: 22   NNGNNLSTEDTHSHHKKTTTSGGGYQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVV 81

Query: 311  GIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFG 370
            GIA Y TSKF   IYN  C ++FGL+YLL RWLP  KVKL G KVPL KAEWVV+ENEFG
Sbjct: 82   GIAGYSTSKFKNAIYNFICIVSFGLLYLLLRWLPSYKVKLIGTKVPLGKAEWVVLENEFG 141

Query: 371  EFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHH--------ANEINPNVPIL 422
            EF I+PI R+WYNRP+ST+LP ++   P  E + IN   +           E NPN+PIL
Sbjct: 142  EFSIEPIKREWYNRPISTILPLDD---PFQEIDGINDESYQHRHHHYHHVTEKNPNIPIL 198

Query: 423  ITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQINLR 482
            ITF+YRYI FIYSP++D+FKTNNNW DPDWVDLS+   GL+ GVQEDR LAF  NQINLR
Sbjct: 199  ITFQYRYITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSSGVQEDRILAFDSNQINLR 258

Query: 483  MKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRN 542
            +KT +E+LFNEVLHPFYVFQ+FSIILW +DEYYYYA CIFLIS+LSI D+L E ++  ++
Sbjct: 259  VKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKS 318

Query: 543  LAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESM 602
            LA+MSHF C+VRV RD+FWT ++S++LVPGDIYE+SDP++T+ PCDS+LLS DCIVNESM
Sbjct: 319  LADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESM 378

Query: 603  LTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAM 662
            LTGESVPVSKFPA  ETM QL DDFQ+TQISS++SKSFL+NGT IIRARI  GQ+AALAM
Sbjct: 379  LTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAM 438

Query: 663  VVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDK 722
            VVRTGFSTTKGSLVRSMVFPKPTGFKFY DSFKYIG M+LIA+FGF +SC+QFIK+GLDK
Sbjct: 439  VVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDK 498

Query: 723  KTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDK 782
            +TMILRALDIITIVVPPALPATLTIGT FALSRLK+KGIFCISPTR+NI GKID++CFDK
Sbjct: 499  RTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDK 558

Query: 783  TGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMS 842
            TGTLTE+GLDVLGVQ+  P+     +F +L+ D+ ++FPKFSLNDCSSP D++++NFF+S
Sbjct: 559  TGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFIS 618

Query: 843  LLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEII 902
            LLTCHSLR VD  L+GDPLDFKMFQFT WS+EEDFQ++ FHS YE R  D+  PEN +II
Sbjct: 619  LLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDII 678

Query: 903  PAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPE 962
            PAVVHP+S + ENTF DNDPHNFLG++RSFEFLSELRRMSVIVK +N+DVYW+FTKGAPE
Sbjct: 679  PAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPE 738

Query: 963  VISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFL 1022
            VI++ICNK+TLPA+FEE+L  YTH GYRVIACAG+ LP+ TWLYSQKVSREEVESN+EFL
Sbjct: 739  VITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFL 798

Query: 1023 GFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSIND 1082
            GFIIF+NKLKKET++TL++LQ+A+IRT+MCTGDN+LTAISVGR+  LI+  +VYVPS+ +
Sbjct: 799  GFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEE 858

Query: 1083 TPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDE 1142
                G+  I+WRDV+  D  LD++TL P+   NNS  +    +YTLA++GD+FR++F DE
Sbjct: 859  IDSTGQTSIIWRDVDNMDDTLDSRTLLPI---NNSSST----SYTLAITGDIFRIIFGDE 911

Query: 1143 -NEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVG 1201
             N I E+Y+N +LL  +IYARMSPDEKHELM QLQ+L+YTVGFCGDGANDCGALKAADVG
Sbjct: 912  NNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVG 971

Query: 1202 ISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILY 1261
            ISLSEAEASVAAPFTS++F+ISCVLDVI+EGRA LVTSF+CFQYMSLYSAIQFITIT+LY
Sbjct: 972  ISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLY 1031

Query: 1262 SRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLV 1321
            SRGSNLGDFQFLYIDLLLIVPIAI MSWSK Y+KI KKRPSANLVSPKIL+PLL S+ +V
Sbjct: 1032 SRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVV 1091

Query: 1322 FLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYREP 1381
             LFQ IPWIIVQ   WY+KPIVGGDD V+SSDNT+LFF+SNFQYILTA++LSVGPPYREP
Sbjct: 1092 LLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAVILSVGPPYREP 1151

Query: 1382 MSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQLY 1441
            MS+N  FIVD+ +SI  S+ LM +D+ S+LGK  QLT IS  F +FI++WV++NY+ QLY
Sbjct: 1152 MSRNIGFIVDVIISIVLSIWLMFIDSSSFLGKKFQLTEISFKFKLFILIWVVINYFVQLY 1211

Query: 1442 IPPSI 1446
            +P S+
Sbjct: 1212 VPGSL 1216

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 76/118 (64%), Gaps = 7/118 (5%)

Query: 45   DQNNSEPYAGATFEAVPSSIVSFHHPHSFQSSNL-PSPHSSGNLEQRGRRLTESEPLVLX 103
            +Q N+E Y+G TFE VPSSIVSFHHP SFQSSN+  +   S  L +RGR   ++EPL+  
Sbjct: 1298 NQPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRGR---DTEPLITS 1354

Query: 104  XXXXXXXXXXXXXXX---XXXTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGT 158
                                 T++QI+NAEG STLENTDY+  WDATP+YEQ+R+YGT
Sbjct: 1355 HSPSPIRRSRSSSRNPQFHFFTEDQINNAEGTSTLENTDYNTPWDATPSYEQERLYGT 1412

>Kwal_26.9207
          Length = 1469

 Score = 1707 bits (4420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/1168 (68%), Positives = 966/1168 (82%), Gaps = 9/1168 (0%)

Query: 276  HSEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGL 335
            H+EYLKP YH++F+PQ  P+L +QRFYIAEEDLV+GIA ++TSKF  I Y L   +T GL
Sbjct: 282  HAEYLKPQYHDRFFPQNIPHLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLGL 341

Query: 336  VYLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENY 395
             YLL RW+P  KV+L G K  LAKAEWVV+ENEFGE  I  + R+WYNRPLST+L  +  
Sbjct: 342  FYLLLRWVPRYKVRLCGKKTHLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDKI 401

Query: 396  PNPSYEPNDINLSHHHANEINPNVPILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDL 455
             + + +  + +  HHH ++ NPN+PI+I+F YRY   IYSP++DLFK N+NW D DW+ L
Sbjct: 402  ADITEDIPNHHQRHHHESKENPNIPIMISFSYRYFNLIYSPIEDLFKINSNWTDADWLSL 461

Query: 456  STVSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYY 515
            S++  GL   V EDR LAFG+N INL+ KT+ EILF+EVLHPFYVFQ+FSI+LW  D YY
Sbjct: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSILLWLADNYY 521

Query: 516  YYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIY 575
            YYAACIF+IS+LSI D+L E KK S+ LAE+SH HC+VRV RD FW  +SSSELVPGD+Y
Sbjct: 522  YYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVY 581

Query: 576  EVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSF 635
            E+SDP+++  PCDS+LLS DCIVNESMLTGESVPVSK PA++ET+YQL +DFQ TQIS+F
Sbjct: 582  EISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQISNF 641

Query: 636  VSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFK 695
            ++KSFL+NGT IIR RI   Q+ ALAMVVRTGFSTTKGSL+RSM+FPKP+GFKFY DSFK
Sbjct: 642  LAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFK 701

Query: 696  YIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSR 755
            YIGFM+LIA+ GF +SC+ FI+LGL  K MILRALDIITIVVPPALPATL+IG +FA++R
Sbjct: 702  YIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIAR 761

Query: 756  LKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSD 815
            LK+KGIFCI+PTR+N+SGKIDVMCFDKTGTLTEDGLDVLGV ++EP G +  +FG L+++
Sbjct: 762  LKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITN 821

Query: 816  IRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEE 875
            +R +F K+SLNDC SP+DFKSRNF +SLLTCHSLR VDG LLGDPLDFKMFQFT WS+ E
Sbjct: 822  VRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAE 881

Query: 876  DFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFL 935
            DFQ   FHSL E R+     PEN+ I PAVVHP++ + EN FT+NDPHN LGV+RSFEF+
Sbjct: 882  DFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFV 941

Query: 936  SELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACA 995
            SELRRMSVIVK   ++V+W FTKGAPEVISEICNKSTLPA++E++L+ YTHNGYRVIACA
Sbjct: 942  SELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACA 1001

Query: 996  GKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGD 1055
            GKTLPKRTW ++QKVSREEVESN+EFLGF++F+NKLK  T+ TL SLQDA IR+IMCTGD
Sbjct: 1002 GKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGD 1061

Query: 1056 NILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGN 1115
            N+LTAISVGRE+GLI  S V+VP IND     E +I+WRDV++ D ILD  TL+P+   N
Sbjct: 1062 NVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPM---N 1118

Query: 1116 NSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQL 1175
             S       +YT+AV+GDVFRLLF++   +PE Y+N +LL SSIYARMSPDEKHEL+ QL
Sbjct: 1119 GS------SDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQL 1172

Query: 1176 QKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAA 1235
            Q LDY VGFCGDGANDCGALKAADVG+SLSEAEASVAAPFTS +F ISC+LDVI+EGRA+
Sbjct: 1173 QGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVFEISCILDVIKEGRAS 1232

Query: 1236 LVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEK 1295
            L TSF+CFQYMSLYSAIQF+T+T+LYSRG NLGDFQFLYIDL LIVPIAI MSWSK Y K
Sbjct: 1233 LTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHK 1292

Query: 1296 IDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNT 1355
            + KKRPSANLVSPKIL PL+ ++ ++ +FQ  PW++VQ M WY  P+VGGDDAVQSSDNT
Sbjct: 1293 LVKKRPSANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNT 1352

Query: 1356 VLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTESYLGKML 1415
            VLFF SNFQY+LTAIVLSVGPPYREPMSKN  FI D+ +SI  +++LM +  +S LGK+ 
Sbjct: 1353 VLFFFSNFQYVLTAIVLSVGPPYREPMSKNLGFITDVVISIILNVVLMMVPVDSTLGKVF 1412

Query: 1416 QLTPISNSFTMFIIVWVILNYYAQLYIP 1443
            QLT IS+ F  ++++W +LNY+AQLYIP
Sbjct: 1413 QLTDISSGFKGYLLIWAVLNYFAQLYIP 1440

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 81/155 (52%), Gaps = 4/155 (2%)

Query: 5   SSNQIQH-GQRSERNRRMPRXXXXXXXXXXXXXXXXXXMVLDQNNSEPYAGATFEAVPSS 63
           S++ + H G  + RN RM R                   V+D N++E YAGATFE VPSS
Sbjct: 2   SNSDLSHRGSTNGRNSRM-RPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS 60

Query: 64  IVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVLXXXXXXXXXX-XXXXXXXXXT 122
           IVSFHHPHSF ++      S+ N  +   R  E+E L+                     +
Sbjct: 61  IVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAESLLSSRHSYSRSQGPSRTPNFRYFS 120

Query: 123 QEQISNAEG-ASTLENTDYDMAWDATPAYEQDRIY 156
           +E+I  AEG +STLE+ DYD+ WD TP YEQ+R++
Sbjct: 121 EEEIELAEGVSSTLESADYDINWDGTPTYEQERLH 155

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 1625 bits (4209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 768/1184 (64%), Positives = 948/1184 (80%), Gaps = 24/1184 (2%)

Query: 261  NNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKF 320
            N+R       +  + HSE+LKP YH +F+P   P LHYQRFYIAEEDLV+ IA Y+TS+F
Sbjct: 250  NSRAEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRTSRF 309

Query: 321  WYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQ 380
                Y L C +T GL +L+ RW P ++VK+ G K PL KAEWVV+ENEFGE  ++ + R+
Sbjct: 310  RLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESVKRR 369

Query: 381  WYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVPILITFEYRYIKFIYSPLDDL 440
            WYNRPLSTVL  E   +    P   +  HHH  E NPN+PILI+F+YRY   +YSP+DD+
Sbjct: 370  WYNRPLSTVL-METNEDRIGTPESRHY-HHHETEWNPNLPILISFQYRYFTLVYSPIDDI 427

Query: 441  FKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYV 500
            F++N+NW DPDW+DL  V +GLT  +QEDR LAFGKN +NL+ KT +EILF+E LHPFYV
Sbjct: 428  FRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPFYV 487

Query: 501  FQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKF 560
            FQ+FSIILW  D+YYYYA CIFLISVLSI D++ E KK S  LA++SHF+C+VRV +D+F
Sbjct: 488  FQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRF 547

Query: 561  WTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETM 620
            WT ++SS+LVPGD++E+SDP++ +LPCD++L+S DCIVNESMLTGESVPVSK+ ATE TM
Sbjct: 548  WTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATM 607

Query: 621  YQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMV 680
             QL  DF+S+Q+SSFVSKSFL+NGT IIR R  PGQ  ALA+V+RTGFSTTKGSLVRSMV
Sbjct: 608  AQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMV 667

Query: 681  FPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPA 740
            FPKP GFKFY DSFKYIGFM+LIA+FGF +SC+QFI+LGL+ K MILRALDIITIVVPPA
Sbjct: 668  FPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPA 727

Query: 741  LPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISE 800
            LPATLTIGT+FAL RLK+KGIFCISPTR+N+ GK+D+MCFDKTGTLTE+GLDVLG+  ++
Sbjct: 728  LPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAK 787

Query: 801  PNGVRG-QKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGD 859
            P G     +  +L++D  +V  K +L+DC+S  +FK++NF +SLLTCHSL+ +DG LLGD
Sbjct: 788  PEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGD 847

Query: 860  PLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTD 919
            PLD KMF+FT W++EE ++   F +            + + I PAVVHP SN     F +
Sbjct: 848  PLDLKMFEFTKWAYEEGYESWKFKNA----------EDKTGISPAVVHPTSN---CNFIE 894

Query: 920  NDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEE 979
            NDP N +GV+RSFEFLSELRRMSVIVK   ++ YWSFTKGAPEVI++ICN +T+P DF E
Sbjct: 895  NDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHE 954

Query: 980  VLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETL 1039
            +L  YTHNG+R+IACAGKTLPK +WLYSQKVSREEVE NLEFLGFI+F+NKLK  T   L
Sbjct: 955  LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAAL 1014

Query: 1040 KSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEP 1099
            K LQ+ANIRT+MCTGDN+LTA+SVGR++GLI   RV++P +ND       ++ WRDV+E 
Sbjct: 1015 KELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEE 1074

Query: 1100 DKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSI 1159
              +LD  TLKP+   N+      E +YTLA++GD+FR+LFR++  +P++Y++ +L+  SI
Sbjct: 1075 GSVLDAVTLKPL---NDP-----EKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSI 1126

Query: 1160 YARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKI 1219
            YARMSPDEKHEL+ QLQKLDY VGFCGDGANDCGALKAA++GISLSEAEASVAAPFTS +
Sbjct: 1127 YARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAV 1186

Query: 1220 FNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLL 1279
            F+ISCVLDVI+EGRA+LVTSF+CFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLL
Sbjct: 1187 FDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLL 1246

Query: 1280 IVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYI 1339
            IVPIAI MSWSK   K+ KKRPSANLVSPKILVPL +++ L+ +FQ +PWI VQ  SWY+
Sbjct: 1247 IVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYM 1306

Query: 1340 KPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGAS 1399
            KP+VGGDDAVQSSDNTVLFFVSNFQYILTA+VLS GPPYREPM KN  FI+DI++S+  S
Sbjct: 1307 KPVVGGDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVS 1366

Query: 1400 LLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQLYIP 1443
              LM L+ +++LG++LQLT IS++F   I+     NYYA  YIP
Sbjct: 1367 FGLMYLNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIP 1410

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 77/116 (66%), Gaps = 3/116 (2%)

Query: 43  VLDQNNSEPYAGATFEAVPSSIVSFHHPHSFQSSNL-PSPHSSGNLEQRGRRLTESEPLV 101
           +L+QNN+EPY+GA  E VPSSIVSF+HPHSFQSS    S  SS NLE+RGR  +E +PL+
Sbjct: 40  ILEQNNTEPYSGAAVETVPSSIVSFYHPHSFQSSGYGASAGSSTNLERRGRS-SEHDPLL 98

Query: 102 LXXXXXXXXXXXXXXXXXXXTQEQISNAEG-ASTLENTDYDMAWDATPAYEQDRIY 156
           L                   T+EQ+ NAEG  S++EN DYDM WDA P YEQ+R++
Sbjct: 99  LSTTTSRRSSSSRGRGFQFFTEEQVENAEGITSSVENADYDMDWDAIPTYEQERLH 154

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 1613 bits (4176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 770/1172 (65%), Positives = 928/1172 (79%), Gaps = 22/1172 (1%)

Query: 276  HSEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGL 335
            H+EYLKP YH++FYP+  P+LH QRFYIAEED+V+GIA Y+TS +   IYN+ C LT G+
Sbjct: 271  HAEYLKPRYHDRFYPRNVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLGM 330

Query: 336  VYLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENY 395
            +Y+L +W+P  KVK  G K  L KAEWVV+EN++ E  I  + R WYNRPLSTVLP +  
Sbjct: 331  LYILCKWIPRYKVKFCGSKTFLGKAEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKR- 389

Query: 396  PNPSYEPNDINLSH-HHANEINPNVPILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVD 454
                     +N  H HH +E NPN+PILI+FEYRY+  IYSPL D+F+TN NW DPDW D
Sbjct: 390  -------GLLNSRHYHHESEENPNIPILISFEYRYLTLIYSPLTDIFQTNTNWADPDWTD 442

Query: 455  LSTVSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEY 514
            LS VS GL   + EDR +AFGKN INLR KTTS+ILF+E LHPFY+FQ+FSIILW  D Y
Sbjct: 443  LSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILWMFDAY 502

Query: 515  YYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDI 574
            YYYA CIF+ISVLS+ D+L E K+ S  L+E+S F+CDVRV RD FW+ + SS+LVPGDI
Sbjct: 503  YYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI 562

Query: 575  YEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISS 634
            YE++DP++++LPCDSIL+S DC+VNESMLTGESVPVSK  AT ETM QL DDF  TQ+SS
Sbjct: 563  YELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSS 622

Query: 635  FVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSF 694
            FVSKSFL+NGT +IR R   GQ+ AL MV RTGFSTTKGSLVRSMVFPKPTGFKFY DSF
Sbjct: 623  FVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSF 682

Query: 695  KYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALS 754
            KYIG++S+IA+FGF VS +QF++LGLDK+TMILRALDIIT+VVPPALPA+L+IGT FAL+
Sbjct: 683  KYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALN 742

Query: 755  RLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLS 814
            RLK+KGIFCISPTR+N+ GKIDVMCFDKTGTLTEDGLDVLGV + +P   +  K  +L++
Sbjct: 743  RLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQ-QEMKISKLVT 801

Query: 815  DIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFE 874
            D++ +    SL+DC S  D K++NF +SLLTCHSLR VDG LLGDP DFKM QFT WS E
Sbjct: 802  DVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDE 861

Query: 875  EDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEF 934
            E+   R  HSLYE RH+    PENS   PA+VHP    R   F + +P N +G+VRSFEF
Sbjct: 862  EETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR---FIEREPSNVIGIVRSFEF 918

Query: 935  LSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIAC 994
            LS LRRMSVIVK  +++V+ SFTKGAPEVI E+C+K TLP D+E +L  YTHNGYRVIAC
Sbjct: 919  LSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIAC 978

Query: 995  AGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTG 1054
            AGK L +++WLYSQKVSREE+ESNLEFLGFIIF+NKLK  T ETL+SL  A+IRTIMCTG
Sbjct: 979  AGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTG 1038

Query: 1055 DNILTAISVGREAGLIQCSRVYVPSINDTPLHGE-PVIVWRDVNEPDKILDTKTLKPVKL 1113
            DN+LTAISVGREAGL++  RV+V  IND     E  +I W++V      LD+ TL+P+  
Sbjct: 1039 DNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSG 1098

Query: 1114 GNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMI 1173
              +        +YTLAV+G+VFRLLF+ +    EE +N ILL +SIYARMSPDEKHEL+ 
Sbjct: 1099 DTD--------DYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVE 1150

Query: 1174 QLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGR 1233
            +LQ + Y VGFCGDGANDCGALKAAD+GISLSEAEASVAAPFTS++F ISCVLDV++EGR
Sbjct: 1151 RLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGR 1210

Query: 1234 AALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSY 1293
            AALVTSFACFQYMSLYSA QF+TI ILYSRGSNLGDFQFLYIDL LIVP+A+ MSWSK Y
Sbjct: 1211 AALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPY 1270

Query: 1294 EKIDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSD 1353
            E + KKRP+ANLVSPKIL+PLL+ + ++F+FQ +PW+ VQ M WY +P+VG D+ V SSD
Sbjct: 1271 EVLAKKRPTANLVSPKILIPLLVHIVILFVFQLVPWLAVQHMKWYRQPVVGDDEHVASSD 1330

Query: 1354 NTVLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTESYLGK 1413
            NT+LFFVSNFQYIL A+VLSVGPPYREPMSKN  FI D+ VS+ AS  +M L  +S LG+
Sbjct: 1331 NTILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGR 1390

Query: 1414 MLQLTPISNSFTMFIIVWVILNYYAQLYIPPS 1445
            + QLT  S+ F + II WV LNYYAQLYIPP+
Sbjct: 1391 LFQLTEASHPFCLLIIGWVFLNYYAQLYIPPA 1422

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 75/119 (63%), Gaps = 9/119 (7%)

Query: 43  VLDQNNSEPYAGATFEAVPSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVL 102
           +L+Q NSE YAGA+FEAVPSSIVSFHHPHS++S        S ++ +R RR T SE ++L
Sbjct: 39  ILEQRNSEAYAGASFEAVPSSIVSFHHPHSYRSGAF----GSVDMLERSRRNTGSESVLL 94

Query: 103 XXXXXXXXXXXXXXXXXXX----TQEQISNAEG-ASTLENTDYDMAWDATPAYEQDRIY 156
                                  +++Q+ NAEG ASTLE TDYD  WDATPAYEQ+R++
Sbjct: 95  SPVRSRTSEISRTPSRATHFRFFSEQQLENAEGAASTLEYTDYDTDWDATPAYEQERLH 153

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score =  324 bits (831), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 240/804 (29%), Positives = 395/804 (49%), Gaps = 119/804 (14%)

Query: 423  ITFEYRYIKFIYSPLDDLFKTNNNWID--PDWVDLSTVSNGLTKGVQEDRELAFGKNQIN 480
            + F+++  +F++     +F +    +D  P   +    S GL   +   + L +G+N  +
Sbjct: 125  VFFQFQKKRFLWHEETQVFSSPKFLVDGSPKIAEFQN-SKGLNGDLTHHKRL-YGENSFD 182

Query: 481  LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAAC-IFLISVL---SIFDSLNEQ 536
            + + T  E+     + PF++FQ+F + LW  D+ +YY+   +F+I  +   S+F  L   
Sbjct: 183  IPIPTFLELFKEHAVAPFFIFQLFCVALWLFDDLWYYSLFNLFMIVAMEATSVFQRLTTL 242

Query: 537  KKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVS-DPNITILPCDSILLSSD 595
            K+       M      + V RD  W  + + +L P D+  ++     + +PCD +L+   
Sbjct: 243  KE----FRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLIDGS 298

Query: 596  CIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRAR---- 651
            CIVNE+ML+GES P+ K    E    +  +D    Q+      + L+ GT  ++      
Sbjct: 299  CIVNEAMLSGESTPLLK----ESIKLRPAND--QLQLDGVDKNAVLHGGTKALQVTAPEN 352

Query: 652  ----IAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFG 707
                I P    ALA+V +TGF T++GSLVR M+F         +++  +I F+ + AI  
Sbjct: 353  RTGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYFILFLLIFAIVA 412

Query: 708  FCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPT 767
                  +  ++G  +  +IL  + IIT VVPP LP  LT+  N +L+ L +  ++C  P 
Sbjct: 413  SWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEPF 472

Query: 768  RLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLND 827
            R+  +G+IDV CFDKTGTLT + L           G+ G   G   SDIR +    S ND
Sbjct: 473  RIPYAGRIDVCCFDKTGTLTAEDLVF--------EGLAGLHDG---SDIRTL---KSAND 518

Query: 828  CSSPLDFKSRNFFMSLLTCHSLRSV-DGNLLGDPLDFKMFQFTGWSFE-EDFQKRAFHSL 885
                    S+    ++   H+L  + DG ++GDP++    + + W+ + +D  KRA    
Sbjct: 519  A-------SQEVLSAIGAAHALVKLDDGEIVGDPMEKATLKASSWTVDFKDVVKRA---- 567

Query: 886  YEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIV 945
                                             DN     + ++R F+F S L+R + I 
Sbjct: 568  -------------------------------GADN-----IRILRRFQFSSSLKRSASIA 591

Query: 946  KTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWL 1005
              +N   +++  KGAPE I E  N  ++P+D++++ + +T +G RV+A A K LPK +  
Sbjct: 592  SQSNR--FFAAVKGAPETIRERLN--SVPSDYDDIYKSFTRSGSRVLALAYKDLPKMSNS 647

Query: 1006 YSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGR 1065
                + R+E+E+ L F  F++F   LK +  ET+K L +++ R+IM TGDN LTA+ V +
Sbjct: 648  QIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAK 707

Query: 1066 EAGLIQCSRVYVPSINDTPLHGEP-VIVWRDVNEPDKILDTKTLKPVKLGNNSVESLREC 1124
            E G++    +    I D P+ G    +V RDVNE         +KP    N   ++  E 
Sbjct: 708  EVGIVDRETL----ILDEPIDGSSHALVMRDVNE-------TIVKPF---NPDADTFDEK 753

Query: 1125 ----NYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDY 1180
                 Y LAV+G   +LL   +       L +++ ++ IYAR+SP +K  ++I L+ + Y
Sbjct: 754  EIFQKYDLAVTGHALKLLQGHKQ------LRDVIRHTWIYARVSPSQKEFILITLKDMGY 807

Query: 1181 TVGFCGDGANDCGALKAADVGISL 1204
                CGDG ND GALK A VGI+L
Sbjct: 808  QTLMCGDGTNDVGALKQAHVGIAL 831

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 119/242 (49%), Gaps = 14/242 (5%)

Query: 1203 SLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYS 1262
            SL   +AS AAPFTSK+ N++ V ++IR+GR AL+ +   ++ ++L   I   +++++Y 
Sbjct: 949  SLKLGDASCAAPFTSKLANVNAVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYL 1008

Query: 1263 RGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVF 1322
             G   GD Q     LLL V   + +S  K  EK+ K+RP   + +    + ++ S+   F
Sbjct: 1009 AGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKERPQPGIFN----IYIMGSILGQF 1063

Query: 1323 LFQFIPWIIVQKMSWYIKP----IVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPY 1378
                +  + +    + I+P    +    + V S  NT +F V   Q + T +V   G P+
Sbjct: 1064 AVHILTLVYITTEIYKIEPREPQVDLEKEFVPSLLNTGIFMVQLAQQVSTFVVNYQGEPF 1123

Query: 1379 REPMSKNFEFIVDITVSIGASLLLMTLDTE--SYLGKMLQLTPISNSFTMFIIVWVILNY 1436
            RE +  N      I   +G S+L +   TE    L   ++  P+ + F M +   ++L++
Sbjct: 1124 RENIKNNKGMYYGI---VGVSVLALCGSTEFIPELNAAMKFVPMDDIFKMKLTGTLLLDF 1180

Query: 1437 YA 1438
            + 
Sbjct: 1181 FG 1182

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score =  319 bits (817), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 239/799 (29%), Positives = 384/799 (48%), Gaps = 111/799 (13%)

Query: 425  FEYRYIKFIYSPLDDLFKTNNNWID--PDWVDLSTVSNGLTKGVQEDRELAFGKNQINLR 482
            F+++  +F++      F +    +D  P    L   S GL+ G     +L +G+N  ++ 
Sbjct: 128  FQFQKKRFLWQADLQAFSSPKFLVDEEPKLGKLQQ-SRGLS-GDLTHMKLLYGENTFDIP 185

Query: 483  MKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAA----CIFLISVLSIFDSLNEQKK 538
            + +  E+     + PF+VFQ+F + LW  D+ +Y +      IF +  +S+F  L   K+
Sbjct: 186  VPSFLELFKEHAVEPFFVFQIFCVALWLFDQMWYLSLFNLFMIFAMEAVSVFQRLTTLKE 245

Query: 539  VSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNI-TILPCDSILLSSDCI 597
                   M      + V RD  W  + ++EL+P D+  V+  +  + L CD IL+   CI
Sbjct: 246  ----FKTMGIKPYGINVFRDSKWQLLQTNELLPMDLISVTRTDEDSALSCDMILVDGTCI 301

Query: 598  VNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARI----- 652
            VNE+ML+GES P+ K         +L    +  Q+      S L+ GT +++        
Sbjct: 302  VNEAMLSGESTPLLK------ESVKLRSSEEKLQVEGLDKNSVLHGGTKVLQVTAPEKGS 355

Query: 653  ----APGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGF 708
                AP    ALA+V +TGF T++G+LVR M++         +++  +I F+ + AI   
Sbjct: 356  SSIPAPPDGGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKEALYFILFLLIFAIAAS 415

Query: 709  CVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTR 768
                V+  ++G  +  +IL  + IIT VVP  LP  LT+  N +L+ L +  ++C  P R
Sbjct: 416  WYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKFYVYCTEPFR 475

Query: 769  LNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDC 828
            + ++G+IDV CFDKTGTLT + L   G+      G+ G+        +  +F        
Sbjct: 476  IPLAGRIDVCCFDKTGTLTGEDLVFEGLA-----GLAGKN-----QPVNHLF-----KGT 520

Query: 829  SSPLDFKSRNFFMSLLTCHSL-RSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYE 887
              PLD       + +   H+L R  D  ++GDP++      TGW                
Sbjct: 521  EVPLDTN-----LVIGAAHALVRLDDDEVVGDPMEKATLAATGWK--------------- 560

Query: 888  GRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKT 947
                             V   DS         N+    + ++R F+F S L+R S I   
Sbjct: 561  -----------------VGVKDS-------LSNEKVGDISILRRFQFSSALKRSSTIAVH 596

Query: 948  NNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYS 1007
            N    ++S  KGAPE I E    S +P D+++V + +T  G RV+A A K LP  +    
Sbjct: 597  NKQ--HYSAVKGAPETIRE--RLSQVPTDYDQVYKSFTRAGSRVLALASKKLPSMSIKQI 652

Query: 1008 QKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREA 1067
            +K+ RE VES+LEF GF++F   LK +  ET+K L +++ R IM TGDN LTA+ V +E 
Sbjct: 653  EKLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEV 712

Query: 1068 GLIQCSRVYVPSINDTPLHGEP-VIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRE-CN 1125
             +++   +    I D P+ G    +V+R++ E         + P     ++ E  +    
Sbjct: 713  AIVERETL----ILDEPIDGSSHALVFRNIEE-------TIVNPFNPEKDTFEHSKLFAK 761

Query: 1126 YTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFC 1185
            Y +AV+G   +LL           LNE++ ++ +YAR+SP +K  +M  L+ + Y    C
Sbjct: 762  YDIAVTGHALQLLSGHSQ------LNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTLMC 815

Query: 1186 GDGANDCGALKAADVGISL 1204
            GDG ND GALK A VGI+L
Sbjct: 816  GDGTNDVGALKQAHVGIAL 834

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 98/202 (48%), Gaps = 13/202 (6%)

Query: 1188 GANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMS 1247
            G ND      +D   +L   +AS AAPFTSK+ N+S V ++IR+GR AL+ +   ++ ++
Sbjct: 942  GLND----SESDDAPTLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALINTIQMYKILA 997

Query: 1248 LYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVS 1307
            L   I   +++++Y  G   GD Q   +  LLI    + +S  +  EK+ K+RP   + +
Sbjct: 998  LNCLITAYSLSVIYLAGVKFGDVQ-ATVSGLLITVCFLSISRGQPLEKLSKERPQPGIFN 1056

Query: 1308 PKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKP----IVGGDDAVQSSDNTVLFFVSNF 1363
                V ++ S+   F         + +  ++++P    I    D   S  NT +F +   
Sbjct: 1057 ----VYIMGSILGQFAVHIAALAYINREIYFLEPREPQIDLEKDFSPSLLNTGIFLIQLA 1112

Query: 1364 QYILTAIVLSVGPPYREPMSKN 1385
            Q + T  V   G P+RE +  N
Sbjct: 1113 QQVSTFAVNYQGEPFRENIRSN 1134

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score =  317 bits (813), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 229/754 (30%), Positives = 368/754 (48%), Gaps = 120/754 (15%)

Query: 474  FGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSL 533
            +G N+ ++ + T  E+     + P +VFQVF + LW +DEY+Y       +S+ ++F  L
Sbjct: 175  YGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWY-------LSLFNLFMIL 227

Query: 534  N-EQKKVSRNLAEMSHFHC------DVRVLRDKFWTTISSSELVPGDIYEV-SDPNITIL 585
            + E   V + L  +  F         + VLRD  W  + ++EL+P D+  V      + L
Sbjct: 228  SMEAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSAL 287

Query: 586  PCDSILLSSDCIVNESMLTGESVPVSK-----FPATEETMYQLCDDFQSTQISSFVSKSF 640
            PCD IL+   CIVNE+ML+GES P+ K      P  EE   +  D             S 
Sbjct: 288  PCDLILVDGTCIVNEAMLSGESTPLLKESIRLRPGNEELQIEGTDKI-----------SV 336

Query: 641  LYNGTNIIRARI--------APGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRD 692
            L+ GT +++           +P    A+A+V +TGF T++GSLVR M++         ++
Sbjct: 337  LHGGTKVLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKE 396

Query: 693  SFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFA 752
            +  +I F+ + A+       V+  K+G  +  +IL  + IIT VVPP LP  LT+  N +
Sbjct: 397  ALYFILFLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSS 456

Query: 753  LSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGEL 812
            LS L +  ++C  P R+  +G+IDV CFDKTGTLT + L   G+               L
Sbjct: 457  LSALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGL-------------AGL 503

Query: 813  LSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSL-RSVDGNLLGDPLDFKMFQFTGW 871
             SD + +   +S  DC +          + +   H+L R  DG ++GDP++    +   W
Sbjct: 504  SSDPKDIRHLYSATDCPNSTS-------LVVGAAHALVRLEDGEIVGDPMEKATLKALKW 556

Query: 872  SFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRS 931
            + E+                D VF                        N+ +  + ++R 
Sbjct: 557  TVEKG---------------DKVF------------------------NEKNGQVTILRR 577

Query: 932  FEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRV 991
            F+F S L+R S +    +D   +S  KGAPE I E     T+PA+++E+ + +T +G RV
Sbjct: 578  FQFSSALKRSSSV--ATHDGKLYSAVKGAPETIRE--RLFTIPANYDEIYKSFTRSGSRV 633

Query: 992  IACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIM 1051
            +A A K L K +    +   RE  E +LEF GF+IF   LK +  ET++ L ++  R +M
Sbjct: 634  LALASKKLEKMSQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVM 693

Query: 1052 CTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPV 1111
             TGDN LTA+ V +E G+++   + V  +++     +  +V+R+V E      T + + V
Sbjct: 694  ITGDNPLTAVHVAKEVGIVKGETLIVDMVDNG---NDDKLVFRNVEE------TLSFEFV 744

Query: 1112 KLGNNSVESLRECN-YTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHE 1170
             +  +S E     + Y LAV+G     L           L +++ ++ IYAR+SP +K  
Sbjct: 745  -VSKDSFEKYGIFDKYDLAVTGHALEALKGHHQ------LQDLIRHAWIYARVSPAQKEF 797

Query: 1171 LMIQLQKLDYTVGFCGDGANDCGALKAADVGISL 1204
            ++  L+ + Y    CGDG ND GALK A VG++L
Sbjct: 798  ILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL 831

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 117/242 (48%), Gaps = 14/242 (5%)

Query: 1203 SLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYS 1262
            +L   +AS AAPFTSK+ N+S V ++IR+GR ALV +   ++ ++L   I   +++I+Y 
Sbjct: 950  TLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 1009

Query: 1263 RGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVF 1322
             G   GD Q     LLL V   + +S  K  +K+ K RP A + +    V ++ S+   F
Sbjct: 1010 AGVKFGDGQATTSGLLLSVCF-LSISRGKPLQKLSKARPQAGIFN----VYIMGSILSQF 1064

Query: 1323 LFQFIPWIIVQKMSWYIKPIVGGDDAVQ----SSDNTVLFFVSNFQYILTAIVLSVGPPY 1378
            +      I +    + ++P     D  +    S  NT +F +   Q + T  V   G P+
Sbjct: 1065 VVHIGTLIYLTNEIYRLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPF 1124

Query: 1379 REPMSKNFEFIVDITVSIGASLLLMTLDTE--SYLGKMLQLTPISNSFTMFIIVWVILNY 1436
            RE +  N      +   +G + L +   TE    L + ++  P+ + F M + + + +++
Sbjct: 1125 RENIRSNKGMYYGL---LGVTGLALASATEFIPELNEAMKFVPMEDDFKMKLTITLFVDF 1181

Query: 1437 YA 1438
            + 
Sbjct: 1182 FG 1183

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score =  313 bits (803), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 231/799 (28%), Positives = 390/799 (48%), Gaps = 112/799 (14%)

Query: 425  FEYRYIKFIYSPLDDLFKTNNNWID--PDWVDLSTVSNGLTKGVQEDRELAFGKNQINLR 482
            F+++  +F++   + +F +    +D  P   D      G +  +   + L +G+N  ++ 
Sbjct: 128  FQFQKKRFLWHENEQVFSSPKFLVDESPKIGDFQKC-KGHSGDLTHLKRL-YGENSFDIP 185

Query: 483  MKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRN 542
            + T  E+     + P +VFQVF + LW +DE++YY+    L  ++S+     E   V + 
Sbjct: 186  IPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYS-LFNLFMIISM-----EAAAVFQR 239

Query: 543  LAEMSHFHC------DVRVLRDKFWTTISSSELVPGDIYEVS-DPNITILPCDSILLSSD 595
            L  +  F         + V R+K W  + ++EL+P D+  ++     + +PCD ILL   
Sbjct: 240  LTALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGS 299

Query: 596  CIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIA-- 653
             IVNE+ML+GES P+ K    E    +  +D  + Q+      + L+ GT  ++      
Sbjct: 300  AIVNEAMLSGESTPLLK----ESIKLRPSED--NLQLDGVDKIAVLHGGTKALQVTPPEH 353

Query: 654  ------PGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFG 707
                  P    ALA+V +TGF T++GSLVR M++         +++  +I F+ + A+  
Sbjct: 354  KSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIA 413

Query: 708  FCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPT 767
                 V+  K+G  +  +IL  + IIT VVPP LP  LT+  N +L+ L +  ++C  P 
Sbjct: 414  SWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPF 473

Query: 768  RLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLND 827
            R+  +G+IDV CFDKTGTLT + L   G+      G+          +IR ++     + 
Sbjct: 474  RIPFAGRIDVCCFDKTGTLTGEDLVFEGLA-----GISADS-----ENIRHLY-----SA 518

Query: 828  CSSPLDFKSRNFFMSLLTCHSLRSV-DGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLY 886
              +P      +  + +   H+L  + DG+++GDP++    +  GW+ E            
Sbjct: 519  AEAP-----ESTILVIGAAHALVKLEDGDIVGDPMEKATLKAVGWAVERK---------- 563

Query: 887  EGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVK 946
                                  +SN RE T         L ++R F+F S L+R + I  
Sbjct: 564  ----------------------NSNYREGT-------GKLDIIRRFQFSSALKRSASIAS 594

Query: 947  TNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLY 1006
             N  D  ++  KGAPE I E    S +P +++E+ + +T +G RV+A A K+LPK +   
Sbjct: 595  HN--DALFAAVKGAPETIRE--RLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSK 650

Query: 1007 SQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGRE 1066
               ++R++VES L F GF+IF   LK +  ET+K L +++ R+IM TGDN LTA+ V +E
Sbjct: 651  IDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKE 710

Query: 1067 AGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECN- 1125
             G++    + +     +    +  +++RDV E   I       P     ++ +  +  + 
Sbjct: 711  VGIVFGETLILDRAGKS---DDNQLLFRDVEETVSI-------PFDPSKDTFDHSKLFDR 760

Query: 1126 YTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFC 1185
            Y +AV+G     L           L ++L ++ +YAR+SP +K  L+  L+ + Y    C
Sbjct: 761  YDIAVTGYALNALEGHSQ------LRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMC 814

Query: 1186 GDGANDCGALKAADVGISL 1204
            GDG ND GALK A VGI+L
Sbjct: 815  GDGTNDVGALKQAHVGIAL 833

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 112/235 (47%), Gaps = 14/235 (5%)

Query: 1198 ADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITI 1257
             D   +L   +AS AAPFTSK+ N+S V ++IR+GR ALV +   ++ ++L   I   ++
Sbjct: 947  GDEAPALKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSL 1006

Query: 1258 TILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLIS 1317
            +I+Y  G   GD Q     LLL V   + +S  K  EK+ K+RP + + +    V ++ S
Sbjct: 1007 SIIYMAGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKQRPQSGIFN----VYIMGS 1061

Query: 1318 VFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQ----SSDNTVLFFVSNFQYILTAIVLS 1373
            +   F       + +    + ++P     D  +    S  NT +F +   Q + T  V  
Sbjct: 1062 ILSQFAVHIATLVYITTEIYKLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNY 1121

Query: 1374 VGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTE--SYLGKMLQLTPISNSFTM 1426
             G P+RE +  N      +   +G + L +   TE    L + ++  P+++ F +
Sbjct: 1122 QGEPFRENIRSNKGMYYGL---LGVTGLALASATEFLPELNEAMKFVPMTDDFKI 1173

>Scas_583.14*
          Length = 875

 Score =  230 bits (586), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 164/550 (29%), Positives = 273/550 (49%), Gaps = 83/550 (15%)

Query: 658  AALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIK 717
             AL +V +TGF T +GSLVR M++         +++  +I F+   A+       V+  K
Sbjct: 18   GALVVVTKTGFETYQGSLVRVMIYSAERVGVDNKEALMFILFLLNFAVVASWYVWVEGTK 77

Query: 718  LGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDV 777
            +G  +  +IL  + IIT VVPP LP  LT+  N +L+ L +  ++C  P R+ ++G+IDV
Sbjct: 78   MGRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDV 137

Query: 778  MCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSR 837
             CFDKTGTLT + L   G+      G+  +       D+R +F   S  D S       +
Sbjct: 138  CCFDKTGTLTGEDLVFEGLA-----GLSDKS-----EDVRHLF---SSEDAS-------Q 177

Query: 838  NFFMSLLTCHSLRSVD-GNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFP 896
               + +   H+L  +D G ++GDP++    +  GW  E                      
Sbjct: 178  ETILVVGAAHALVKLDDGEIVGDPMEKATLKALGWKVEG--------------------- 216

Query: 897  ENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSF 956
                              N FT       L ++R F+F S L+R S +   ++ D  ++ 
Sbjct: 217  ------------------NDFTSRPKTGKLQILRRFQFSSALKRSSSV--ASHKDKLFTA 256

Query: 957  TKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVE 1016
             KGAPE I E    + +P +++E+ + +T +G RV+A A K+LP  +      + R+E+E
Sbjct: 257  VKGAPETIRE--RLAVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDRDEIE 314

Query: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVY 1076
            + L F GF++F   LK +  ET+K L ++  R+IM TGDN LTA+ V +E  ++    + 
Sbjct: 315  TGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLI 374

Query: 1077 VPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLREC--NYTLAVSGDV 1134
               ++ +   G+  +++ +V E  KI       P    ++  +  RE    Y +AV+G  
Sbjct: 375  ---LDKSETVGDGKLLFFNVEETIKI-------PFDPASDKFDH-RELFDKYDIAVTGYA 423

Query: 1135 FRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGA 1194
              LL  D ++     L +++ ++ +YAR+SP +K  ++  L+++ Y    CGDG ND GA
Sbjct: 424  LNLL-EDHSQ-----LKDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGA 477

Query: 1195 LKAADVGISL 1204
            LK A VG++L
Sbjct: 478  LKQAHVGVAL 487

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 117/242 (48%), Gaps = 14/242 (5%)

Query: 1203 SLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYS 1262
            +L   +AS AAPFTSK+  +S V ++IR+GR ALV +   ++ ++L   I   +++I+Y 
Sbjct: 610  TLKLGDASCAAPFTSKLSKVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 669

Query: 1263 RGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVF 1322
             G   GD Q     LLL V   + +S  K  +K+ K+RP   + +  I+  +L S F V 
Sbjct: 670  AGVKFGDAQATVSGLLLSVCF-LSISRGKPIQKLSKQRPQKGIFNVYIMGSIL-SQFAVH 727

Query: 1323 LFQFIPWIIVQKMSWYIKPIVGGDDAVQ----SSDNTVLFFVSNFQYILTAIVLSVGPPY 1378
            +F     + + +  + ++P     D  +    S  NT +F +   Q + T  V   G P+
Sbjct: 728  IFTL---VYITREIYILEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPF 784

Query: 1379 REPMSKNFEFIVDITVSIGASLLLMTLDTE--SYLGKMLQLTPISNSFTMFIIVWVILNY 1436
            RE +  N      +   +G S L +   TE    L + +   P+ + F   +   ++L++
Sbjct: 785  RENIRNNRGMYFGL---LGVSSLALVSATEFMPELNEAMNFVPMDDIFKFKLTGTLLLDF 841

Query: 1437 YA 1438
            + 
Sbjct: 842  FG 843

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 184/841 (21%), Positives = 318/841 (37%), Gaps = 157/841 (18%)

Query: 553  VRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSK 612
            V V+RD   + IS   L+ GD+ ++   ++  +P D +L+  +C  +ES LTGES  + K
Sbjct: 159  VVVVRDAAESLISIHNLLVGDLLKLQTGDV--VPADCVLVRGECETDESALTGESNTIKK 216

Query: 613  FPATEETMYQLC------DDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRT 666
             P  +   Y          D  ++  S     S   +   I  +R+  G   A A+V   
Sbjct: 217  LPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSG--LASAIVTNV 274

Query: 667  GFSTTKGSLVRSMV-----FPKPTGFKFYRDSFKYIGFMSLIAIF--------------G 707
            G ++  G  + S+       P         D+    G ++ I +F              G
Sbjct: 275  GVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSG 334

Query: 708  FCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPT 767
                 +   + G     + + A+ +I + VP  LP  +T+   FA +R+ + G       
Sbjct: 335  GKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLR 394

Query: 768  RLNISGKIDVMCFDKTGTLTED------------GLDVLGVQISEPNGVRGQKFGELLSD 815
                 G    +C DKTGTLTE+            G D +G   S+ N V  +K  +LL  
Sbjct: 395  SCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRT 454

Query: 816  IRQVFPKFSLNDCS-SPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFE 874
            +  ++    LN  +    D+K  N + S+      R +           +    T    +
Sbjct: 455  V--IYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLI-----------RRITQTLQKKK 501

Query: 875  EDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPH-----NFLGVV 929
             D ++       EGR E  +  +    + ++       +         H         +V
Sbjct: 502  PDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETIV 561

Query: 930  RSFEFLSELRRMSVIVKTNND-----DVYWSFTKGAPEVISEICNKSTL----------- 973
            +   F S  +  +++VK N++       +  + KGA E++++ C    +           
Sbjct: 562  QIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQK 621

Query: 974  -PADFEEVLRCYTHNGYRVIACAGKTLPKRTW----LYSQKVSREEV--------ESNLE 1020
               D EE +     +  R I+ A        W    L   + S E +        + +LE
Sbjct: 622  SKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHLE 681

Query: 1021 FL---GFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYV 1077
             L     +  Q+ L++    ++   Q A +   M TGDN+LTA ++ R  G++       
Sbjct: 682  GLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSK---- 737

Query: 1078 PSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRL 1137
             S+ND+                                             A+ G  FR 
Sbjct: 738  -SLNDS-------------------------------------------ACAMEGPAFRK 753

Query: 1138 LFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKA 1197
            L   E +        IL    + AR SP++K  L+  L+++   V   GDG ND  ALK 
Sbjct: 754  LSDSERK-------RILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKL 806

Query: 1198 ADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGR--AALVTSFACFQYMSLYSAI 1252
            ADVG S+      VA   +  I    + S +++ I+ GR  AA +  F  FQ +   +A+
Sbjct: 807  ADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAV 866

Query: 1253 --QFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRP---SANLVS 1307
               F+T  I     S L   Q L+++L++    A+ ++  K    I  ++P   S  L++
Sbjct: 867  LLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLIT 926

Query: 1308 P 1308
            P
Sbjct: 927  P 927

>Kwal_14.1498
          Length = 939

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 225/941 (23%), Positives = 374/941 (39%), Gaps = 195/941 (20%)

Query: 460  NGL-TKGVQEDRELAFGKNQIN------LRMKTTSEILFNEVLHPFYVFQVFSIILWGID 512
            NGL T  V E+R   +GKN+I+      L  K  +  + + ++       V S I+  ID
Sbjct: 51   NGLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIMGNID 110

Query: 513  EYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCD-VRVLRDKFWTTISSSELVP 571
            +    A  I L  V+ +     ++ +  ++L  ++    D   ++R    + + +S LVP
Sbjct: 111  D----AVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVP 166

Query: 572  GDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQ 628
            GD+  + V D     +P D  I+ + D  + ES LTGE+ PV K  AT      +  +F 
Sbjct: 167  GDVVRFRVGDR----IPADLRIIEAVDLSIEESNLTGENEPVHKSTAT------VNKEFY 216

Query: 629  STQISSFVSKS----FLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSM-VFPK 683
               + S V  S      + GT ++R     G      +V+ T  +T  G +   M    K
Sbjct: 217  KENLGSIVPVSERSCIAFMGT-LVREGHGRG------IVIGTAKNTAFGKVFEMMNAIEK 269

Query: 684  P-TGFKFYRDSF-KYIGFMSLIAIFGFC-VSCVQFIKLGLDKKTMILRALDIITIVVPPA 740
            P T  +   D   K + FMS I I   C +  +Q    G     M   ++ +    +P  
Sbjct: 270  PKTPLQTAMDKLGKDLSFMSFIVIGIICLIGVIQ----GRSWLEMFQISVSLAVAAIPEG 325

Query: 741  LPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISE 800
            LP  +T+     + R+ ++         +   G ++V+C DKTGTLT + + V       
Sbjct: 326  LPIIVTVTLALGVLRMAKRRAIIRRLPSVETLGSVNVICSDKTGTLTANHMSV------- 378

Query: 801  PNGVRGQKFGELLSDIRQVFPKFSLNDCSS--PLDFKSRNFFMSLLTCHSLRSV--DGNL 856
                             +V+   S+++ S+   LD  +   F   LT   LR+    GNL
Sbjct: 379  ----------------NKVWCLGSMSNKSNILKLDKATSGSFKKNLT-EDLRATLRTGNL 421

Query: 857  LGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENT 916
              +         + +S E        H+ Y G   D    E       V+H      +  
Sbjct: 422  CNN---------STYSHE--------HAKYLGNPTDIALLE-------VLH------KFG 451

Query: 917  FTDNDPHNFLGVVRSFE--FLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC------ 968
              D  P     V RS E  F S+ + M+V VK  N   +    KGA E I E        
Sbjct: 452  LEDERPQ----VTRSDEISFNSKRKFMAVKVKEANGK-FVVHVKGAYEKILEKSTHFINA 506

Query: 969  -NK-----STLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFL 1022
             NK     S L     +       +G R +A A   L       S+K++ +++ + L F 
Sbjct: 507  ENKVVKLDSNLRQAITDSADALASDGLRTLAFAQLELSNGN---SKKLTEDDI-NGLTFA 562

Query: 1023 GFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSIND 1082
            G +   +  +      ++ L + ++  IM TGD   TA+S+ R+ G        +P +N 
Sbjct: 563  GLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIG--------IPVVN- 613

Query: 1083 TPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDE 1142
                            P+                          T  ++GD         
Sbjct: 614  ----------------PE--------------------------TAVLTGDKL------- 624

Query: 1143 NEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGI 1202
            + + E+ L  I+ + +I+AR +P+ K  ++  LQK    V   GDG ND  ALK AD+G+
Sbjct: 625  DHMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV 684

Query: 1203 SLSEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYSAIQFITI 1257
            S+ +    VA   +  +    + S +L  I EG+     + +F  FQ  +  +A+  + I
Sbjct: 685  SMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAI 744

Query: 1258 TILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLIS 1317
               +   + L   Q L+I++L+  P A  +       ++ KK P     + KIL     +
Sbjct: 745  ATAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR--ADKILTK---A 799

Query: 1318 VFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358
            VF   L Q    II+  +  +IK +   D  V + D T+ F
Sbjct: 800  VFQ-RLLQSAALIIIGTIYVFIKEM-AEDGEVTARDTTMTF 838

>Kwal_23.3160
          Length = 1100

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 202/940 (21%), Positives = 373/940 (39%), Gaps = 160/940 (17%)

Query: 461  GLTKGVQEDRELAFGKNQINLRMKTT-SEILFNEVLHPFYVFQVFSIILWGIDEYYYYAA 519
            GL       R   +G+N +    K     IL +++ +   +    S+++      +    
Sbjct: 42   GLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRDWISGG 101

Query: 520  CIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELVPGDIYEVS 578
             I  +  +++     ++ K S+ +  +         V+RD    TI S +LVPGD+  V 
Sbjct: 102  VIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVK 161

Query: 579  DPNITILPCDSILLSSDCI---VNESMLTGESVPVSK-----FPATEETMYQLCDDFQST 630
              +   +P D  L+  +C+    +E++LTGES+P++K     +PATE+T   + D     
Sbjct: 162  AGDT--VPADLRLI--ECVNFETDEALLTGESLPIAKEASQVYPATEDT--PVGDRLNLA 215

Query: 631  QISSFVSKS-----FLYNGTNIIRARIA---PGQTAALAMVVRTGFSTTKGSLVRSMV-- 680
              SS VSK       +  G N    +IA    G  + ++      F    G  + + +  
Sbjct: 216  FASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGS 275

Query: 681  -FPKPTGFKFYRDSFKYIGFMSLIAI-FGFCVSCVQFIKLGLDKKTMILRALDIITIVVP 738
                 TG   +R   K    +  IA+ F   V   Q  K  ++K+  I  A+ +   ++P
Sbjct: 276  FLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQ--KFVVNKEVAIY-AICVAVSMIP 332

Query: 739  PALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQI 798
             +L   LTI  +     +  + +       L   G ++ +C DKTGTLT+  + V    +
Sbjct: 333  SSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWV 392

Query: 799  SEPNGV----RGQKFGELLSDIRQVFPKF--------SLNDCSSPLDFKSR--------- 837
                 +        F      I ++ P+F        S  D      FK++         
Sbjct: 393  PSFGTITVSNSSNPFDPTDGGI-ELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAG 451

Query: 838  ---NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDV 894
                 F++ L   +L ++  ++  DP      +   W    D  + A        H+ D+
Sbjct: 452  LNSKLFLNWLKTAALANI-AHVYQDP------ETEEWKAHGDPTEIAIQVF---AHKLDM 501

Query: 895  FPENSEIIPAVVHPDSNNRENTF-----TDNDPHNFLGVVRSFEFLSELRRMSVI-VKTN 948
             P N+  + A    DS + E+       +  +PH     +  F F S ++RMS + V  +
Sbjct: 502  -PRNA--LTAEDKSDSESDEDAALGEKTSSVEPH--YKHIAEFPFDSSIKRMSAVYVSLD 556

Query: 949  NDDVYWSFTKGAPEVISEICNKSTLP-------------ADFEEVLR---CYTHNGYRVI 992
             D+ +  FTKGA E + + C K  LP              D EEV +     +  G RV+
Sbjct: 557  EDNAHRVFTKGAFERVLDCCTK-WLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVL 615

Query: 993  ACAGKTLPKRTWLYSQ---KVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRT 1049
            A A K+  +   L      + +R+ VES+L F G +   +  ++ET+  +K    A I  
Sbjct: 616  AFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINV 675

Query: 1050 IMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLK 1109
             M TGD   TA ++ +E G++  +  + P                      +++D+  + 
Sbjct: 676  HMLTGDFPGTAKAIAQEVGILPRNLYHYPK---------------------EVVDSMVMT 714

Query: 1110 PVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKH 1169
              +                              +++ +E ++ +LL   + AR +P  K 
Sbjct: 715  AAQF-----------------------------DQLTDEEIDNLLLLPLVIARCAPQTKV 745

Query: 1170 ELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---NISCVL 1226
             ++  L + +      GDG ND  +LK A+VGI++    + VA   +  +    N + +L
Sbjct: 746  RMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASIL 805

Query: 1227 DVIREGR--AALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIA 1284
            + + EGR  +  +  F         +   ++ I + +     L  F    +++L I+ + 
Sbjct: 806  NAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVT 865

Query: 1285 IC-----MSWSKSYEKIDKKRP---SANLVSPKILVPLLI 1316
             C     +   KS   I +K P    A + + +I++ +LI
Sbjct: 866  SCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLI 905

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  116 bits (290), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 185/868 (21%), Positives = 339/868 (39%), Gaps = 165/868 (19%)

Query: 555  VLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFP 614
            V+R+     IS   ++ GD+  +   ++  +P D +++S  C  +ES +TGES  + KFP
Sbjct: 196  VIRNDQEILISIHHVLVGDVISLQTGDV--VPADCVMISGKCEADESSITGESNTIQKFP 253

Query: 615  AT-------------EETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALA 661
                                +  D     +  + ++   L +G+ I+             
Sbjct: 254  VDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSG-------LGRG 306

Query: 662  MVVRTGFSTTKGSLVRSM-VFPKPTGFKFY----RDSFKYIGFMSLIAIFGFCVSCVQFI 716
            ++   G ++  G  + S+   P+ T  + +     D+    G +S I +F    +   F 
Sbjct: 307  VITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFY 366

Query: 717  KLGLDKK--------------TMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIF 762
             +  D +               + + ++ +I + VP  LP  +T+   FA +R+ + G  
Sbjct: 367  IIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNL 426

Query: 763  CISPTRLNISGKIDVMCFDKTGTLTEDGLDVL-------------GVQISEPNGVRGQKF 809
                      G    +C DKTGTLTE+ + V+              + +SE   +  +K 
Sbjct: 427  VRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKV 486

Query: 810  GE--LLSDIRQ-VFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNL-LGDPLDFKM 865
             E    S +R  +     LN  +    F++R++  +    +  +++  NL   D    ++
Sbjct: 487  FEENCSSSLRNDLLANIVLNSTA----FENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRL 542

Query: 866  FQFTGWSFEEDFQKRAFHSLYEGRHEDDVFP--ENSEIIPAVVHPDSNNRENTFTDNDPH 923
              F   + E+D + + F ++ +GR E  +    E + +  A +       E  +  + P 
Sbjct: 543  SFFKKGNREDD-EDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPM 601

Query: 924  ---NFLGVVRSFEFLSELRRMSVIVK----TNNDDVYWSFTKGAPEVISEICN-KSTLPA 975
               N   VV++  F S  +   ++VK     N    Y  F KGA E++S+ C+ K     
Sbjct: 602  EKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDD 661

Query: 976  DFEEV-----------LRCYTHNGYRVIACAGKTLPK-RTWLYSQKVSREE--------- 1014
              EE+           ++    +  R I+ A K   +  +W   Q   ++          
Sbjct: 662  TLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLL 721

Query: 1015 --VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQC 1072
               +  L   G +  Q+ L+    E+++  Q A +   M TGDNILTA ++ R   ++  
Sbjct: 722  FNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILS- 780

Query: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSG 1132
                      T +  E                                     Y+ A+ G
Sbjct: 781  ----------TDISSEA------------------------------------YS-AMEG 793

Query: 1133 DVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDC 1192
              FR L ++E          IL N  + AR SP++K  L+  L+ +   V   GDG ND 
Sbjct: 794  TEFRKLTKNERI-------RILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDA 846

Query: 1193 GALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAALVT--SFACFQYMS 1247
             ALK ADVG S+  +   VA   +  I    + S +++ I+ GR   V+   F  FQ + 
Sbjct: 847  PALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIV 906

Query: 1248 LYSAI--QFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRP---S 1302
              +A+   F++        S L   Q L+I+L++    A+ ++  K    I  ++P   S
Sbjct: 907  NITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRS 966

Query: 1303 ANLVS----PKILVPLLISVFLVFLFQF 1326
             +L+S      IL    + + + F+  F
Sbjct: 967  TSLISVSTWKMILSQATLQLIVTFILHF 994

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 198/862 (22%), Positives = 345/862 (40%), Gaps = 170/862 (19%)

Query: 458  VSNGLTKGVQEDREL----AFGKNQINLRMKTT-SEILFNEVLHPFYVFQVFSI-ILWGI 511
            +   LT+G+ +D  L    A G+N +    K     ++ ++V +   +  V S+ I + +
Sbjct: 29   IGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAV 88

Query: 512  DEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELV 570
             ++       F+I+V ++   L ++ K ++ +  + +    +  V+R+    TI+S ++V
Sbjct: 89   RDWITGGVISFVIAV-NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVV 147

Query: 571  PGDI--YEVSDPNITILPCDSILLSSDCI-VNESMLTGESVPVSK-----FPATEETMY- 621
            PGDI   +V D     +P D  L+ +     +ES+LTGES+PVSK     F   EET   
Sbjct: 148  PGDICLVKVGDT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG 203

Query: 622  -QLCDDFQSTQISSFVSKSF-LYNGTNIIRARIAPGQTAALAMVVR---------TGFST 670
             +L   F S+ +    +K   +    N    +IA        ++ R         T  ST
Sbjct: 204  DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWIST 263

Query: 671  TKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRAL 730
             K   V         G   +R   K    +  IA+  F +  +   K  +DK+  I  A+
Sbjct: 264  KK---VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY-AI 318

Query: 731  DIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDG 790
             +   ++P +L   LTI  +   + +  + +       L   G ++ +C DKTGTLT+  
Sbjct: 319  CVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 791  LDVLGVQISEPNGVRGQKFGEL-LSDIRQVF----------PKFSLNDCSSPLD------ 833
            +  L  QI  P      +FG + +S+    F          P+FS  + S   D      
Sbjct: 379  M--LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGIL 430

Query: 834  --FKSR------------NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQK 879
              FK R            + F   L   +L ++      D  D        W    D  +
Sbjct: 431  QNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDC-------WKAHGDPTE 483

Query: 880  RAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNR--ENTFTDNDPHNFLGVVRSFEFLSE 937
             A   ++  + +    P N     A+    S N+  EN  +    HN       FE ++E
Sbjct: 484  IAIQ-VFATKMD---LPHN-----ALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAE 534

Query: 938  ------LRRMSVIVKTNNDDVYWSFTKGAPEVISEICN--------KSTLPADFE-EVLR 982
                  ++RMS +   N+++ Y  + KGA E I   C+        K T   D + E +R
Sbjct: 535  FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIR 594

Query: 983  ----CYTHNGYRVIACAGKTLPKRT----WLYSQKVSREEVESNLEFLGFIIFQNKLKKE 1034
                  ++ G RV+  A K+  K       L +   +R   ES+L FLG I   +  + E
Sbjct: 595  KNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNE 654

Query: 1035 TSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWR 1094
            T+  +K    A I   M TGD + TA ++ +E G++                        
Sbjct: 655  TAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL------------------------ 690

Query: 1095 DVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL 1154
                           P  L + S    +E   ++ ++G  F       + + EE ++++ 
Sbjct: 691  ---------------PTNLYHYS----QEIVDSMVMTGSQF-------DGLSEEEVDDLP 724

Query: 1155 LNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAP 1214
            +   + AR SP  K  ++  L +        GDG ND  +LK A+VGI++    + V+  
Sbjct: 725  VLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784

Query: 1215 FTSKIF---NISCVLDVIREGR 1233
             +  +    N + +L+ + EGR
Sbjct: 785  ASDIVLSDDNFASILNAVEEGR 806

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  112 bits (281), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 198/862 (22%), Positives = 345/862 (40%), Gaps = 170/862 (19%)

Query: 458  VSNGLTKGVQEDREL----AFGKNQINLRMKTT-SEILFNEVLHPFYVFQVFSI-ILWGI 511
            +   LT+G+ +D  L    A G+N +    K     ++ ++V +   +  V S+ I + +
Sbjct: 29   IGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAV 88

Query: 512  DEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELV 570
             ++       F+I+V ++   L ++ K ++ +  + +    +  V+R+    TI+S ++V
Sbjct: 89   RDWITGGVISFVIAV-NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVV 147

Query: 571  PGDI--YEVSDPNITILPCDSILLSSDCI-VNESMLTGESVPVSK-----FPATEETMY- 621
            PGDI   +V D     +P D  L+ +     +ES+LTGES+PVSK     F   EET   
Sbjct: 148  PGDICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG 203

Query: 622  -QLCDDFQSTQISSFVSKSF-LYNGTNIIRARIAPGQTAALAMVVR---------TGFST 670
             +L   F S+ +    +K   +    N    +IA        ++ R         T  ST
Sbjct: 204  DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWIST 263

Query: 671  TKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRAL 730
             K   V         G   +R   K    +  IA+  F +  +   K  +DK+  I  A+
Sbjct: 264  KK---VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY-AI 318

Query: 731  DIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDG 790
             +   ++P +L   LTI  +   + +  + +       L   G ++ +C DKTGTLT+  
Sbjct: 319  CVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 791  LDVLGVQISEPNGVRGQKFGEL-LSDIRQVF----------PKFSLNDCSSPLD------ 833
            +  L  QI  P      +FG + +S+    F          P+FS  + S   D      
Sbjct: 379  M--LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGIL 430

Query: 834  --FKSR------------NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQK 879
              FK R            + F   L   +L ++      D  D        W    D  +
Sbjct: 431  QNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDC-------WKAHGDPTE 483

Query: 880  RAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNR--ENTFTDNDPHNFLGVVRSFEFLSE 937
             A   ++  + +    P N     A+    S N+  EN  +    HN       FE ++E
Sbjct: 484  IAIQ-VFATKMD---LPHN-----ALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAE 534

Query: 938  ------LRRMSVIVKTNNDDVYWSFTKGAPEVISEICN--------KSTLPADFE-EVLR 982
                  ++RMS +   N+++ Y  + KGA E I   C+        K T   D + E +R
Sbjct: 535  FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIR 594

Query: 983  ----CYTHNGYRVIACAGKTLPKRT----WLYSQKVSREEVESNLEFLGFIIFQNKLKKE 1034
                  ++ G RV+  A K+  K       L +   +R   ES+L FLG I   +  + E
Sbjct: 595  KNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNE 654

Query: 1035 TSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWR 1094
            T+  +K    A I   M TGD + TA ++ +E G++                        
Sbjct: 655  TAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL------------------------ 690

Query: 1095 DVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL 1154
                           P  L + S    +E   ++ ++G  F       + + EE ++++ 
Sbjct: 691  ---------------PTNLYHYS----QEIVDSMVMTGSQF-------DGLSEEEVDDLP 724

Query: 1155 LNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAP 1214
            +   + AR SP  K  ++  L +        GDG ND  +LK A+VGI++    + V+  
Sbjct: 725  VLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784

Query: 1215 FTSKIF---NISCVLDVIREGR 1233
             +  +    N + +L+ + EGR
Sbjct: 785  ASDIVLSDDNFASILNAVEEGR 806

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 196/862 (22%), Positives = 345/862 (40%), Gaps = 170/862 (19%)

Query: 458  VSNGLTKGVQED----RELAFGKNQINLRMKTT-SEILFNEVLHPFYVFQVFSIIL-WGI 511
            +   LT+G+ +D    R    G+N +    K     ++ ++V +   +  + S+I+ + +
Sbjct: 29   IGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAM 88

Query: 512  DEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELV 570
             ++       F+I+V ++   L ++ K ++ +  + +    +  V+R+    TI+S ++V
Sbjct: 89   HDWITGGVISFVIAV-NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVV 147

Query: 571  PGDI--YEVSDPNITILPCDSILLSSDCI-VNESMLTGESVPVSK-----FPATEETMY- 621
            PGDI   +V D     +P D  L+ +     +ES+LTGES+PVSK     F   EET   
Sbjct: 148  PGDICLVKVGDT----IPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG 203

Query: 622  -QLCDDFQSTQISSFVSKSF-LYNGTNIIRARIAPGQTAALAMVVR---------TGFST 670
             +L   F S+ +    +K   +    N    +IA        ++ R         T  ST
Sbjct: 204  DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWIST 263

Query: 671  TKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRAL 730
             K   V         G   +R   K    +  IA+  F +  +   K  +DK+  I  A+
Sbjct: 264  KK---VTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY-AI 318

Query: 731  DIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDG 790
             +   ++P +L   LTI  +   + +  + +       L   G ++ +C DKTGTLT+  
Sbjct: 319  CVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 791  LDVLGVQISEPNGVRGQKFGEL-LSDIRQVF----------PKFSLNDCSSPLD------ 833
            +  L  QI  P      +FG + +S+    F          P+FS  + S   D      
Sbjct: 379  M--LARQIWIP------RFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGIL 430

Query: 834  --FKSR------------NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQK 879
              FK R            + F   L   +L ++      D  D        W    D  +
Sbjct: 431  QNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDC-------WKAHGDPTE 483

Query: 880  RAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNR--ENTFTDNDPHNFLGVVRSFEFLSE 937
             A   ++  + +    P N     A+    S N+  EN  +    HN       FE ++E
Sbjct: 484  IAIQ-VFATKMD---LPHN-----ALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAE 534

Query: 938  ------LRRMSVIVKTNNDDVYWSFTKGAPEVISEICN--------KSTLPADFE-EVLR 982
                  ++RMS +   N+++ Y  + KGA E I   C+        K T   D + E +R
Sbjct: 535  FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIR 594

Query: 983  ----CYTHNGYRVIACAGKTLPKRT----WLYSQKVSREEVESNLEFLGFIIFQNKLKKE 1034
                  ++ G RV+  A K+  K       L +   +R   ES+L FLG I   +  + E
Sbjct: 595  KNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNE 654

Query: 1035 TSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWR 1094
            T+  +K    A I   M TGD + TA ++ +E G++                        
Sbjct: 655  TAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL------------------------ 690

Query: 1095 DVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL 1154
                           P  L + S    +E   ++ ++G  F       + + EE ++++ 
Sbjct: 691  ---------------PTNLYHYS----QEIVDSMVMTGSQF-------DGLSEEEVDDLP 724

Query: 1155 LNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAP 1214
            +   + AR SP  K  ++  L +        GDG ND  +LK A+VGI++    + V+  
Sbjct: 725  VLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKE 784

Query: 1215 FTSKIF---NISCVLDVIREGR 1233
             +  +    N + +L+ + EGR
Sbjct: 785  ASDIVLSDDNFASILNAVEEGR 806

>Kwal_47.17547
          Length = 1240

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 190/842 (22%), Positives = 315/842 (37%), Gaps = 167/842 (19%)

Query: 552  DVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVS 611
            +V VLR+     IS  +++ GDI  +   ++  +P D IL+   C  +ES LTGES  + 
Sbjct: 187  EVIVLRNGDEHLISIHDILVGDILSLQTGDV--VPADCILVKGSCECDESALTGESATIK 244

Query: 612  KFPATEETMYQLCDDFQSTQIS--------SFVSKSFLYNGTNIIRARIAPGQTAALAMV 663
            K  A  +  Y+      +T  +          V    L +G+ ++            A+V
Sbjct: 245  K--AAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSG-------LGRAVV 295

Query: 664  VRTGFSTTKG-SLVRSMVFPKPTGFKFYRDSFK---------------YIGFMSLIAIF- 706
               G ++  G +L+   V  + T  +   DS                 +I FM  +A   
Sbjct: 296  TSVGVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLK 355

Query: 707  -GFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCIS 765
             G  +  +   + G     + +  + +I + VP  LP  +T+   FA +R+ + G     
Sbjct: 356  KGGELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRV 415

Query: 766  PTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSL 825
                   G    +C DKTGTLTE+ + V+        G  G  F     +   V P  S 
Sbjct: 416  LRACETMGSATAVCSDKTGTLTENRMTVV-------KGFLGSTF---FDEAESVGPSDSE 465

Query: 826  NDCSSPLDFK-SRNFFMSLLTCHSLRSV---------DGNLLGDPLDFKMFQFTGWSFEE 875
             D    +  + S      +LT  +L S          D     +P          WS   
Sbjct: 466  TDVDLAIANECSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNN 525

Query: 876  DFQKRA-FHSLYEGRHEDD----VFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGV-- 928
              +K A    L E    D          +E         +   +N     D  + LG+  
Sbjct: 526  KSKKPATAKELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEK 585

Query: 929  -VRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC-------NKSTL--PADFE 978
             V+   F S  +   ++VK  N  ++  + KGA E++   C       +K TL    DF+
Sbjct: 586  IVQIIPFESSRKWGGIVVKYKNG-LHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFD 644

Query: 979  EVLRCYTH---NGYRVIACAGKTLPK-RTW------------------LYSQKVSR---- 1012
            E  +  T+      R I+ A +  P    W                  L+  +VSR    
Sbjct: 645  EESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSV 704

Query: 1013 ----EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAG 1068
                +E+ S +   G +  Q+ L+K   ++++  Q A +   M TGDNILTA ++ ++  
Sbjct: 705  SEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCS 764

Query: 1069 LIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTL 1128
            ++   +   P                                     +S+E  R      
Sbjct: 765  ILSEEQAENP------------------------------------ESSMEGPR------ 782

Query: 1129 AVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDG 1188
                  FR L   E          IL N  + AR SP++K  L+  L+K+   V   GDG
Sbjct: 783  ------FRKLSNKERV-------RILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDG 829

Query: 1189 ANDCGALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGR--AALVTSFACF 1243
             ND  ALK ADVG S+  A   VA   +  I    + S +++ I+ GR  +  +  F  F
Sbjct: 830  TNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQF 889

Query: 1244 QYMSLYSAI--QFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRP 1301
            Q     +A+   F++        S L   Q L+++L++    A+ ++  K  E I +++P
Sbjct: 890  QLTVNVTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENILERKP 949

Query: 1302 SA 1303
              
Sbjct: 950  KG 951

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 189/823 (22%), Positives = 317/823 (38%), Gaps = 160/823 (19%)

Query: 562  TTISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGESVPVSK--FPAT 616
            T + +S LVPGD+  ++V D     +P D  I+ S+D  ++ES LTGE+ PV K   P  
Sbjct: 168  THVLASCLVPGDLVYFKVGDR----IPADVRIIESTDLSLDESTLTGETEPVHKSCTPVN 223

Query: 617  EETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLV 676
              T      D     I      S  Y GT ++R     G      +VV TG  T  G++ 
Sbjct: 224  SATY----SDVPGGIIPIGERTSIAYMGT-LVREGHGKG------IVVATGKHTMFGAVF 272

Query: 677  RSM------VFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRAL 730
              M        P        R    Y+ F+ L  I  F +  +Q    G     M   ++
Sbjct: 273  EMMNSIEKPKTPLQMAMDTLRRDLSYVRFV-LSGII-FLLGVIQ----GRSWLEMFQISV 326

Query: 731  DIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDG 790
             +    +P  LP  +T+     + R+  +         +   G ++V+C DKTGTLT + 
Sbjct: 327  SLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANH 386

Query: 791  LDV-----LGVQISEPN--GVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSL 843
            +       LG   ++ N   +  +  G L   +  +  K  L+D     D K+     S+
Sbjct: 387  MTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNL--KNYLSD-----DVKATLRIGSI 439

Query: 844  LTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIP 903
                S     G  LG+P D  +         E  QK             D    NS+   
Sbjct: 440  CNNASFSHEHGKYLGNPTDIALL--------EVLQKFDLVDERPTTTRVDELTFNSKRKY 491

Query: 904  AVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEV 963
              V  DS         N   + + V  +FE +  L R +            SF  GA +V
Sbjct: 492  MAVKVDS-------PANSGKHIIYVKGAFERI--LERSA------------SFIGGAGKV 530

Query: 964  ISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLG 1023
                 +  +L  D  + L      G R +A A      +    + K   +    NL F+G
Sbjct: 531  EKLSDSHKSLINDCAKSL---ASEGLRTLAFA------QLECSTNKPMNDSTIQNLTFVG 581

Query: 1024 FIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDT 1083
             I  ++  +      ++ L    +  IM TGD   TA+++ R+ G        +P IN  
Sbjct: 582  LIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG--------IPVIN-- 631

Query: 1084 PLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDEN 1143
                 P I                                      ++GD  RL     +
Sbjct: 632  -----PEIS------------------------------------VLTGD--RL-----D 643

Query: 1144 EIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGIS 1203
            ++ ++ L  ++ + +I+AR +P+ K  ++  LQK    V   GDG ND  ALK AD+G++
Sbjct: 644  QMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVA 703

Query: 1204 LSEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYSAIQFITIT 1258
            +      VA   +  +    + S +L  I EG+     + SF  FQ  +  +A+  + I 
Sbjct: 704  MGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIA 763

Query: 1259 ILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRP---SANLVSPKILVPLL 1315
              +   + L   Q L+I++L+  P A  +       ++ +K P   S  +++P+++  LL
Sbjct: 764  TAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLL 823

Query: 1316 ISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358
            I+    F+     ++ +++M+         D  V + D T+ F
Sbjct: 824  INA--AFIIGGTIYVFIKEMTE--------DGQVTARDTTMTF 856

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 194/859 (22%), Positives = 333/859 (38%), Gaps = 174/859 (20%)

Query: 455  LST-VSNGLTKGVQEDRELAFGKNQINLRMKTTSEILF-NEVLHPFYVFQVFSIILWGID 512
            LST ++ GL      +R    G+N +    K   + +F +++ +   +  + S+++    
Sbjct: 31   LSTHINQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMIMVLIISMVISFAI 90

Query: 513  EYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELVP 571
            + +     I  +  +++     ++   S+ +  +         V+R     TI S ELVP
Sbjct: 91   KDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAGNDLTIESKELVP 150

Query: 572  GDI--YEVSDPNITILPCDSILLSS-DCIVNESMLTGESVPVSKFPATEETMYQLCDDFQ 628
            GDI    V D     +P D  L  + +   +E++LTGES+PV+K   +   +Y+     Q
Sbjct: 151  GDICIIRVGD----TVPADLRLFEAINLETDEALLTGESLPVAK---SHGEVYE-----Q 198

Query: 629  STQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFK 688
             T +   ++ +F    + + + R       A  +V++T  +T  G + +S+   K     
Sbjct: 199  DTPVGDRLNLAFA--ASTVTKGR-------ATGIVIKTALNTEIGKIAKSL---KSEASL 246

Query: 689  FYRDSFKYIGF-------MSLIAIFGFCVSCVQFIKL-------------------GLDK 722
              RD  K  G         S+    G  V      KL                   G  K
Sbjct: 247  ISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQK 306

Query: 723  ----KTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVM 778
                K + + A+ +   ++P +L   LTI  +     +  + +       L   G ++ +
Sbjct: 307  FKVNKQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDI 366

Query: 779  CFDKTGTLTEDGLDVLGVQISEPNGVRGQK----FGELLSDIRQVFPKFS--------LN 826
            C DKTGTLT+  +    V I +   +  Q     F   + +I Q+ PKFS          
Sbjct: 367  CSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEI-QLIPKFSPYQYKHDDEE 425

Query: 827  DCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLY 886
            D     DFKS+ +               + LG PL+  +F  T W +       A  +++
Sbjct: 426  DVGMITDFKSKYY--------------ADELG-PLNVSLF--TQWLYTATLANIA--TVF 466

Query: 887  EGRHEDD--VFPENSEIIPAV--VHPDSNNRENTFTDNDP----HNFLGV--VRSFEFLS 936
                  D     + +EI   V     D   R  T  DND     HN +    V  + F S
Sbjct: 467  RDPETQDWKAHGDPTEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDS 526

Query: 937  ELRRMSVIVKTNNDD---VYWSFTKGAPEVISEICNK-STLP---------ADFEEVLR- 982
             ++RMS I K   +    +Y  FTKGA E + + CN   T P          D E V + 
Sbjct: 527  SVKRMSAIYKNVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKN 586

Query: 983  --CYTHNGYRVIACAGKTLPKRTWLYSQKV---SREEVESNLEFLGFIIFQNKLKKETSE 1037
                +  G RV+A A KT  +  +  ++      R+ VE+NL FLG +   +  ++E+  
Sbjct: 587  VDTLSSEGLRVLAFAKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLA 646

Query: 1038 TLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVN 1097
             +K    A I   M TGD   TA S+ +E G++  +  + P                   
Sbjct: 647  AVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK------------------ 688

Query: 1098 EPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNS 1157
                                       N+ +  + D   L  ++ +E+P   L       
Sbjct: 689  ------------------------EVVNFMVMTATDFDALSDKEIDELPVLPL------- 717

Query: 1158 SIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTS 1217
             + AR +P  K  ++  L + +      GDG ND  +LK A+VGI++    + VA   + 
Sbjct: 718  -VIARCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASD 776

Query: 1218 KIF---NISCVLDVIREGR 1233
             +    N + +L+ + EGR
Sbjct: 777  IVLSDDNFASILNAVEEGR 795

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 196/875 (22%), Positives = 337/875 (38%), Gaps = 157/875 (17%)

Query: 503  VFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWT 562
            + S+ L  ID+       I ++  +        +K +   L ++    C   ++R    +
Sbjct: 114  IISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEA-LNKLVPQEC--HLIRGGRES 170

Query: 563  TISSSELVPGDI--YEVSD---PNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATE 617
             + ++ LVPGD+  + + D    +I I+ C+      D  ++ES LTGE+ PV K     
Sbjct: 171  NVLATNLVPGDLVRFRIGDRIPADIRIIECN------DLTIDESNLTGETDPVHK----- 219

Query: 618  ETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVR 677
             +   L  D  + Q +S V    +   TNI        +     +VV TG  T+ G++  
Sbjct: 220  -SYKALSRDSYNDQPNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFE 275

Query: 678  SMV-FPKP-TGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITI 735
             M    KP T  +   D  K    +SL +     + CV  I  G     M   ++ +   
Sbjct: 276  MMSSIEKPKTPLQLTMD--KLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVA 333

Query: 736  VVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV-- 793
             +P  LP  +T+     + R+ ++         +   G ++V+C DKTGTLT + + V  
Sbjct: 334  AIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 393

Query: 794  ---LGVQISEPN--GVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHS 848
               LG   ++ N   +   K G L         K  L D     D K+     +L    S
Sbjct: 394  IWCLGSMANKLNVLSLDKNKGGNL---------KNYLTD-----DVKTTLLCGNLCNNAS 439

Query: 849  LRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHP 908
                    LG+P D  +         E  QK             DV  E +++     + 
Sbjct: 440  YSQEHAKYLGNPTDVALL--------EQLQKFELA---------DVRSEYTKVKELSFNS 482

Query: 909  DSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC 968
                      DN+    L +  +FE + + +  S + +          T G  E I +  
Sbjct: 483  KRKMMATKIQDNEKKTTLFIKGAFERILD-KSSSYLTEKGK---IEKLTAGHRETIIDCA 538

Query: 969  NKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQ 1028
            N  TL ++           G RV+A A + +       S K+  +++ S+L F G I   
Sbjct: 539  N--TLASE-----------GLRVLAFAKRAMTDS----SSKLVEDDI-SDLVFTGLIGMN 580

Query: 1029 NKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGE 1088
            +  +      +       I  IM TGD+  TA+++ R+ G+                   
Sbjct: 581  DPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI------------------- 621

Query: 1089 PVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEE 1148
            PVI      +P            KL                +SGD         NE+ ++
Sbjct: 622  PVI------DP------------KLS--------------VLSGDKL-------NEMTDD 642

Query: 1149 YLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAE 1208
             L  ++ + +I+AR +P+ K  ++  L++    V   GDG ND  ALK AD+G+S+    
Sbjct: 643  QLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMG 702

Query: 1209 ASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYSAIQFITITILYSR 1263
              VA   +  I    + S +L  I EG+     + +F  FQ  +  +A+  + ++  +  
Sbjct: 703  TDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFML 762

Query: 1264 GSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFL 1323
             + L   Q L+I++L+  P A  +       ++ KK P     + KIL   L    L  L
Sbjct: 763  PNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR--TDKILTAEL----LKRL 816

Query: 1324 FQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358
                  II+  +  ++K +   D  V + D T+ F
Sbjct: 817  IGTASCIILGTVYVFVKEM-AEDGQVTARDTTMTF 850

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 136/606 (22%), Positives = 244/606 (40%), Gaps = 119/606 (19%)

Query: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNIS----GKIDVMCFD 781
            ILR L + + ++P +L   L +  +    +++       +  R +      G+I+ +  D
Sbjct: 444  ILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 503

Query: 782  KTGTLTEDGLDVLGVQI------SEPNGVRGQKFGELLSDIRQVF--PKFSLNDCSSPLD 833
            KTGTLT++ + +  + +      SE   +       L+S         K +L+     + 
Sbjct: 504  KTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMS 563

Query: 834  FKSRNFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFEEDFQKRAFHSLYEG 888
            F+ R+  ++L  CH++     D  L      P +  + +FT  S      KR  HS+   
Sbjct: 564  FRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTE-SVGLSLFKRDRHSI--- 619

Query: 889  RHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTN 948
                           +++H  S    N            +++ F F S+ +RM +IV+  
Sbjct: 620  ---------------SLLHEHSGKTLN----------YEILQVFPFNSDSKRMGIIVRDE 654

Query: 949  NDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQ 1008
              D YW   KGA  V+S+I   +      EE        G R +    K L K+ +   Q
Sbjct: 655  QLDEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKKLNKKIYEQFQ 711

Query: 1009 K---------VSREE---------VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTI 1050
            K         ++R++         +E +LE LG    ++KL+K+   +++ L++A I+  
Sbjct: 712  KEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIW 771

Query: 1051 MCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKP 1110
            M TGD + TA  V   A LI                G+ V     V  P+   +   L+ 
Sbjct: 772  MLTGDKVETARCVSISAKLIS--------------RGQYVHTITKVTRPEGAFN--QLEY 815

Query: 1111 VKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSPDEKH 1169
            +K+  N+          L + G+   +  +      +E+ + ++ L + I  R +P +K 
Sbjct: 816  LKINRNAC---------LLIDGESLGMFLK---HYEQEFFDVVVHLPTVIACRCTPQQKA 863

Query: 1170 ELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCV 1225
            ++ + ++K+      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F   C 
Sbjct: 864  DVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CH 920

Query: 1226 LD--VIREGRAALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPI 1283
            L   ++  GR +   S    Q+              +  RG  +   Q +Y    L  PI
Sbjct: 921  LTELLLWHGRNSYKRSAKLAQF--------------VMHRGLIIAICQAVYSICSLFEPI 966

Query: 1284 AICMSW 1289
            A+   W
Sbjct: 967  ALYQGW 972

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 179/836 (21%), Positives = 322/836 (38%), Gaps = 171/836 (20%)

Query: 552  DVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVS 611
            DV V+R+     IS  +L+ GD+  +   ++  +P D++L+S  C  +ES LTGES  + 
Sbjct: 240  DVVVIRNGDEHLISIHDLLVGDVISLQTGDV--VPADAVLISGSCECDESALTGESDTIK 297

Query: 612  KF---PATEETMYQLCD-----DFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMV 663
            K    PA E+   Q+ +     D  S  +   V    L +G+ ++            A++
Sbjct: 298  KVALKPALEK-YKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSG-------IGNAVI 349

Query: 664  VRTGFSTTKGSLVRSM-----VFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFI-- 716
               G ++  G ++ ++       P         D+    G M+ + +  F +  ++F+  
Sbjct: 350  TSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVL--FIILFIRFLTY 407

Query: 717  -------------KLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFC 763
                         + G     + + A+ +I + VP  LP  +T+   FA +R+ + G   
Sbjct: 408  LPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLV 467

Query: 764  ISPTRLNISGKIDVMCFDKTGTLTEDGLDVL----------------GVQISEPNGVRGQ 807
                     G    +C DKTGTLTE+ + V+                  +I     +R  
Sbjct: 468  RVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSN 527

Query: 808  KFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQ 867
                LL+DI       SLN  +          F +  + H  + VD N    P       
Sbjct: 528  CDASLLTDI---LSNISLNSTA----------FENKESQHKDKDVDEN----PYHKSRKS 570

Query: 868  FTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLG 927
               WS      +    ++ E  +++      +E         S   ++        + LG
Sbjct: 571  LFPWSRNNRTSQLIADAMKE--NDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDLG 628

Query: 928  ---VVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC------NKSTLPAD-- 976
               VV+   F S  +  ++ V+  ++  Y  + KGA E++ ++C      + S +P +  
Sbjct: 629  IDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQD 688

Query: 977  -----FEEVLRCYTHNGYRVIACAG---KTLPKRTWLYSQKVS---------REEVESNL 1019
                 F+++    +H   R I+      K  P + +  S   S          E    NL
Sbjct: 689  LYDESFKKIQDMASH-ALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNL 747

Query: 1020 EFLGFII-----FQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR 1074
               G  +      Q+ L++   E+++  Q A +   M TGDNILTA ++ R      C+ 
Sbjct: 748  SSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISR-----NCN- 801

Query: 1075 VYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDV 1134
                           ++     N+P                       EC    A+ G  
Sbjct: 802  ---------------ILSEEGYNDP-----------------------EC----AMEGPT 819

Query: 1135 FRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGA 1194
            FR       ++P + +  ++    + AR SP++K  L+  L+K+   V   GDG ND  A
Sbjct: 820  FR-------KLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPA 872

Query: 1195 LKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAALVT--SFACFQYMSLY 1249
            LK ADVG S+  +   VA   +  I    + + +++ I+ GR   V+   F  FQ     
Sbjct: 873  LKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNI 932

Query: 1250 SAI--QFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSA 1303
            +A+   F++        S L   Q L+++L++    A+ ++  K  E I  ++P  
Sbjct: 933  TAVILTFVSAVASAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKG 988

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 202/948 (21%), Positives = 358/948 (37%), Gaps = 178/948 (18%)

Query: 448  IDPDWVDLSTVSNGLTKGVQE--DRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQ--- 502
            +D     L T  NG  +   E  +R   +G N+I +      E LF + L  F   +   
Sbjct: 43   VDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVE---DDESLFKKFLSNFIEDRMIL 99

Query: 503  ------VFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVL 556
                  V S+ +  ID+       IF++  +        +K +   L ++    C   ++
Sbjct: 100  LLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEA-LNKLVPAEC--HLM 156

Query: 557  RDKFWTTISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGESVPVSKF 613
            R    + + +S LVPGD+  + + D     +P D  I+ + D  ++ES LTGE+ PV K 
Sbjct: 157  RCGQESHVLASTLVPGDLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHK- 211

Query: 614  PATEETMYQLCDDFQSTQISSFVSKSFL-YNGTNIIRARIAPGQTAALAMVVRTGFSTTK 672
              T +T+ +   + Q   I     +S + Y GT +++     G      +VV TG +T+ 
Sbjct: 212  --TSQTIEKSSFNDQPNSIVPISERSCIAYMGT-LVKEGHGKG------IVVGTGTNTSF 262

Query: 673  GSLVRSMV-FPKP-TGFKFYRDSF-KYIGFMSLIAIFGFC-VSCVQFIKLGLDKKTMILR 728
            G++   M    KP T  +   D   K +  +S I I   C V  +Q    G     M   
Sbjct: 263  GAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQ----GRSWLEMFQI 318

Query: 729  ALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTE 788
            ++ +    +P  LP  +T+     + R+ ++         +   G ++V+C DKT     
Sbjct: 319  SVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKT----- 373

Query: 789  DGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHS 848
                                 G L S+   V   + L+  S+ L+       +SL     
Sbjct: 374  ---------------------GTLTSNHMTVSKLWCLDSMSNKLNV------LSLDKNKK 406

Query: 849  LRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHP 908
             ++ +GNL     +      T  +   +      H+++ G   D    E           
Sbjct: 407  TKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLE----------- 455

Query: 909  DSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC 968
                +   F   D  N +  V+   F S+ + M+  +    D+    + KGA E I E  
Sbjct: 456  ----QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYS 511

Query: 969  NK-------------STLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEV 1015
                               A   E        G RV   A  TL   +   +     E++
Sbjct: 512  TSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLT-----EDL 566

Query: 1016 ESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRV 1075
              +L F G I   +  +      ++ L    +  IM TGD+  TA+++ ++ G+      
Sbjct: 567  IKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI------ 620

Query: 1076 YVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVF 1135
                         PVI      +P            KL                +SGD  
Sbjct: 621  -------------PVI------DP------------KLS--------------VLSGDKL 635

Query: 1136 RLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGAL 1195
                   +E+ ++ L  ++ + +I+AR +P+ K  ++  L+K    V   GDG ND  AL
Sbjct: 636  -------DEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPAL 688

Query: 1196 KAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYS 1250
            K +D+G+S+      VA   +  +    + S +L  I EG+     + +F  FQ  +  +
Sbjct: 689  KLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVA 748

Query: 1251 AIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKI 1310
            A+  + ++  +   + L   Q L+I++L+  P A  +       ++ KK P     + KI
Sbjct: 749  ALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR--TDKI 806

Query: 1311 LVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358
            L   ++   L         IIV  +  ++K +   D  V + D T+ F
Sbjct: 807  LTHDVMKRLLT----TAACIIVGTVYIFVKEM-AEDGKVTARDTTMTF 849

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 184/864 (21%), Positives = 329/864 (38%), Gaps = 184/864 (21%)

Query: 455  LST-VSNGLTKGVQEDRELAFGKNQINLRMKTTSE-ILFNEVLHPFYVFQVFS-IILWGI 511
            LST ++ GL      +R    G+N +    K   + IL +++ +   +  + S +I   I
Sbjct: 31   LSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAI 90

Query: 512  DEYYYYAACIFLISVLSIFDSLNE--QKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSEL 569
             ++       F++ +  +  +  E    K   +L  +S       V+RD    TI S EL
Sbjct: 91   KDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLST--PSAHVIRDGNDITIQSKEL 148

Query: 570  VPGDI--YEVSDPNITILPCDSILLSS-DCIVNESMLTGESVPVSKFPATEETMYQLCDD 626
            VPGDI   +V D     +P D  LL S +   +E++LTGES+PV+K   +   +Y+    
Sbjct: 149  VPGDICIIKVGD----TVPADLRLLESINLETDEALLTGESLPVAK---SHSEVYE---- 197

Query: 627  FQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTG 686
             + T +   ++ +F    + + + R       A  +V++T  +T  G + +S+     T 
Sbjct: 198  -KDTPVGDRLNLAFA--ASTVTKGR-------ATGIVIKTALNTEIGKIAKSL--KSETS 245

Query: 687  FKFYRDSFKYIG--------------------------FMSLIAIFGFCVSCVQFIKLGL 720
            F   +D  K  G                             L  +          + +G 
Sbjct: 246  F-ISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGT 304

Query: 721  DK----KTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKID 776
             K    K + + A+ +   ++P +L   LTI  +     +  + +       L   G ++
Sbjct: 305  QKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVN 364

Query: 777  VMCFDKTGTLTEDGLDVLGVQISEPNGVRGQK----FGELLSDIRQVFPKFS-------- 824
             +C DKTGTLT+  +    V I +   +  Q+    F   + +I  + PKFS        
Sbjct: 365  DICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEI-HLIPKFSPYQYKHDD 423

Query: 825  LNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHS 884
              D     DFKS+     L                PL+  +F    W +       A  +
Sbjct: 424  EEDVGIIPDFKSKYLAGEL---------------GPLNVSLFD--QWLYTATLANIA--T 464

Query: 885  LYEGRHEDD-------------VFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRS 931
            +++     D             VF    ++   V+  +  + E    D   ++    V  
Sbjct: 465  VFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEK---DARANSSFEHVAE 521

Query: 932  FEFLSELRRMSVIVKTNNDD---VYWSFTKGAPEVISEICNK-STLP---------ADFE 978
            F F S ++RMS I K   D    +Y  FTKGA E + + C+   T P          D E
Sbjct: 522  FPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLE 581

Query: 979  EVLR---CYTHNGYRVIACAGKTLPKRTWLYSQKV---SREEVESNLEFLGFIIFQNKLK 1032
             + +     +  G RV+A A K+  +  +  ++      R+ VE  L FLG I   +  +
Sbjct: 582  TIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPR 641

Query: 1033 KETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIV 1092
            +E+   +K    A I   M TGD   TA S+ +E G++  +  + P              
Sbjct: 642  QESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK------------- 688

Query: 1093 WRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNE 1152
                                            N+ +  + D         + + ++ +++
Sbjct: 689  -----------------------------EVVNFMVMAATDF--------DALSDQEIDD 711

Query: 1153 ILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212
            + +   + AR +P  K  ++  L +        GDG ND  +LK A+VGI++    + VA
Sbjct: 712  LRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVA 771

Query: 1213 APFTSKIF---NISCVLDVIREGR 1233
               +  +    N + +L+ + EGR
Sbjct: 772  KDASDIVLSDDNFASILNAVEEGR 795

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 99.8 bits (247), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 184/831 (22%), Positives = 316/831 (38%), Gaps = 162/831 (19%)

Query: 551  CDVRVLRDKFWTTISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGES 607
             +  + R    + + +S LVPGD+  ++V D     +P D  I+ S D  V+ES LTGE+
Sbjct: 146  AECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLRIVESIDLCVDESNLTGEN 201

Query: 608  VPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTG 667
             PV K            D    + I   +      N    +   +  G    +  V+ TG
Sbjct: 202  EPVHKSSGA-------VDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGI--VIATG 252

Query: 668  FSTTKGSLVRSMV-FPKP-TGFKFYRDSF-KYIGFMSLIAIFGFCVSCVQFIKLGLDKKT 724
              T  GS+   M    KP T  +   D   + + +MS + I   C+  +   +  L+   
Sbjct: 253  KHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVLIGIICLIGIIQGRSWLE--- 309

Query: 725  MILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTG 784
            M   A+ +    +P  LP  +T+     + R+ ++         +   G ++V+C DKTG
Sbjct: 310  MFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTG 369

Query: 785  TLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLL 844
            TLT + + V                    S I  +    +  +C +    K R   M   
Sbjct: 370  TLTANHMTV--------------------SKIWCLGSMENKTNCLALSKVKERPIKMEQD 409

Query: 845  TCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPA 904
               +LR   GN+  +          G   +E       H  Y G       P +  I+ +
Sbjct: 410  VATTLRI--GNICNN----------GTYSQE-------HLKYLGN------PTDIAILES 444

Query: 905  VVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVI 964
            + H         F  ND  N +  +    F S+ + M+V     ND V   + KGA E I
Sbjct: 445  LQH---------FGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVVV-YVKGAFEKI 494

Query: 965  SEICN------------KSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSR 1012
             E               K    A   +        G R +A A   +   +  +  K   
Sbjct: 495  VEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV---SATHGDKEFN 551

Query: 1013 EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQC 1072
            E++   L F G I   +  +      ++ L   ++  IM TGD   TA+S+ R+ G    
Sbjct: 552  EDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIG---- 607

Query: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSG 1132
                +P IN                 P+                         Y++ +SG
Sbjct: 608  ----IPVIN-----------------PE-------------------------YSV-LSG 620

Query: 1133 DVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDC 1192
            D         +++ ++ L  ++ + +++AR +P+ K  ++  LQK    V   GDG ND 
Sbjct: 621  DKL-------DQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDA 673

Query: 1193 GALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMS 1247
             ALK AD+G+S+ +    VA   +  +    + S +L  I EG+     + +F  FQ  +
Sbjct: 674  PALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLST 733

Query: 1248 LYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVS 1307
              +A+  + I+      + L   Q L+I++L+  P A  +       ++ +K P     +
Sbjct: 734  SVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR--T 791

Query: 1308 PKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358
             KIL   ++   L+       +IIV  +  ++K +   D  V S D T+ F
Sbjct: 792  DKILTDAVLKRVLISAC----FIIVGTIYVFVKEM-AEDGQVTSRDTTMTF 837

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 175/839 (20%), Positives = 331/839 (39%), Gaps = 143/839 (17%)

Query: 461  GLTKGVQEDRELAFGKNQ------INLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEY 514
            GLT      R    G N       IN+R      IL  ++ +   +  + S+++    + 
Sbjct: 40   GLTAEEARARLEVVGDNTLGEEEGINVR-----AILLKQMCNAMILVLIISMVIALAIKD 94

Query: 515  YYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELVPGD 573
            +     I  +  L++     ++    + +  +        RV+R+     ++S+++VPGD
Sbjct: 95   WISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQVVPGD 154

Query: 574  IYEVSDPNITILPCDSILLSS-DCIVNESMLTGESVPVSKFPATE-ETMYQLCDDFQSTQ 631
            I +V   +   +P D  L+ + +   +E++LTGE++PV+K PA   E    + D      
Sbjct: 155  IVQVRVGDT--VPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAF 212

Query: 632  ISSFVSKS-----FLYNGTNIIRARIAPGQTAALAMVVR----TGFSTTKGSLVRSM--V 680
             SS VSK       +  G      +IA       +++ R    +G   T  ++  S+   
Sbjct: 213  ASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSF 272

Query: 681  FPKPTGFKFYRDSFKYIGFMSLIAI-FGFCVSCVQFIKLGLDKKTMILRALDIITIVVPP 739
                 G   +R   K    +  IA+ F   V   Q  K  ++++  I  A+ +   ++P 
Sbjct: 273  LGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQ--KFIVNREVAIY-AICVALSMIPS 329

Query: 740  ALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQIS 799
            +L   LTI  +     +  + +       L   G ++ +C DKTGTLT+  + +  + + 
Sbjct: 330  SLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVP 389

Query: 800  EPNGVRGQK----FGELLSDIRQVFPKFS--------LNDCSSPLDFKSR---------- 837
            E   V   +    F   + D+  + P+FS          D     +FK R          
Sbjct: 390  EFGTVVVNRSNVPFDPTVGDV-SLIPRFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGL 448

Query: 838  --NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVF 895
                F S L   +L ++   +  D  D K ++  G   E   Q   F +  +  H     
Sbjct: 449  NPRKFESWLHTATLANI-ATVFKDS-DSKEWRAHGDPTEIAIQ--VFATRMDHPHHALTT 504

Query: 896  PENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVI-VKTNNDDVYW 954
             ++ E        DS++ +     ND          F F S ++RMS + +   + +   
Sbjct: 505  EQDEE--------DSDSSQQ----NDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRH 552

Query: 955  SFTKGAPEVISEICNK----------STLPADFEEVLR----CYTHNGYRVIACAGKTLP 1000
             FTKGA E + + C +            L  D  E+++      ++ G RV+A A KT+P
Sbjct: 553  VFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIP 612

Query: 1001 -KRTWLYSQKVSREE--VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNI 1057
             +      ++++++   VES+L F G +   +  + ET+  +K    A I   M TGD  
Sbjct: 613  AEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFP 672

Query: 1058 LTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNS 1117
             TA ++ +E G++  +  + P                      +++D   +   +     
Sbjct: 673  GTAKAIAQEVGILPHNLYHYPK---------------------EVVDIMVMTATQF---- 707

Query: 1118 VESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK 1177
                                     + + +E L+++ +   + AR +P  K  ++  L +
Sbjct: 708  -------------------------DSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHR 742

Query: 1178 LDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGR 1233
             +      GDG ND  +LK A+VGI++    + VA   +  +    N + +L+ + EGR
Sbjct: 743  REKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 801

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 143/633 (22%), Positives = 250/633 (39%), Gaps = 124/633 (19%)

Query: 702  LIAIFGFCVSCVQFIKLGLDKKTM---ILRALDIITIVVPPALPATLTIGTNFALSRLKE 758
            ++ I  F +S +  +  GLD       I+R L + + ++P +L   L +G +    +++ 
Sbjct: 434  ILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493

Query: 759  KGIFCISPTRLNIS----GKIDVMCFDKTGTLTEDGLDVLGVQIS------EPNGVRGQK 808
                  +  R +      G+I+ +  DKTGTLT++ + +  + +       E   +    
Sbjct: 494  DKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDY 553

Query: 809  FGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLR-SVDGNLL----GDPLDF 863
               L S         ++      +  + R+  ++L TCH++  + + N L      P + 
Sbjct: 554  IQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEI 613

Query: 864  KMFQFTGWSFEEDFQKRAFHSLYE-GRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDP 922
             + +FT         +R   SL++  RH   +F E S +                  N  
Sbjct: 614  AIVKFT---------ERVGLSLFKRDRHSLTLFHEYSGV------------------NLQ 646

Query: 923  HNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLR 982
            ++ L V   F F S+ +RM +IV+    +  W   KGA  V+S+I   +      EE + 
Sbjct: 647  YDILHV---FPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVS 700

Query: 983  CYTHNGYRVIACAGKTLPKRTWLYSQ--------------------KVSREEVESNLEFL 1022
                 G R +  A K L  R  LY Q                    +V +  +E NLE L
Sbjct: 701  NMAREGLRTLVIARKKLSTR--LYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELL 758

Query: 1023 GFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSIND 1082
            G    ++KL+K+   +++ L++A ++  M TGD + TA  V   A LI            
Sbjct: 759  GLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLIS----------- 807

Query: 1083 TPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDE 1142
                G+ V     +   D  L    L+ +K   NS          L + GD   +     
Sbjct: 808  ---RGQYVHTITKLTRRDGALS--RLEYLKANRNSC---------LLIDGDSLAIYMSHY 853

Query: 1143 NEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVG 1201
                E +   I L   I  R +P +K ++ + ++++      C GDG ND   ++ ADVG
Sbjct: 854  R--AEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG 911

Query: 1202 ISLSEAE---ASVAAPFTSKIFNISCVLD--VIREGRAALVTSFACFQYMSLYSAIQFIT 1256
            + +   E   AS+AA ++   F   C L   ++  GR +   S    Q++ ++  +    
Sbjct: 912  VGIVGKEGKQASLAADYSITQF---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISV 967

Query: 1257 ITILYSRGSNLGDFQFLYIDLLLIVPIAICMSW 1289
               +YS  SNL              PIA+   W
Sbjct: 968  CQAVYSISSNLK-------------PIALYQGW 987

>Kwal_23.5789
          Length = 1133

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 161/725 (22%), Positives = 296/725 (40%), Gaps = 134/725 (18%)

Query: 558  DKFWTTISSSELVPGDIYEVSD----PNITILPCDSILL-----SSDCIVNESMLTGE-- 606
            ++ +  +S S+LVP    +V D          P D +LL     S +  +    L GE  
Sbjct: 239  NELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETD 298

Query: 607  -----SVPVSKFPATEETMYQL--CDDFQSTQISSFVSK-------SFLYNGTNIIRAR- 651
                 + P+++  + ++ +Y++          I++F+ K       S   +  N + A  
Sbjct: 299  WKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANT 358

Query: 652  IAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVS 711
            +      A+A VV TG + T+ ++  SM   K    +   +S   I       +F   V+
Sbjct: 359  VFASAGTAIACVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKI---LCACVFILSVA 414

Query: 712  CVQFIKLGL-DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLN 770
             V F      D    I+R L + + ++P +L   L +G +    +++       +  R +
Sbjct: 415  LVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTS 474

Query: 771  IS----GKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLN 826
                  G+I+ +  DKTGTLT++ +++  + +   +        ++++D  +     +LN
Sbjct: 475  TIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTM--DIVTDYVRAMSD-NLN 531

Query: 827  DCSSP------LDFKSRNFFMSLLTCHSLRSV--DGNL---LGDPLDFKMFQFTGWSFEE 875
              + P      L  + R+  ++L  CH +     DG L      P +  + +FT  S   
Sbjct: 532  SSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTE-SVGL 590

Query: 876  DFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFL 935
               +R  HS+                   ++H  S         N  ++ L V   F F 
Sbjct: 591  TLFRRDRHSI------------------TLLHDQSGT-------NFEYDILHV---FPFN 622

Query: 936  SELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACA 995
            S+ +RM +++     D YW   KGA  V+S+I  K+      EE        G R +   
Sbjct: 623  SDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIG 679

Query: 996  GKTLPKR-------------TWLYSQKVSREEV-----ESNLEFLGFIIFQNKLKKETSE 1037
             K L K+               + +++V+   V     E +LE LG    ++KL+++   
Sbjct: 680  RKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKS 739

Query: 1038 TLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVN 1097
            +++ L++A I+  M TGD + TA  V   A L+                G+ V     VN
Sbjct: 740  SIELLRNAGIKIWMLTGDKVETARCVSISAKLVS--------------RGQYVHTVTKVN 785

Query: 1098 EPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLN- 1156
            +P+  L    L+ +K+  NS          L + G+   L      E   +   EI++N 
Sbjct: 786  KPEGAL--THLELLKINTNSC---------LLIDGESLGLYL----EYYRQQFFEIVVNL 830

Query: 1157 -SSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASV 1211
             + I  R +P +K ++   ++++      C GDG ND   +++ADVG+ +   E   AS+
Sbjct: 831  PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASL 890

Query: 1212 AAPFT 1216
            AA F+
Sbjct: 891  AADFS 895

>Scas_707.48*
          Length = 741

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 176/802 (21%), Positives = 309/802 (38%), Gaps = 160/802 (19%)

Query: 470  RELAFGKNQI------NLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFL 523
            R+L +G N+I      +L  K  S  + + ++       V S I+  ID+       I +
Sbjct: 67   RKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVI 126

Query: 524  ISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDI--YEVSDPN 581
            +  +        +K +   L ++    C   ++R    + + +S LVPGD+  +++ D  
Sbjct: 127  VVSVGFVQEYRSEKSL-EALNKLVPAEC--HLIRCGQESHVLASGLVPGDLVHFKIGDR- 182

Query: 582  ITILPCD-SILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSF 640
               +P D  I+ + D  ++ES LTGE+ PV K  + +E      +D  ++ I        
Sbjct: 183  ---IPADLRIIEAVDLSIDESNLTGENEPVHK--SAKEVNKDSFNDQPNSIIPISDRTCV 237

Query: 641  LYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMV-FPKPTGFKFYRDSFKYIGF 699
             Y GT +++     G      +VV  G +T+ G++   +    KP      +++   +G 
Sbjct: 238  AYMGT-LVKEGHGKG------IVVGIGKNTSFGAIFEMLSNIEKPK--TPLQNAMDKLGK 288

Query: 700  -MSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKE 758
             +SL +     + C+  I  G     M   ++ +    +P  LP  +T+     + R+ +
Sbjct: 289  DLSLFSFIVIGLICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 348

Query: 759  KGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV-----LGVQISEPN--GVRGQKFGE 811
            +         +   G ++V+C DKTGTLT + +       L    ++ N   +   K G 
Sbjct: 349  RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSGS 408

Query: 812  LLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGW 871
            L + + +              D KS     ++    S     G  LG+P D  + +    
Sbjct: 409  LKNYLTE--------------DVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLS- 453

Query: 872  SFEEDFQKRAFHSLYEGRHEDDVFPENSE---IIPAVVHPDSNNRENTFTDNDPHNFLGV 928
             F+    +  F  + E        P NS+   +   +V     N E  ++       L V
Sbjct: 454  KFDLSDIRPTFKKVQE-------IPFNSKRKFMAVKIV-----NSEGKYS-------LCV 494

Query: 929  VRSFE-FLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHN 987
              +FE  LS+          N        T+G  +VI E  N                  
Sbjct: 495  KGAFEKVLSQCSHY-----LNQKGKTEKLTQGQRDVIIETANS-------------LASE 536

Query: 988  GYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANI 1047
            G R++A A  TLP    L +     EE   +L F G I   +  +      ++ L    +
Sbjct: 537  GLRMLAFAKTTLPDSPTLLT-----EESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGV 591

Query: 1048 RTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKT 1107
              IM TGD+  TA+++ R+ G        +P                       +LD K 
Sbjct: 592  HIIMITGDSENTAVNIARQIG--------IP-----------------------VLDPKL 620

Query: 1108 LKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDE 1167
                     SV           +SGD         NE+ ++ L  ++ + +I+AR +P+ 
Sbjct: 621  ---------SV-----------LSGDKL-------NEMSDDQLANVIDHVNIFARATPEH 653

Query: 1168 KHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---NISC 1224
            K  ++  L+K    V   GDG ND  ALK AD+G+S+      VA   +  +    + S 
Sbjct: 654  KLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFST 713

Query: 1225 VLDVIREGRAAL--VTSFACFQ 1244
            +L  I EG+     + +F  FQ
Sbjct: 714  ILTAIEEGKGIFNNIQNFLTFQ 735

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 124/535 (23%), Positives = 219/535 (40%), Gaps = 109/535 (20%)

Query: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNIS----GKIDVMCFD 781
            I+R L + + ++P +L   L +  +    +++       +  R +      G+I+ +  D
Sbjct: 438  IMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 497

Query: 782  KTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSR---- 837
            KTGTLT++ + +  V +   N     +  +++SD  Q   + S ND  + L  +S     
Sbjct: 498  KTGTLTQNDMQLKKVHLG--NVSYTTETADIVSDYIQGMIE-SKNDSVTNLGPRSTTRKD 554

Query: 838  ------NFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFEEDFQKRAFHSLY 886
                  +   +L  CH++     D  L      P +  + +FT  S      KR  HS+ 
Sbjct: 555  AATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTE-SVGLSLFKRDRHSM- 612

Query: 887  EGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVK 946
                             +++H  S    N            V+  F F S+ +RM +IV 
Sbjct: 613  -----------------SLLHEHSGTILN----------YDVLTMFPFNSDTKRMGIIVY 645

Query: 947  TNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLY 1006
                D YW   KGA  V++ I   +      EE        G R +    K L K+  +Y
Sbjct: 646  DKQKDQYWFLQKGADTVMNRIVANNDW---LEEETGNMAREGLRTLVIGRKKLTKK--IY 700

Query: 1007 SQ-KVSREEV-------------------ESNLEFLGFIIFQNKLKKETSETLKSLQDAN 1046
             Q K   EEV                   E +LE LG    ++KL+K+   +++ L++A 
Sbjct: 701  EQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAG 760

Query: 1047 IRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTK 1106
            I+  M TGD + TA  V   A LI                G+ V V   +++P+   +  
Sbjct: 761  IKIWMLTGDKVETARCVSISAKLIS--------------RGQYVHVVTKLSKPEGAFN-- 804

Query: 1107 TLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSP 1165
             L+ +K+  N+          L + G+   +  +      +E+ + ++ L + I  R +P
Sbjct: 805  QLEYLKVNKNAC---------LLIDGESLGMFLK---YYRQEFFDVVVHLPTVIACRCTP 852

Query: 1166 DEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1216
             +K ++ + +++L      C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 853  QQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 907

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 207/881 (23%), Positives = 349/881 (39%), Gaps = 183/881 (20%)

Query: 515  YYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDI 574
            Y     + ++ ++S      E  K S    E++H  CDV   R   +      ++  GDI
Sbjct: 252  YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311

Query: 575  YEVSDPNITILPCDSILLSSD-----CIVNESMLTGESVPVSKFPATEETMY----QLCD 625
              V       +P D I+LSS      C +  + L GE+    K    E   Y     LC 
Sbjct: 312  IRVRSEEA--IPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCK 369

Query: 626  DFQSTQISSFVSKSFLYNGTNIIRAR---IAPGQTAALAMVVRT-----GFSTTKGSLVR 677
                 Q     S  + Y GT  +      ++P Q       +R      G     G   +
Sbjct: 370  LHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETK 429

Query: 678  SMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCV------------------SCVQFIKL- 718
             M     T  K  R + + +  M ++A+FG  +                  + + ++ + 
Sbjct: 430  LMRNATATPIK--RTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIE 487

Query: 719  GLDKKTMILRALDIITI------VVPPALPATL---------TIGTNFALSRLKEKGIFC 763
            G +K  +  +  DI+T       +VP +L  T+          IG++  L   +      
Sbjct: 488  GTNKAGLFFK--DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESD---- 541

Query: 764  ISPTRLNIS------GKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIR 817
             +PT +  S      G+I+ +  DKTGTLT + ++   V I+      G+ + E + + R
Sbjct: 542  -TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIA------GRCYIETIPEDR 594

Query: 818  QV---------FPKF-SLND-CSSPLDFKSR---NFFMSLLTCHSL---RSVDGNLLGDP 860
            +          F  F SL D  + P D ++     F   L TCH++      DG +    
Sbjct: 595  RATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTI---- 650

Query: 861  LDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDN 920
                  ++   S +E        +L +G   D  F  +      +  P+S +    F++ 
Sbjct: 651  ------KYQAASPDEG-------ALVQG-AADLGFRFD------IRRPNSVSISTPFSEQ 690

Query: 921  DPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEV 980
              +  L +    EF S  +RMS I +  +  +   F KGA  VI E  +    P   +  
Sbjct: 691  LEYQLLNIC---EFNSTRKRMSAIFRMPDGSIKL-FCKGADTVILERLDSEFNPY-VQST 745

Query: 981  LRC---YTHNGYRVIACAGKTLPKRTWLYSQKV-----------------SREEVESNLE 1020
            LR    Y   G R +  A +T+P++ +    K+                 + E +E +L 
Sbjct: 746  LRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLF 805

Query: 1021 FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI 1080
            FLG    ++KL++   ET+  LQ+A ++  + TGD   TAI++G    L+          
Sbjct: 806  FLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLS--------- 856

Query: 1081 NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNY---TLAVSGDVFRL 1137
             D  L    +IV  +  E     DT+T    KL  N++ES +       +LA+  D   L
Sbjct: 857  EDMNL----LIVNEETKE-----DTRTNLQSKL--NAIESHQISQQDMNSLALVIDGKSL 905

Query: 1138 LFRDENEIPEEYLN-EILLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGA 1194
             +  E ++ +++L    L  + I  R+SP +K  L++++  +K    +   GDGAND   
Sbjct: 906  GYALEEDLEDQFLTIGKLCKAVICCRVSPLQK-ALVVKMVKRKTSSLLLAIGDGANDVSM 964

Query: 1195 LKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQF 1254
            ++AA VG+ +S  E   AA   S  F I       R  R  L+     + Y       Q 
Sbjct: 965  IQAAHVGVGISGMEGMQAA--RSADFAIG----QFRFLRKLLIVH-GSWSY-------QR 1010

Query: 1255 ITITILYSRGSNLGDF--QFLYIDLLLIVPIAICMSWSKSY 1293
            I++ ILYS   N+  +  QF Y+        +I  SW+ ++
Sbjct: 1011 ISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTF 1051

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 116/530 (21%), Positives = 216/530 (40%), Gaps = 104/530 (19%)

Query: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLK-----EKGIFCISPTRLNISGKIDVMCF 780
            I+R L + + ++P +L   L +G +    +++     E  I   S    ++ G+I+ +  
Sbjct: 447  IMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDL-GRIEYLLS 505

Query: 781  DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSR--- 837
            DKTGTLT++ + +  + +   +     +  ++++D  Q     + N  S+P   +     
Sbjct: 506  DKTGTLTQNDMQLKKIHLGTVSYT--NETMDIVTDFIQSMNSRTSN--STPTTTRKNISD 561

Query: 838  ---NFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGR 889
               +   +L  CH++     DG L      P +  + +FT        +          R
Sbjct: 562  RVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT--------ESVGLSLFRRDR 613

Query: 890  HEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNN 949
            H   +F ++S +                          +   F F S+ +RM VI+    
Sbjct: 614  HSISLFHDHSGMKLE---------------------YDIKILFPFNSDSKRMGVIIFDKL 652

Query: 950  DDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTW----- 1004
               YW   KGA  V+S I  ++      EE        G R +    K L    +     
Sbjct: 653  KQEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEK 709

Query: 1005 -------------LYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIM 1051
                         ++ Q V R+ +E++LE LG    ++KL+K+   +++ L++A I+  M
Sbjct: 710  EYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWM 769

Query: 1052 CTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPV 1111
             TGD + TA  V   A LI                G+ V     VN+P+  L    L+ +
Sbjct: 770  LTGDKVETARCVSISAKLIS--------------RGQYVHTVTKVNKPEGAL--HHLEYL 813

Query: 1112 KLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSPDEKHE 1170
            ++  NS          L + G+   L  +     P+E+ + ++ L + +  R +P +K +
Sbjct: 814  QVNQNSC---------LLIDGESLGLYLQ---YFPDEFFDIVVNLPTVVACRCTPQQKAD 861

Query: 1171 LMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1216
            + + +++       C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 862  VAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 911

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 115/555 (20%), Positives = 222/555 (40%), Gaps = 101/555 (18%)

Query: 705  IFGFCVSCVQFIKLG-LDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFC 763
            +F   +  V F   G  D    I+R L + + ++P +L   L +G +    +++      
Sbjct: 418  VFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIP 477

Query: 764  ISPTRLNIS----GKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQV 819
             +  R +      G+I+ +  DKTGTLT++ + +  + +   +        ++++D  Q 
Sbjct: 478  DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTM--DIVTDYVQE 535

Query: 820  FPKFSL------NDCSSPLDFKSRNFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQF 868
                S       +     L  + R+  ++L  CH++     DG L      P +  + +F
Sbjct: 536  LVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKF 595

Query: 869  TGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGV 928
            T        +          RH   +F ++S                    N  ++ L V
Sbjct: 596  T--------ESVGLSLFKRDRHSVSLFHQHS------------------ATNFEYDILQV 629

Query: 929  VRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNG 988
               F F S+ +RM +IV       +W   KGA  V++ I   +      +E +      G
Sbjct: 630  ---FPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEEVGNMAREG 683

Query: 989  YRVIACAGKTLPKRTWLYSQK------------------VSREEVESNLEFLGFIIFQNK 1030
             R +    K L  +++   +K                  V ++ +E NLE LG    ++K
Sbjct: 684  LRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDK 743

Query: 1031 LKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPV 1090
            L+ +   +++ L++A ++  M TGD + TA  V   A LI                G+ V
Sbjct: 744  LQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLIS--------------RGQYV 789

Query: 1091 IVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYL 1150
                 ++ P+  L+   L+ +K+  +S          L + G+   +         +E+ 
Sbjct: 790  HTVTKLSRPEGALN--ALEYLKINKSSC---------LLIDGESLGMFL---TYYKQEFF 835

Query: 1151 NEIL-LNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE 1208
            + ++ L + I  R +P +K ++ + ++++      C GDG ND   ++ ADVG+ +   E
Sbjct: 836  DIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKE 895

Query: 1209 ---ASVAAPFTSKIF 1220
               AS+AA F+   F
Sbjct: 896  GKQASLAADFSVTQF 910

>Scas_704.38
          Length = 1161

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 112/531 (21%), Positives = 211/531 (39%), Gaps = 100/531 (18%)

Query: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNIS----GKIDVMCFD 781
            ++R L + + ++P +L   L +  +    +++       +  R +      G+I+ +  D
Sbjct: 454  VMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSD 513

Query: 782  KTGTLTEDGLDVLGVQI------SEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFK 835
            KTGTLT++ + +  + +      SE   +       L++      P       +S  D  
Sbjct: 514  KTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLS 573

Query: 836  SR--NFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFEEDFQKRAFHSLYEG 888
            +R  +  ++L  CH++     D  L      P +  + +FT  S      KR  HS+   
Sbjct: 574  ARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTE-SVGLSLFKRDRHSI--- 629

Query: 889  RHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTN 948
                           +++H  S +               +++ F F S+ +RM +IV   
Sbjct: 630  ---------------SLLHGHSGSILT----------YEILQVFPFNSDSKRMGIIVHDE 664

Query: 949  NDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQ 1008
              D YW   KGA  V++ I   +      EE        G R +    K L +  +   +
Sbjct: 665  QKDEYWFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQFK 721

Query: 1009 K---------VSREE---------VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTI 1050
            K         V+R++         +E +LE LG    ++KL+ +   +++ L++A I+  
Sbjct: 722  KDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIW 781

Query: 1051 MCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKP 1110
            M TGD + TA  V   A LI                G+ V +   + +P+  L+      
Sbjct: 782  MLTGDKVETARCVSISAKLIS--------------RGQYVHIITKLTKPEGALNQLEYLK 827

Query: 1111 VKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSPDEKH 1169
            V  G         C   L + G+   +  R       E+ + ++ L + +  R +P +K 
Sbjct: 828  VNKG--------AC---LLIDGESLGMFLR---YYKREFFDVVICLPTVVACRCTPQQKA 873

Query: 1170 ELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1216
            ++ + +++       C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 874  DVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 924

>Scas_499.3
          Length = 346

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 81/146 (55%), Gaps = 14/146 (9%)

Query: 474 FGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSL 533
           +G+N  ++ + T  E+     + P +VFQ+F + LW +DE++YY +   L+ ++S+    
Sbjct: 177 YGENAFDIPVPTFMELFKEHAVAPLFVFQLFCVALWLLDEFWYY-SLFNLMMIVSM---- 231

Query: 534 NEQKKVSRNLAEMSHFHC------DVRVLRDKFWTTISSSELVPGDIYEVSDPN-ITILP 586
            E   V + L  +  F         + VLR++ W T+ ++EL+  D+  ++     + +P
Sbjct: 232 -EGAAVFQRLQSLKEFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTTTEESAIP 290

Query: 587 CDSILLSSDCIVNESMLTGESVPVSK 612
           CD IL+   CIVNE+M +GES P+ K
Sbjct: 291 CDMILIDGACIVNEAM-SGESTPLLK 315

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 133/322 (41%), Gaps = 70/322 (21%)

Query: 932  FEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC--------NKSTLPAD-----FE 978
            F F S ++RMS + ++ +   Y  +TKGA E +   C        N +T+  D      +
Sbjct: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIK 589

Query: 979  EVLRCYTHNGYRVIACAGKTLPKRTWLYS--QKVSREE--VESNLEFLGFIIFQNKLKKE 1034
            E +   +  G RV+A A K+ PK        QK+ +E    E+ L FLG I   +  ++E
Sbjct: 590  ENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREE 649

Query: 1035 TSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWR 1094
            T+  +K    A I   M TGD   TA ++ +E G++                        
Sbjct: 650  TAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL------------------------ 685

Query: 1095 DVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL 1154
                           P  L + S E +           D+  +  +  + + E+ ++ + 
Sbjct: 686  ---------------PTNLYHYSKEVV-----------DIMVMTGKQFDNLSEDEIDNLP 719

Query: 1155 LNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAP 1214
            +   + AR SP  K  ++  L + +      GDG ND  +LK A+VGI++    + VA  
Sbjct: 720  VLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKD 779

Query: 1215 FTSKIF---NISCVLDVIREGR 1233
             +  +    N + +L+ + EGR
Sbjct: 780  ASDIVLSDDNFASILNAVEEGR 801

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 81/385 (21%), Positives = 171/385 (44%), Gaps = 59/385 (15%)

Query: 459 SNGLTKGVQEDRELAFGKNQINLRMKTT-SEILFNEVLHPFYVFQVFSIIL-WGIDEYYY 516
           S G++    + R    G+N +    K     +L +++ +   +  + S+I+ + I ++  
Sbjct: 30  SKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAMILVLIISMIISFAIRDWIT 89

Query: 517 YAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHC-DVRVLRDKFWTTISSSELVPGDIY 575
                F+I + ++   L ++ K S+ +  +      +  V+R+     + S+++VPGD+ 
Sbjct: 90  GGVICFVIGI-NVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTDVVPGDLV 148

Query: 576 EVSDPNITILPCDSILLSSDCI-VNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISS 634
            V   +   +P D  L+S      +E++LTGES+PVSK         ++ DD   T +  
Sbjct: 149 VVKVGDT--IPADLRLVSQQNFETDEALLTGESLPVSK------DANEIFDD--ETPVGD 198

Query: 635 FVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSM-----VFPKPTGFKF 689
            ++ +F  + + +++ R       A  + ++TG +T  G + +S+     +  +     +
Sbjct: 199 RINLAF--SSSTVVKGR-------AQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTW 249

Query: 690 YRDSF--------KYIGF---------MSLIAIFGFCVSCVQFIKLGLDKKTMILRALDI 732
           Y++++         ++G          +S +A+  F ++ V  I +   +K  + R + I
Sbjct: 250 YQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAI 309

Query: 733 ITIVV-----PPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLT 787
             + V     P +L   LTI  +   + +  + +       L   G ++ +C DKTGTLT
Sbjct: 310 YAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLT 369

Query: 788 EDGLDVLGVQISEPNGVRGQKFGEL 812
           +  +  +  QI  P      KFG L
Sbjct: 370 QGKM--IAKQIWVP------KFGTL 386

>Kwal_26.7070
          Length = 1315

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 148/306 (48%), Gaps = 47/306 (15%)

Query: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRC---YTHNGY 989
            EF S  +RMS I +  N ++   F KGA  VI E       P   E  LR    Y   G 
Sbjct: 696  EFNSTRKRMSAIFRLPNGEIKL-FCKGADTVILERLKAGENPY-IEATLRHLEDYAAEGL 753

Query: 990  RVIACAGKTLPKRTW-----LY----------SQKV--SREEVESNLEFLGFIIFQNKLK 1032
            R +  A +T+ +  +     +Y          +QK+  + E +E +L  LG    ++KL+
Sbjct: 754  RTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQ 813

Query: 1033 KETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIV 1092
                ET+ +LQDA I+  + TGD   TA+++G     + C R+    +N        +++
Sbjct: 814  DGVPETIHTLQDAGIKVWVLTGDRQETAVNIG-----MSC-RLLSEDMN--------LLI 859

Query: 1093 WRDVNEPDKILDTKTL-KPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLN 1151
               +NE DK    K L + +K  ++   S ++ N +LA+  D   L F  E ++ E+YL 
Sbjct: 860  ---INEEDKEATRKNLTEKLKAISDHQISQQDMN-SLALVIDGKSLGFALEADL-EDYLL 914

Query: 1152 EI--LLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEA 1207
             I  L  + I  R+SP +K  L++++  +K D  +   GDGAND   ++AA VG+ +S  
Sbjct: 915  AIGKLCKAVICCRVSPLQK-ALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGM 973

Query: 1208 EASVAA 1213
            E   AA
Sbjct: 974  EGMQAA 979

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 144/365 (39%), Gaps = 74/365 (20%)

Query: 979  EVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSET 1038
            E       +G R IACA K         S  V  E+  + L F G     +  +     +
Sbjct: 532  EAAHSCASDGLRTIACAFKPTD------SDNVISEDDINGLTFTGLFGLADPPRPNVKAS 585

Query: 1039 LKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNE 1098
            ++ L    +  IM TGD++ TA+S+  + GL         S+ D                
Sbjct: 586  IEKLHRGGVHIIMITGDSVNTAVSIAEKIGL---------SVQD---------------- 620

Query: 1099 PDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSS 1158
                                   RE +    ++GD    L  DE       L++++   +
Sbjct: 621  -----------------------RESS---VMTGDKVSELTEDE-------LSKVIDKVN 647

Query: 1159 IYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSK 1218
            I+AR +P+ K  ++  L+K    V   GDG ND  ALK AD+GI++  +   VA   +  
Sbjct: 648  IFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDM 707

Query: 1219 IF---NISCVLDVIREGRAAL--VTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFL 1273
            I    + S +L  I EG+     + +F  FQ     + +  I IT +    + L   Q L
Sbjct: 708  ILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPMQIL 767

Query: 1274 YIDLLLIVPIAICMSWSKSYEKIDKKRPSA---NLVSPKILVPLLISVFLVFLFQFIPWI 1330
            +I++++  P A  +        +  K P +    +++  IL+ LL     + +  F  +I
Sbjct: 768  WINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLLYLAICILVGTF--YI 825

Query: 1331 IVQKM 1335
             ++ M
Sbjct: 826  FLKGM 830

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 131/298 (43%), Gaps = 30/298 (10%)

Query: 503 VFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWT 562
           V S  +  ID+    +  I ++  +        +K +   L ++    C   ++R    +
Sbjct: 116 VLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEA-LNKLVPTKC--HLIRYGRES 172

Query: 563 TISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGESVPVSKFPATEET 619
              +SELVPGD+  +++ D     +P D  I+ + D  ++ES LTGE+ P+ K   T + 
Sbjct: 173 NTLASELVPGDLVRFKIGDR----IPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDP 228

Query: 620 MYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGS---LV 676
                +++ +  +         Y GT +++     G      +V+ TG +T+ G+   +V
Sbjct: 229 -----EEYDNRNVPVSERSCIAYMGT-LVKEGHGKG------IVIGTGTNTSYGAIFEMV 276

Query: 677 RSMVFPKPTGFKFYRDSFKYIGF-MSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITI 735
            S+  PK       +++   +G  +S I+ F   +  +  I  G     M   ++ +   
Sbjct: 277 NSIEKPKTP----LQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVA 332

Query: 736 VVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV 793
            +P  LP  +T+     + R+ ++         +   G ++V+C DKTGTLT + + V
Sbjct: 333 AIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTV 390

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 133/312 (42%), Gaps = 59/312 (18%)

Query: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLP--ADFEEVLRCYTHNGYR 990
            EF S  +RMS I +  ++ +     KGA  VI E    ++ P  A     L  Y   G R
Sbjct: 693  EFNSTRKRMSAIFRFPDNSIRL-LCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLR 751

Query: 991  VIACAGKTLPKRTW-----LYSQKVS------------REEVESNLEFLGFIIFQNKLKK 1033
             +  A +T+P+  +     LY    +             E +E  L  LG    ++KL+ 
Sbjct: 752  TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811

Query: 1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVW 1093
               ET+ +LQ A I+  + TGD   TAI++G    L+           D  L    +IV 
Sbjct: 812  GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLS---------EDMNL----LIVN 858

Query: 1094 RDVNEPDKILDTKTLKPVKLGNNSVESLRECN---------YTLAVSGDVFRLLFRDENE 1144
             D  E  +             NN ++ LR  N          TLA+  D   L F  E +
Sbjct: 859  EDTKESTR-------------NNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPD 905

Query: 1145 IPEEYLNEI--LLNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVG 1201
            + EE+L  I  +  + I  R+SP +K  ++  +++   ++    GDGAND   ++AA VG
Sbjct: 906  L-EEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964

Query: 1202 ISLSEAEASVAA 1213
            + +S  E   AA
Sbjct: 965  VGISGMEGMQAA 976

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 137/305 (44%), Gaps = 45/305 (14%)

Query: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISE-ICNKSTLPADFE-EVLRCYTHNGYR 990
            EF S  +RMS I +  +D +     KGA  VI E +        D     L  Y   G R
Sbjct: 678  EFNSTRKRMSAIFRFPDDSIKL-LCKGADSVILERLSETGNFYVDATTRHLEDYATEGLR 736

Query: 991  VIACAGKTLPKRTW-LYSQK----------------VSREEVESNLEFLGFIIFQNKLKK 1033
             +  A K +P+  +  +++K                   EE+ES L  +G    ++KL++
Sbjct: 737  TLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQE 796

Query: 1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVW 1093
               +T+++LQ+A I+  + TGD   TAI++G    L+           D  L    +I+ 
Sbjct: 797  GVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLS---------EDMNL----LIIS 843

Query: 1094 RDVNEPDKILDTKTLKPVKLGNNSVESLRECNY-TLAVSGDVFRLLFRDENEIPEEYLNE 1152
             +  E      T+     KL      SL E +  TLA+  D   L F  E ++ E+Y   
Sbjct: 844  EETKEA-----TRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADL-EDYFLA 897

Query: 1153 I--LLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEAE 1208
            I  +  + I  R+SP +K  L++++  +K +  +   GDGAND   ++AA VG+ +S  E
Sbjct: 898  IGKMCKAVICCRVSPLQK-ALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGME 956

Query: 1209 ASVAA 1213
               AA
Sbjct: 957  GMQAA 961

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 129/323 (39%), Gaps = 67/323 (20%)

Query: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVY 1076
            S L   G +   + L+    E++K+ Q + +   M TGDNI T  ++ R  G++  S   
Sbjct: 702  SGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEY- 760

Query: 1077 VPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFR 1136
                                                            ++  A+ G VFR
Sbjct: 761  -----------------------------------------------ADHECAMEGPVFR 773

Query: 1137 LLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALK 1196
             L R +       + +      + AR SP++K   +  L+K++  V   GDG ND  AL 
Sbjct: 774  KLSRRQ-------MMDAAPKLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALT 826

Query: 1197 AADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAALVT--SFACFQYMSLYSA 1251
             ADVG S+  +   VA   +  I    + + +++ I+ GR   ++   F  FQ     +A
Sbjct: 827  LADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNITA 886

Query: 1252 IQFITITILYSRGSN--LGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPK 1309
            +    +T + S   N  L   Q L+++L++    A+ ++  K    I ++ P+    SP 
Sbjct: 887  VTLTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGR-DSPL 945

Query: 1310 ILVPLLISVFLVFLFQFIPWIIV 1332
            I V    S + + L Q +  +I+
Sbjct: 946  IAV----STWKMILGQAVLQLII 964

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 124/325 (38%), Gaps = 55/325 (16%)

Query: 552 DVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVS 611
           +V V+R+     IS  +L+ GD+  +   ++  +P D IL+   C  +ES +TGES  + 
Sbjct: 184 EVVVVRNGDKHVISVHDLLVGDLLSLQTGDV--VPVDCILVEGKCECDESGITGESDTIK 241

Query: 612 KFP-ATEETMYQ-LCDDFQSTQISS------FVSKSFLYNGTNIIRARIAPGQTAALAMV 663
           K   A    +Y+ +  D  S  I S       V    L +G+ ++            A+V
Sbjct: 242 KVSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSG-------IGHAVV 294

Query: 664 VRTGFSTTKGSLVRSM-----VFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKL 718
              G  +  G ++ ++       P         D     G  S+ A   F V  ++F+  
Sbjct: 295 TAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYG--SVAAFLLFVVLFLRFLSY 352

Query: 719 --------GLDKKTMILRALDIITIVV-------PPALPATLTIGTNFALSRLKEKGIFC 763
                    L       R +DI    V       P  LP  +T+   FA +R+ + G   
Sbjct: 353 LPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLV 412

Query: 764 ISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQK-FGELLSD------- 815
                    G    +C DKTGTLT++ + V+        G  G   F ++  D       
Sbjct: 413 RVLRACETMGSATTVCSDKTGTLTQNKMVVV-------KGFLGSSHFDDISEDSNCAQSD 465

Query: 816 -IRQVFPKFSLNDCSSPLDFKSRNF 839
            +RQ   + +LND  + +   S  F
Sbjct: 466 ALRQDMSQHTLNDILANIALNSTAF 490

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 140/322 (43%), Gaps = 50/322 (15%)

Query: 932  FEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVISEICNKSTLPADFEEV---LRC 983
             EF S  +RMS I+K      N +       KGA  +I    +K+      E+    L  
Sbjct: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQ 944

Query: 984  YTHNGYRVIACAGKTLPKRTWL-YSQK--------VSREE--------VESNLEFLGFII 1026
            Y   G R +  A + L  + +  +++K        V RE+        +E  L  LG   
Sbjct: 945  YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTA 1004

Query: 1027 FQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR---VYVPSINDT 1083
             +++L+    +++ +L +A I+  + TGD + TAI++G    L+       V   S +D 
Sbjct: 1005 IEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDV 1064

Query: 1084 PLHGEPVIVWRDVNEPDKILDTKTLKPVKLG---NNSVESLREC---------NYTLAVS 1131
             ++G         ++P +I+    LK ++     + S E L E          N+ + + 
Sbjct: 1065 DIYG---------SKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIID 1115

Query: 1132 GDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK-LDYTVGFCGDGAN 1190
            GD  +L  R+++   E  L      + +  R+SP +K  ++  ++  LD      GDG+N
Sbjct: 1116 GDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1175

Query: 1191 DCGALKAADVGISLSEAEASVA 1212
            D   +++AD+G+ ++  E   A
Sbjct: 1176 DVAMIQSADIGVGIAGEEGRQA 1197

>Scas_297.1
          Length = 800

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 97/215 (45%), Gaps = 21/215 (9%)

Query: 1123 ECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTV 1182
            EC    A+ G  FR L + E         ++L N  + AR SP++K  L+  L+ +   V
Sbjct: 26   EC----AIEGPKFRTLTKQERI-------KMLPNLRVMARSSPEDKRLLVETLKGMGDVV 74

Query: 1183 GFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAALVT- 1238
               GDG ND  ALK ADVG S+  +   VA   +  I    + + ++D I+ GR   ++ 
Sbjct: 75   AVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKWGRCVSISI 134

Query: 1239 -SFACFQYMSLYSAI--QFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEK 1295
              F  FQ +   +A+   F++        S L   Q L+I+L++    A+ ++  K    
Sbjct: 135  KKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDTLAALALATDKPDPN 194

Query: 1296 IDKKRP---SANLVSPKILVPLLISVFLVFLFQFI 1327
            I  ++P   S  L+ P     +L    L  +  FI
Sbjct: 195  IMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVTFI 229

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 555 VLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSK 612
           V+R+      S   L+ GDI  +   ++  +P D +L+   C V+ES +TGES  + K
Sbjct: 602 VIRNSQELLTSIHNLLVGDIITLQTGDV--IPADGVLVEGQCEVDESSITGESDTIKK 657

>Scas_710.41
          Length = 904

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 155/367 (42%), Gaps = 62/367 (16%)

Query: 461 GLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPF-----YVFQVFSIILWGIDEYY 515
           GLT      R   +G NQ    MK  +E    + L  F     +V +  +I+  G+ ++ 
Sbjct: 74  GLTTDEVVRRRKKYGLNQ----MKEENENFIVKFLMYFVGPIQFVMEAAAILAAGLSDWV 129

Query: 516 YYAA-CIFLISVLSI-----FDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSEL 569
            +   C  L+   S+     F + +  +++ + LA  +      RV+RD     I ++E+
Sbjct: 130 DFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTA------RVIRDGTLQEIPANEI 183

Query: 570 VPGDIYEVSDPNITILPCDSILLSSDCI--VNESMLTGESVPVSKFPATEETMYQLCDDF 627
           VPGDI E+ +   TI+P D  L++ +    V++S +TGES+ V K             ++
Sbjct: 184 VPGDILELDEG--TIIPADGRLVTENRFLQVDQSAITGESLAVDK-------------NY 228

Query: 628 QSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGF 687
                SS   K+    GT+++             +V  TG +T  G    ++V     G 
Sbjct: 229 GDVTFSSSTVKT----GTSVM-------------VVTATGDNTFVGR-AAALVGEASGGQ 270

Query: 688 KFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILR-ALDIITIVVPPALPATLT 746
             + D    IG + L+ +    +          D   MILR  L I  I VP  LPA +T
Sbjct: 271 GHFTDILNDIGTILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITIIGVPVGLPAVVT 330

Query: 747 IGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRG 806
                  + L +K       + +     ++++C DKTGTLT++ L      + EP  V G
Sbjct: 331 TTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL-----SLHEPYTVEG 385

Query: 807 QKFGELL 813
               +L+
Sbjct: 386 VSADDLM 392

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 81/179 (45%), Gaps = 8/179 (4%)

Query: 1105 TKTLKPVKLGNNSVESLRECNYTLAVSGDVF---RLLFRDENEIPEEYLNEILLNSSIYA 1161
            T  L+   L  ++V   +E +  L +  +++   +L      ++P   L + + N+  +A
Sbjct: 536  TLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGSELADFVENADGFA 595

Query: 1162 RMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTSKI 1219
             + P  K++++  LQ   Y V   GDG ND  +LK AD GI++  A   A  AA      
Sbjct: 596  EVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLA 655

Query: 1220 FNISCVLDVIREGRAALVTSFACFQY---MSLYSAIQFITITILYSRGSNLGDFQFLYI 1275
              +S ++D ++  R      ++   Y   +SL+  I F     + +R  N+    F+ I
Sbjct: 656  PGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWIAILNRSLNIELIVFIAI 714

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/329 (26%), Positives = 140/329 (42%), Gaps = 55/329 (16%)

Query: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVI----SEICNKSTLPADFE 978
            V+   EF S  +RMS I+K       ++       KGA  VI        N +TL     
Sbjct: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940

Query: 979  EVLRCYTHNGYRVIACAGKTL---PKRTWLYSQKVS------REE--------VESNLEF 1021
              L  Y   G R +  A + L       W+ +  V+      REE        +E  L  
Sbjct: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000

Query: 1022 LGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR---VYVP 1078
            LG    +++L+    +++  L +A I+  + TGD + TAI++G    ++       V   
Sbjct: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060

Query: 1079 SINDTPLHG-EPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLREC---------NYTL 1128
            S  D    G +P+ V   VN     L TK L+     + S E L+E          N+ +
Sbjct: 1061 SGEDVEEFGSDPIQV---VNN----LVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAV 1113

Query: 1129 AVSGDVFRLLFRDENEIPEEYLNEILLNSSIYA----RMSPDEKHELMIQLQK-LDYTVG 1183
             + GD  ++    E E+  ++L   LL  +  A    R+SP +K  ++  ++K LD    
Sbjct: 1114 IIDGDALKVALNGE-EMRRKFL---LLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTL 1169

Query: 1184 FCGDGANDCGALKAADVGISLSEAEASVA 1212
              GDG+ND   +++ADVG+ ++  E   A
Sbjct: 1170 AIGDGSNDVAMIQSADVGVGIAGEEGRQA 1198

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 99/389 (25%), Positives = 165/389 (42%), Gaps = 65/389 (16%)

Query: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKST---LPADFEEVLRCYTHNGY 989
            EF S  +RMS I +  +  +   F KGA  VI E  +      + A     L  Y   G 
Sbjct: 697  EFNSTRKRMSAIFRFPDGSIKL-FCKGADTVILERLDDEANQYVEATMRH-LEDYASEGL 754

Query: 990  RVIACAGKTLPKRTW-----LYSQKVS----REE--------VESNLEFLGFIIFQNKLK 1032
            R +  A + + +  +     +Y++  +    R E        +E NL  +G    ++KL+
Sbjct: 755  RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814

Query: 1033 KETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIV 1092
                ET+ +LQ+A I+  + TGD   TAI++G     + C R+    +N   ++ E    
Sbjct: 815  DGVPETIHTLQEAGIKIWVLTGDRQETAINIG-----MSC-RLLSEDMNLLIINEET--- 865

Query: 1093 WRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNE 1152
             RD  E + +     L   +L  + ++SL      L + G    L F  E E+ E+YL  
Sbjct: 866  -RDDTERNLLEKINALNEHQLSTHDMKSL-----ALVIDGK--SLGFALEPEL-EDYLLT 916

Query: 1153 I--LLNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAEA 1209
            +  L  + I  R+SP +K  ++  +++   ++      GAND   ++AA VG+ +S  E 
Sbjct: 917  VAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEG 976

Query: 1210 SVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYS---AIQFITITILYSRGSN 1266
              AA                R    AL   F   + + L     + Q I++ ILYS   N
Sbjct: 977  MQAA----------------RSADIAL-GQFKFLKKLLLVHGSWSYQRISVAILYSFYKN 1019

Query: 1267 LGDF--QFLYIDLLLIVPIAICMSWSKSY 1293
               +  QF Y+        +I  SW+ S+
Sbjct: 1020 TALYMTQFWYVFANAFSGQSIMESWTMSF 1048

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 88/356 (24%), Positives = 142/356 (39%), Gaps = 50/356 (14%)

Query: 459 SNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPF-----YVFQVFSIILWGIDE 513
           S GLT      R   +G NQ    M   +E LF + L  F     +V +  +I+  G+++
Sbjct: 66  SYGLTSDEVTKRRKKYGLNQ----MSEETENLFVKFLMFFIGPIQFVMEAAAILAAGLED 121

Query: 514 YYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGD 573
           +  +     L+ + +    + E +  S              V+RD     + S+E+VPGD
Sbjct: 122 WVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEVVPGD 181

Query: 574 IYEVSDPNITILPCDSILLSSDCIV--NESMLTGESVPVSKFPATEETMYQLCDDFQSTQ 631
           I ++ D    ++P D  L++ DC +  ++S +TGES+ V K              F  + 
Sbjct: 182 ILQLEDG--VVIPADGRLVTEDCFIQIDQSAITGESLAVDK-------------RFGDST 226

Query: 632 ISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYR 691
            SS   K                 +  A  +V  TG ST  G     +      G   + 
Sbjct: 227 FSSSTVK-----------------RGEAFMIVTATGDSTFVGRAAALVNKAA-AGSGHFT 268

Query: 692 DSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIV-VPPALPATLTIGTN 750
           +    IG + LI +    +          +K   ILR    ITIV VP  LPA +T    
Sbjct: 269 EVLNGIGTILLILVIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMA 328

Query: 751 FALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRG 806
              + L +K       + +     ++++C DKTGTLT++ L      + EP  V G
Sbjct: 329 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL-----SLHEPYTVEG 379

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 85/226 (37%), Gaps = 60/226 (26%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V+R+  E + E LG +   +  + +T++T+   +   +R  M TGD    A+ + +E   
Sbjct: 496  VARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKE--- 548

Query: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129
                                                 T + + LG N   + R       
Sbjct: 549  -------------------------------------TCRQLGLGTNIYNAERLGLGGGG 571

Query: 1130 VSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGA 1189
                          ++P   L + + N+  +A + P  K+ ++  LQ+  Y V   GDG 
Sbjct: 572  --------------DMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGV 617

Query: 1190 NDCGALKAADVGISLSEA--EASVAAPFTSKIFNISCVLDVIREGR 1233
            ND  +LK AD GI++  A   A  AA        +S ++D ++  R
Sbjct: 618  NDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 107/255 (41%), Gaps = 41/255 (16%)

Query: 555 VLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCI--VNESMLTGESVPVSK 612
           V+RD     I ++E+VPGDI ++ D   T++P D  +++ DC   +++S +TGES+ V K
Sbjct: 182 VIRDGQLVEIPANEVVPGDILQLEDG--TVIPTDGRIVTEDCFLQIDQSAITGESLAVDK 239

Query: 613 FPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTK 672
               +         F S+ +     + F+                    +V  TG +T  
Sbjct: 240 HYGDQT--------FSSSTVKR--GEGFM--------------------VVTATGDNTFV 269

Query: 673 GSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILR-ALD 731
           G    ++V     G   + +    IG + L+ +    +          +    ILR  L 
Sbjct: 270 GR-AAALVNKAAGGQGHFTEVLNGIGIILLVLVIATLLLVWTACFYRTNGIVRILRYTLG 328

Query: 732 IITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGL 791
           I  I VP  LPA +T       + L +K       + +     ++++C DKTGTLT++ L
Sbjct: 329 ITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 388

Query: 792 DVLGVQISEPNGVRG 806
                 + EP  V G
Sbjct: 389 -----SLHEPYTVEG 398

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 84/226 (37%), Gaps = 60/226 (26%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V+R+  E + E LG +   +  + +T++T+   +   +R  M TGD    A+ + +E   
Sbjct: 515  VARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGD----AVGIAKE--- 567

Query: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129
                                                 T + + LG N   + R       
Sbjct: 568  -------------------------------------TCRQLGLGTNIYNAERLGLGGGG 590

Query: 1130 VSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGA 1189
                          ++P   L + + N+  +A + P  K+ ++  LQ   Y V   GDG 
Sbjct: 591  --------------DMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGV 636

Query: 1190 NDCGALKAADVGISLSEA--EASVAAPFTSKIFNISCVLDVIREGR 1233
            ND  +LK AD GI++  A   A  AA        +S ++D ++  R
Sbjct: 637  NDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 682

>Scas_89.1
          Length = 271

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 101/216 (46%), Gaps = 33/216 (15%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V ++ +E NLE LG    ++KL+ +   +++ L++A ++  M TGD + TA  V   A L
Sbjct: 26   VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 85

Query: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129
            I                G+ V     ++ P+  L+   L+ +K+  +S          L 
Sbjct: 86   IS--------------RGQYVHTVTKLSRPEGALN--ALEYLKINKSS---------CLL 120

Query: 1130 VSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GD 1187
            + G+   +         +E+ + ++ L + I  R +P +K ++ + ++++      C GD
Sbjct: 121  IDGESLGMFL---TYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGD 177

Query: 1188 GANDCGALKAADVGISLSEAE---ASVAAPFTSKIF 1220
            G ND   ++ ADVG+ +   E   AS+AA F+   F
Sbjct: 178  GGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 213

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 153/372 (41%), Gaps = 68/372 (18%)

Query: 459 SNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPF-----YVFQVFSIILWGIDE 513
           S GLT      R   +G NQ    M   +E +  + +  F     +V +  +I+  G++E
Sbjct: 66  SYGLTSDEVSRRRKKYGLNQ----MSEANESMILKFVMFFVGPIQFVMEAAAILAAGLEE 121

Query: 514 YYYYAA-CIFL-----ISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSS 567
           +  +   C  L     +  +  F + +  +++ + LA  +       V+RD     I ++
Sbjct: 122 WIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSA------VVIRDGSLVEIPAN 175

Query: 568 ELVPGDIYEVSDPNITILPCDSILLSSDCIV--NESMLTGESVPVSKFPATEETMYQLCD 625
           E+VPGDI ++ D    I+P D  +++  C V  ++S +TGES+ V K             
Sbjct: 176 EVVPGDILQLEDG--VIIPADGRIVTEGCFVQIDQSAITGESLAVDK------------- 220

Query: 626 DFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPT 685
                           Y       + +  G+     +V  TG ST  G    ++V     
Sbjct: 221 ---------------RYGDATFSSSTVKRGE--GFMIVTATGDSTFVGR-AAALVNKASA 262

Query: 686 GFKFYRDSFKYIGFMSLIAIFGFC----VSCVQFIKLGLDKKTMILRALDIITIVVPPAL 741
           G   + +    IG + LI +        V+C  F +  +D  T++   L I  + VP  L
Sbjct: 263 GSGHFTEVLNGIGTILLILVILTLLVVYVAC--FYR-SIDIVTILRYTLAITVVGVPVGL 319

Query: 742 PATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEP 801
           PA +T       + L +K       + +     ++++C DKTGTLT++ L      + EP
Sbjct: 320 PAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL-----SLHEP 374

Query: 802 NGVRGQKFGELL 813
             V G +  +L+
Sbjct: 375 YTVEGVEADDLM 386

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 102/283 (36%), Gaps = 81/283 (28%)

Query: 958  KGAPE-VISEICNKSTLPAD----FEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSR 1012
            KGAP  V+  +     +P D    +E  +      GYR +                 V+R
Sbjct: 455  KGAPLFVLKTVEENHLIPEDVKENYENKVAELASRGYRALG----------------VAR 498

Query: 1013 EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQC 1072
            +  E + E LG +   +  + +T++T+   +   +R  M TGD    A+ + +E      
Sbjct: 499  KRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKE------ 548

Query: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSG 1132
                                              T + + LG N   + R          
Sbjct: 549  ----------------------------------TCRQLGLGTNIYNAERLGLGGGG--- 571

Query: 1133 DVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDC 1192
                       ++P   L + + N+  +A + P  K+ ++  LQ+  Y V   GDG ND 
Sbjct: 572  -----------DMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDA 620

Query: 1193 GALKAADVGISLSEA--EASVAAPFTSKIFNISCVLDVIREGR 1233
             +LK AD GI++  A   A  AA        +S ++D ++  R
Sbjct: 621  PSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

>Scas_576.8
          Length = 1591

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 139/336 (41%), Gaps = 67/336 (19%)

Query: 928  VVRSFEFLSELRRMSVIVK---TNNDDVYWSF--TKGAPEVI------SEICNKSTLPAD 976
            ++ + EF S  +RMS IVK    N DD   +    KGA  +I          N   L   
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKNGANSENLLEK 911

Query: 977  FEEVLRCYTHNGYRVIACAGKTLP--------KRTWLYSQKVSR---------EEVESNL 1019
                L  Y   G R +  A + L         KR  + +  V+          +E+E  L
Sbjct: 912  TALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIEREL 971

Query: 1020 EFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPS 1079
              LG    +++L+    E++  L  A I+  + TGD + TAI++G    L+         
Sbjct: 972  TLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLN-------- 1023

Query: 1080 INDTPL-----HGEPVIVWRDVNEPDKI---LDTKTLKPVKLGNNSVE----------SL 1121
             ND  L     +G+ V  +   N+P +I   L TK L+  K G    E            
Sbjct: 1024 -NDMELLVVKTNGDDVQEFG--NDPAEIAESLITKYLRE-KFGLTGSEMELADAKKNHDF 1079

Query: 1122 RECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYA----RMSPDEKHELM-IQLQ 1176
               ++ + + G+  +L    E+ I  ++L   LL  +  A    R+SP +K  ++ + + 
Sbjct: 1080 PRGDFAVVIDGEALKLALNGES-IRRKFL---LLCKNCKAVLCCRVSPAQKAAVVKLVMT 1135

Query: 1177 KLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212
             LD      GDG+ND   +++ADVG+ ++  E   A
Sbjct: 1136 SLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQA 1171

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 139/333 (41%), Gaps = 61/333 (18%)

Query: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVI-SEICNKS-----TLPAD 976
            ++   EF S  +RMS I+K      N++       KGA  VI S +  K+     TL   
Sbjct: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891

Query: 977  FEEVLRCYTHNGYRVIACAGKTLPKRTW------------LYSQKVSREE--------VE 1016
                L  Y   G R +  A + L   TW              +   +REE        +E
Sbjct: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948

Query: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVY 1076
             +L  LG    +++L+    E++  L +A I+  + TGD + TAI++G    L+      
Sbjct: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN----- 1003

Query: 1077 VPSINDTPL-----HGEPVIVW-RDVNEPDKILDTKTLKPVKLGNNSVE----------S 1120
                ND  L      GE V+ +  D +E    L +K L+  K G +  E          S
Sbjct: 1004 ----NDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLRE-KFGLSGSEMELDNAKGDHS 1058

Query: 1121 LRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK-LD 1179
              + ++ + + GD  ++    ++   +  L      + +  R+SP +K  ++  ++  LD
Sbjct: 1059 FPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLD 1118

Query: 1180 YTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212
                  GDG+ND   +++ADVGI ++  E   A
Sbjct: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151

>Kwal_23.3556
          Length = 1597

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/420 (24%), Positives = 178/420 (42%), Gaps = 71/420 (16%)

Query: 1013 EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQ- 1071
            E VE++L  LG    ++KL++  ++ +  ++ A I+  M TGD   TAI++G    LI  
Sbjct: 1013 ELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHD 1072

Query: 1072 CSRVYVPSINDTPLHGEPVIVWRDVNEPD-----KILDTKTLKPVKLGNNSVESLRECNY 1126
             S V + S  D  +  +   V +++   +      ++D  TL              E N 
Sbjct: 1073 YSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTF-----------ESNP 1121

Query: 1127 TLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVG--F 1184
            TL     VF  L    + +             I  R SP +K  ++  ++  D  +    
Sbjct: 1122 TLM---SVFVELCTKTDSV-------------ICCRASPSQKALMVTHIRNTDKKLVTLA 1165

Query: 1185 CGDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCVLDVIREGRAALVTSFA 1241
             GDGAND   +++AD+G+ ++  E   AS ++ ++   F     L ++  GR   V +  
Sbjct: 1166 IGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLV-HGRYNYVRTTK 1224

Query: 1242 CFQYMSLYSAIQFITITILYSRGSNLGDFQF-------LYIDLLLIVPIAICMSWSKSYE 1294
             F   + Y  + F    ++Y R +              ++  L   +P+ +C+     +E
Sbjct: 1225 -FVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPV-LCIGM---FE 1279

Query: 1295 KIDKKRPSANLVSPKILVPLLIS------VFLVFLF-QFIPWIIVQKMSWYIKPIVGGDD 1347
            K    +P   L  P++     +S      VFL ++F   +  +I+  ++W I        
Sbjct: 1280 K--DLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIW------- 1330

Query: 1348 AVQS-SDNTVL-FFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTL 1405
            AV S SDNTV    V NF  I+T  +++V     E  ++N   I  + +S+G  LL   L
Sbjct: 1331 AVSSLSDNTVYPIGVINFTAIIT--LVNVKCQLLETHNRNVLAICSLVISVGGWLLWCCL 1388

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 140/336 (41%), Gaps = 67/336 (19%)

Query: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVISEICNK---STLPADFEE 979
            ++   EF S  +RMS IVK       ++       KGA  +I    ++   S   A  E+
Sbjct: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895

Query: 980  V---LRCYTHNGYRVIACAGKTLPKRTWLYSQK------------VSREE--------VE 1016
                L  Y   G R +  A + L   +W   +K             +RE+        +E
Sbjct: 896  TALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSIE 952

Query: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR-- 1074
              L  LG    +++L+    + ++ L +A I+  + TGD + TAI++G    L+      
Sbjct: 953  RELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMEL 1012

Query: 1075 -VYVPSINDTPLHGEPVIVWRDVNEPDKILD---TKTLKPVKLGNNSVESLREC------ 1124
             V   + +D    G         +EP +I+D   +K LK       S E + E       
Sbjct: 1013 LVIKTTGDDVKEFG---------SEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEF 1063

Query: 1125 ---NYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYA----RMSPDEKHELMIQLQ- 1176
               NY + + GD  +L    E +I  ++L   LL  +  A    R+SP +K  ++  ++ 
Sbjct: 1064 PKGNYAIVIDGDALKLALYGE-DIRRKFL---LLCKNCRAVLCCRVSPSQKAAVVKLVKD 1119

Query: 1177 KLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212
             LD      GDG+ND   +++ADVGI ++  E   A
Sbjct: 1120 SLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1155

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 136/327 (41%), Gaps = 51/327 (15%)

Query: 928  VVRSFEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVISEICNKS-TLPADFEEV- 980
            ++   EF S  +RMS IVK      N+        KGA  VI    ++S   P   E   
Sbjct: 843  ILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRNDPKLLERTA 902

Query: 981  --LRCYTHNGYRVIACAGKTL---------PKRTWLYSQKVSREE--------VESNLEF 1021
              L  +   G R +  A + +          +R    +   +REE        +E  L  
Sbjct: 903  LHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADAIERQLVL 962

Query: 1022 LGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR---VYVP 1078
            LG    +++L+    +++  L DA I+  + TGD + TAI++G    L+       V   
Sbjct: 963  LGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLGSDMELLVIKS 1022

Query: 1079 SINDTPLHGEPVIVWRDVNEPDKILDT--KTLKPVKLGNNSVESLR------ECNYTLAV 1130
            S  D    GE     +D +    ++D   +T   +K     + + R      +  + + +
Sbjct: 1023 SGEDVEHLGE-----KDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTPPQSAFGVVI 1077

Query: 1131 SGDVFRLLFRDENEIPEEYLNEILLNSSIYA----RMSPDEKHELM-IQLQKLDYTVGFC 1185
             GD  +L    E +I  ++L   LL  +  A    R+SP +K  ++ +  + LD      
Sbjct: 1078 DGDALKLALHGE-DIRRKFL---LLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVTLAI 1133

Query: 1186 GDGANDCGALKAADVGISLSEAEASVA 1212
            GDG+ND   ++AADVGI ++  E   A
Sbjct: 1134 GDGSNDVAMIQAADVGIGIAGEEGRQA 1160

>Kwal_47.17522
          Length = 899

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/363 (22%), Positives = 144/363 (39%), Gaps = 50/363 (13%)

Query: 459 SNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPF-----YVFQVFSIILWGIDE 513
           S GLT      R   +G NQ    M   SE L  + L  F     +V +  +I+  G+++
Sbjct: 66  SYGLTSDEVTKRRKKYGLNQ----MAEESESLVVKFLMFFIGPIQFVMEAAAILAAGLED 121

Query: 514 YYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGD 573
           +  +   + L+ + +    + E +  S              V+RD     I ++E+VPGD
Sbjct: 122 WVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEVVPGD 181

Query: 574 IYEVSDPNITILPCDSILLSSDCI--VNESMLTGESVPVSKFPATEETMYQLCDDFQSTQ 631
           I ++ D    ++  D  L++ +C   +++S +TGES+ V K                   
Sbjct: 182 IMQLEDG--VVICADGRLVTEECFLQIDQSAITGESLAVDKH------------------ 221

Query: 632 ISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYR 691
                     Y  T    + +  G+     +V  TG +T  G    ++V         + 
Sbjct: 222 ----------YGDTTFSSSTVKRGE--GFMIVTATGDNTFVGR-AAALVNQAAGDQGHFT 268

Query: 692 DSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILR-ALDIITIVVPPALPATLTIGTN 750
           +    IG + L+ +    +          D+   ILR  L I  I VP  LPA +T    
Sbjct: 269 EVLNGIGTILLVLVIVTLLLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMA 328

Query: 751 FALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFG 810
              + L +K       + +     ++++C DKTGTLT++ L      + EP  V G +  
Sbjct: 329 VGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL-----SLHEPYTVEGVEPD 383

Query: 811 ELL 813
           +L+
Sbjct: 384 DLM 386

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 85/226 (37%), Gaps = 60/226 (26%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V+R+  E + E LG +   +  + +T++T+   +   +R  M TGD    A+ + +E   
Sbjct: 496  VARKRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGD----AVGIAKE--- 548

Query: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129
                                                 T + + LG N   + R       
Sbjct: 549  -------------------------------------TCRQLGLGTNIYNAERLGLGGGG 571

Query: 1130 VSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGA 1189
                          ++P   L + + N+  +A + P  K+ ++  LQ+  Y V   GDG 
Sbjct: 572  --------------DMPGSELADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGV 617

Query: 1190 NDCGALKAADVGISLSEA--EASVAAPFTSKIFNISCVLDVIREGR 1233
            ND  +LK AD GI++  A   A  AA        +S ++D ++  R
Sbjct: 618  NDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 150/371 (40%), Gaps = 69/371 (18%)

Query: 454 DLST-VSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPF-----YVFQVFSII 507
           DLST  + GLT      R   +G NQ    M   +E L  + L  F     +V +  +I+
Sbjct: 108 DLSTDPAYGLTSDEVARRRKKYGLNQ----MAEENESLIVKFLMFFVGPIQFVMEAAAIL 163

Query: 508 LWGIDEYYYYAA-CIFLISVLSI-----FDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFW 561
             G+ ++      C  L+   S+     F + +   ++ + LA  +       V+RD   
Sbjct: 164 AAGLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTA------TVIRDGQL 217

Query: 562 TTISSSELVPGDIYEVSDPNITILPCDSILLSSDCI--VNESMLTGESVPVSKFPATEET 619
             I ++E+VPG+I ++     TI P D  +++ DC   +++S +TGES+   K    E  
Sbjct: 218 IEIPANEVVPGEILQLESG--TIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEV- 274

Query: 620 MYQLCDDFQSTQIS---SFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLV 676
                  F S+ +    +F+  +   + T + RA    GQ            S  +G   
Sbjct: 275 -------FSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQA-----------SGVEGHFT 316

Query: 677 RSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILR-ALDIITI 735
             +            +    I  + +IA      +   +  +G+     ILR  L I  I
Sbjct: 317 EVL------------NGIGIILLVLVIATLLLVWTACFYRTVGI---VSILRYTLGITII 361

Query: 736 VVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLG 795
            VP  LPA +T       + L +K       + +     ++++C DKTGTLT++ L    
Sbjct: 362 GVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL---- 417

Query: 796 VQISEPNGVRG 806
             + EP  V G
Sbjct: 418 -SLHEPYTVEG 427

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 85/226 (37%), Gaps = 60/226 (26%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V+R+  E + E LG +   +  + +T++T+   ++  +R  M TGD    A+ + +E   
Sbjct: 544  VARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGD----AVGIAKE--- 596

Query: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129
                                                 T + + LG N   + R       
Sbjct: 597  -------------------------------------TCRQLGLGTNIYNAERLGLGGGG 619

Query: 1130 VSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGA 1189
                          ++P   L + + N+  +A + P  K+ ++  LQ   Y V   GDG 
Sbjct: 620  --------------DMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGV 665

Query: 1190 NDCGALKAADVGISLSEA--EASVAAPFTSKIFNISCVLDVIREGR 1233
            ND  +LK AD GI++  A   A  AA        +S ++D ++  R
Sbjct: 666  NDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 711

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 115/256 (44%), Gaps = 32/256 (12%)

Query: 1015 VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLI-QCS 1073
            +E++LE LG    ++KL++   E ++ ++ A I+  M TGD   TAI++G    LI   S
Sbjct: 995  IETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYS 1054

Query: 1074 RVYVPSINDTPLHGEPVIVWRDVNEPDKILDT-KTLKPVKLGNNSVESLRECNYTLAVSG 1132
             V +   ND  L  +   +  +       LDT K    V + + +  ++ E N T+    
Sbjct: 1055 TVVILKKNDDNLISKMTALGEE-------LDTGKIAHCVLVIDGASLAVFENNPTMM--- 1104

Query: 1133 DVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELM--IQLQKLDYTVGFCGDGAN 1190
             VF  L    + +             I  R SP +K  ++  I+L+  D      GDGAN
Sbjct: 1105 SVFIELCTKTDSV-------------ICCRASPSQKALIVTNIRLKNKDLVTLAIGDGAN 1151

Query: 1191 DCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMS 1247
            D   +++AD+G+ ++  E   AS ++ ++   F     L +   GR   V + + F   +
Sbjct: 1152 DIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKL-LFVHGRYNYVRT-SKFVLCT 1209

Query: 1248 LYSAIQFITITILYSR 1263
             Y  + F    ++Y R
Sbjct: 1210 FYKEVLFYLTQMIYQR 1225

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/331 (22%), Positives = 132/331 (39%), Gaps = 58/331 (17%)

Query: 928  VVRSFEFLSELRRMSVIVKTNNDDVYWS-----FTKGAPEVISEICNKSTLPAD--FEEV 980
            ++   EF S  +RMS IVK   DD           KGA  VI    +K+ L  +   E+ 
Sbjct: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902

Query: 981  ---LRCYTHNGYRVIACAGKTLPKRTWLYSQK---------VSREE--------VESNLE 1020
               L  Y   G R +  A + L    +    K         V REE        +E +L 
Sbjct: 903  ALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLI 962

Query: 1021 FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCS------R 1074
             LG    +++L+    +++  L +A I+  + TGD + TAI++G    L+         +
Sbjct: 963  LLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIK 1022

Query: 1075 VYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPV--KLG-NNSVESLRECN------ 1125
               P + D                P  I+DT   + +  K G   S E L++        
Sbjct: 1023 TTGPDVEDLGA------------TPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIP 1070

Query: 1126 ---YTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK-LDYT 1181
               + + + G+  +     E+   +  L      S +  R+SP +K  ++  ++  LD  
Sbjct: 1071 RGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVM 1130

Query: 1182 VGFCGDGANDCGALKAADVGISLSEAEASVA 1212
                GDG+ND   +++A++G+ ++  E   A
Sbjct: 1131 TLAIGDGSNDVAMIQSANIGVGIAGEEGRQA 1161

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 117/261 (44%), Gaps = 40/261 (15%)

Query: 1014 EVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQ-C 1072
            ++E  L  LG    ++KL++  SE ++ ++ A I+  M TGD   TAI++G    LI   
Sbjct: 1015 QIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDY 1074

Query: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPDK-----ILDTKTLKPVKLGNNSVESLRECNYT 1127
            S V + + +D  +  +   + ++V+  +      ++D  TL           ++ E N T
Sbjct: 1075 STVVILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATL-----------AMFEDNPT 1123

Query: 1128 LAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVG--FC 1185
            L     VF  L    + +             +  R SP +K  ++  ++  D ++     
Sbjct: 1124 LM---SVFTELCTKTDSV-------------VCCRASPAQKALMVSNIRNTDKSIVTLAI 1167

Query: 1186 GDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCVLDVIREGRAALVTSFAC 1242
            GDGAND   +++AD+G+ ++  E   AS +A ++   F     L ++  GR   + + A 
Sbjct: 1168 GDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKL-LLVHGRYNYIRT-AK 1225

Query: 1243 FQYMSLYSAIQFITITILYSR 1263
            F   + Y  + F    ++Y R
Sbjct: 1226 FILCTFYKELTFYLTQLIYQR 1246

>Scas_688.1
          Length = 913

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 88/226 (38%), Gaps = 60/226 (26%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V+R+  E + E LG +   +  + +T ET+   +   +R  M TGD    A+ + +E   
Sbjct: 510  VARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGD----AVGIAKE--- 562

Query: 1070 IQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLA 1129
                                                 T + + LG N   + R     L 
Sbjct: 563  -------------------------------------TCRQLGLGTNVYNAER-----LG 580

Query: 1130 VSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGA 1189
            +SG           ++P   L + + N+  +A + P +K+ ++  LQ   Y V   GDG 
Sbjct: 581  LSGG---------GDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGV 631

Query: 1190 NDCGALKAADVGISLSEA--EASVAAPFTSKIFNISCVLDVIREGR 1233
            ND  +LK AD GI++  A   A  AA        +S ++D ++  R
Sbjct: 632  NDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 677

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 721 DKKTMILRALDIITIV-VPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMC 779
           D    ILR    ITIV VP  LPA +T       + L +K       + +     ++++C
Sbjct: 312 DGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 371

Query: 780 FDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELL 813
            DKTGTLT++ L      + EP  V G    +L+
Sbjct: 372 SDKTGTLTKNKL-----SLHEPYTVEGVSADDLM 400

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 95/209 (45%), Gaps = 35/209 (16%)

Query: 1013 EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQ- 1071
            E +E +L  LG I  ++KL++   + +  L+ A I+  M TGD   TAI++G    LI  
Sbjct: 994  EIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHD 1053

Query: 1072 CSRVYVPSINDTPLHGEPVIVWRDVNEPD-----KILDTKTLKPVKLGNNSVESLRECNY 1126
             S V + + ND  +  +   + +++   +      ++D  TL           ++ E N 
Sbjct: 1054 YSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATL-----------TIFEGNL 1102

Query: 1127 TLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVG--F 1184
            TL     +F  L    + +             I  R SP +K  ++ +++K D  +    
Sbjct: 1103 TLMT---LFIELCTKTDSV-------------ICCRSSPSQKALMVTKIRKTDKKLVTLA 1146

Query: 1185 CGDGANDCGALKAADVGISLSEAEASVAA 1213
             GDGAND   +++AD+G+ ++  E   A+
Sbjct: 1147 IGDGANDIAMIQSADIGVDITGKEGLQAS 1175

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 111/263 (42%), Gaps = 44/263 (16%)

Query: 1014 EVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQ-C 1072
            E+E  L  LG    ++KL+   SE ++ ++ A I+  M TGD   TAI++G    LI+  
Sbjct: 1075 EIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDY 1134

Query: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPD-----KILDTKTLKPVKLGNNSVES--LRECN 1125
            S V + +  D  +  +   V ++V+  +      ++D  T+   + GN +  S  +  C 
Sbjct: 1135 STVVILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFE-GNPTYMSVFVELCT 1193

Query: 1126 YTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLD--YTVG 1183
             T                            +S I  R SP +K  ++  ++  D      
Sbjct: 1194 KT----------------------------DSVICCRASPSQKALMVSNIRNTDPNLVTL 1225

Query: 1184 FCGDGANDCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCVLDVIREGRAALVTSF 1240
              GDGAND   +++AD+G+ ++  E   AS  + ++   F     L +   GR   + + 
Sbjct: 1226 AIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKL-LFVHGRYNYIRT- 1283

Query: 1241 ACFQYMSLYSAIQFITITILYSR 1263
            + F   + Y  I F    ++Y R
Sbjct: 1284 SKFMLCTFYKEITFYFTQLIYQR 1306

>Scas_569.0d
          Length = 468

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 14/143 (9%)

Query: 1098 EPDKILDTKTLKPVK--LGNNSVESLRECNYT--LAVSGDVFRLLFRDENEIPEEYLNEI 1153
            +  K LD +  +  K  +G NS+    + N T  + ++G  F       +E+  E ++ +
Sbjct: 46   DASKGLDDEKFQARKSAVGENSLGDDMKSNSTENMVMTGSQF-------DELTPEQIDNL 98

Query: 1154 LLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAA 1213
             +   + AR SP  K  ++  L + D      GDG ND  +LK A+VGI++    + VA 
Sbjct: 99   PVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAK 158

Query: 1214 PFTSKIF---NISCVLDVIREGR 1233
              +  +    N + +L+ I EGR
Sbjct: 159  DASDIVLSDDNFASILNAIEEGR 181

>Scas_636.16
          Length = 1554

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 137/330 (41%), Gaps = 55/330 (16%)

Query: 928  VVRSFEFLSELRRMSVIVK----TNNDD-VYWSFTKGAPEVI-SEIC-----NKSTLPAD 976
            ++   EF S  +RMS IVK    T  D+       KGA  VI S +      N  TL   
Sbjct: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874

Query: 977  FEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQK------------VSREE--------VE 1016
                L  Y   G R + C G+   + +W   Q+              REE        +E
Sbjct: 875  TALHLEQYATEGLRTL-CVGQR--EISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931

Query: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVY 1076
             +L  LG    +++L+    +++  L +A I+  + TGD + TAI++G    L+  + + 
Sbjct: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN-TDME 990

Query: 1077 VPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLREC------------ 1124
            +  I  T   GE V  + D  +P +I++    K +    N   S  E             
Sbjct: 991  LLVIKTT---GEDVKEFGD--DPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQG 1045

Query: 1125 NYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK--LDYTV 1182
             + + + G+  ++    +    +  L      + +  R+SP +K  + ++L K  LD   
Sbjct: 1046 EFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV-VKLVKDTLDVMT 1104

Query: 1183 GFCGDGANDCGALKAADVGISLSEAEASVA 1212
               GDG+ND   +++ADVG+ ++  E   A
Sbjct: 1105 LAIGDGSNDVAMIQSADVGVGIAGEEGRQA 1134

>Scas_669.3
          Length = 1638

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 116/257 (45%), Gaps = 30/257 (11%)

Query: 1013 EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQC 1072
            EE+E +L+ LG    ++KL++  SE ++ ++ A I+  M TGD   TAI++G       C
Sbjct: 1048 EEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIG-----YSC 1102

Query: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKP-VKLGNNSVESLRECNYTLAVS 1131
              +Y  S       G+  I+ + +N   + +D+  +   V + + S  ++ E N TL   
Sbjct: 1103 KLIYDYSTVVILAKGDENIISK-MNAISQEVDSGNVAHCVIIIDGSTLAMFEGNPTLM-- 1159

Query: 1132 GDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVG--FCGDGA 1189
              VF  L    + +             I  R SP +K  ++  ++  +  +     GDGA
Sbjct: 1160 -SVFIELCTKTDSV-------------ICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGA 1205

Query: 1190 NDCGALKAADVGISLSEAE---ASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYM 1246
            ND   +++AD+GI +   E   AS  A ++   F     L ++  GR   + + A F   
Sbjct: 1206 NDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKL-LLVHGRYNYIRT-AKFILC 1263

Query: 1247 SLYSAIQFITITILYSR 1263
            + +  I F    +++ R
Sbjct: 1264 TFFKEITFYLTQLIFQR 1280

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
            Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
            Saccharomyces cerevisiae YPL036w PMA2, hypothetical start
          Length = 902

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 68/144 (47%), Gaps = 11/144 (7%)

Query: 1096 VNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVF---RLLFRDENEIPEEYLNE 1152
            VNE  ++     L+   L  ++V   +E    L +  +++   RL      ++P   L +
Sbjct: 528  VNEARRL----GLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELAD 583

Query: 1153 ILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212
             + N+  +A + P  K++++  LQ   Y V   GDG ND  +LK AD GI++ E  +  A
Sbjct: 584  FVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGASDAA 642

Query: 1213 APFTSKIF---NISCVLDVIREGR 1233
                  +F    +S ++D ++  R
Sbjct: 643  RSAADIVFLAPGLSAIIDALKTSR 666

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 82/366 (22%), Positives = 135/366 (36%), Gaps = 56/366 (15%)

Query: 459 SNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPF-YVFQVFSIILWGIDEYYYY 517
           S GLT      R   +G NQ+    ++         + P  +V +  +I+  G+ ++  +
Sbjct: 69  SYGLTSDEVAHRRKKYGLNQMADERESMIVKFVMFFVGPIQFVMEAAAILAAGLSDWVDF 128

Query: 518 A---------ACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSE 568
                     AC+  I        ++E KK   N+A          V+RD     + ++E
Sbjct: 129 GVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVA---------VVIRDGQLVEVPANE 179

Query: 569 LVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQ 628
           +VPGDI ++ D                         G  +P      TE    Q+ D   
Sbjct: 180 VVPGDILQLED-------------------------GTIIPADGRLVTENCFLQV-DQSA 213

Query: 629 STQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFK 688
            T  S  V K   Y       + +  G+  A  +V  TG +T  G    ++V     G  
Sbjct: 214 ITGESLAVDKG--YGDQTFSSSTVKRGE--AFMVVTATGDNTFVGR-AAALVNKASGGQG 268

Query: 689 FYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILR-ALDIITIVVPPALPATLTI 747
            + +    IG + L+ +    +          D    ILR  L I  I VP  LPA +T 
Sbjct: 269 HFTEVLNGIGILLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTT 328

Query: 748 GTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQ 807
                 + L +K       + +     ++++C DKTGTLT++ L      + EP  V G 
Sbjct: 329 TMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL-----SLHEPYTVEGV 383

Query: 808 KFGELL 813
              +L+
Sbjct: 384 SADDLM 389

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 1010 VSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            V+R+  E + E LG +   +  + +T+ET+   +   +R  M TGD +  A    R+ GL
Sbjct: 499  VARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGL 558

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 113/302 (37%), Gaps = 67/302 (22%)

Query: 516 YYAACIFLISVLSI---FDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPG 572
           Y+ + +FL   L I    +SL + K  S  ++ +S F  +   L  K        E V  
Sbjct: 511 YFDSVVFLTFFLLIGRLLESLAKTKTASA-ISNLSSFKQETATLMQKVGDQYQEVETVQI 569

Query: 573 DIYEVSD-----PNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATE--ETMYQLCD 625
              E+ D     P  +  P DSI+L  +   +ES LTGES+P+ +    +       +  
Sbjct: 570 QYLELGDYIKISPGQS-PPLDSIILEGETEFDESALTGESIPMVRLRGDQIFAGTVNVGS 628

Query: 626 DFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPT 685
                ++SSF  +S L    N +R                       G L R+ +     
Sbjct: 629 SSVIAKVSSFDGESLLDQIVNTVR----------------------DGQLNRAPI----- 661

Query: 686 GFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKT---------------MILRAL 730
                R +    G+   I IF   ++ V ++ LGL  K                 +  A+
Sbjct: 662 ----ERLADILTGYFVPIIIFLAILTWVVWLSLGLSGKLPEHYLDTDIGGWPVWSLEFAI 717

Query: 731 DIITIVVPP----ALPATLTIGTNFALSRLKEKGIFCISPTRLNISG-KIDVMCFDKTGT 785
            +  I  P     A P  L +G+  A     + GI C         G KI ++CFDKTGT
Sbjct: 718 SVFVIACPCGIGLAAPTALFVGSGMA----AKFGILCRGGGAAFQEGCKIAIVCFDKTGT 773

Query: 786 LT 787
           LT
Sbjct: 774 LT 775

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 1138 LFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDY-------TVGFCGDGAN 1190
            +   +NE+    + + L   ++ A + P+EK   +  +Q  +         V   GDG N
Sbjct: 951  MISGDNEVTARAVAQELDIDNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGIN 1010

Query: 1191 DCGALKAADVGISLSEA 1207
            D  AL AADVGI+L+  
Sbjct: 1011 DAPALAAADVGIALASG 1027

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
            cerevisiae YDR270w CCC2 probable copper-transporting
            ATPase, start by similarity
          Length = 975

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 1159 IYARMSPDEKHELMIQLQKLDYT-VGFCGDGANDCGALKAADVGISLSEA 1207
            +++ ++P++K +++IQLQ      V F GDG ND  AL  AD+GIS+S  
Sbjct: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 118/327 (36%), Gaps = 73/327 (22%)

Query: 499 YVFQVFSIILWGIDEYYYYAACIFLISVLSI----FDSLNEQKKVSRNLAEMSHF----- 549
           Y+F  +SII     +       IF  +V+ +       L E K  S     MS       
Sbjct: 347 YIFSCYSIISSIYHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTP 406

Query: 550 -HCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESV 608
             C + VL D     IS   L P DI EV  P + I P D +++ ++  V+ES++TGES+
Sbjct: 407 SSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRNETEVDESLITGESM 463

Query: 609 PVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARI-APGQTAALAMVVRTG 667
            V K                               G+ +I   +  PG     A  +R G
Sbjct: 464 LVEKIV-----------------------------GSQVIGGSVNGPGHFYFRA--IRVG 492

Query: 668 FSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTM-- 725
             T   +++ +M   + +     + + K  G   +   F   +S + FI   L   TM  
Sbjct: 493 EDTKLANIIATMKKAQLSKAPIQKYADKMAG---IFVPFVISLSAITFITWMLVSYTMKT 549

Query: 726 ---------------ILRALDIITIVVPPAL----PATLTIGTNFALSRLKEKGIFCISP 766
                          +  ++ +I +  P AL    P  + +GT    S     G+     
Sbjct: 550 PPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASH----GVLIKGG 605

Query: 767 TRLNISGKIDVMCFDKTGTLTEDGLDV 793
             L     +    FDKTGTLT   + V
Sbjct: 606 DVLEKCSALQTFLFDKTGTLTTGRMSV 632

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 97/234 (41%), Gaps = 45/234 (19%)

Query: 572 GDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQ 631
           GDI++V  P+  I P D  ++S    V+E+++TGES+PV K               QS  
Sbjct: 717 GDIFKVL-PDSRI-PTDGTVISGSSEVDEALITGESMPVPK-------------KCQSIV 761

Query: 632 ISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYR 691
           ++  V+ +    GT  ++    PG              +T  ++V      KP   +   
Sbjct: 762 VAGSVNGT----GTLFVKLSKLPGNNTI----------STIATMVDEAKLTKPK-IQNIA 806

Query: 692 DSFK--YIGFMSLIAIFGFCVSCVQFIKLGLDKKT-----MILRALDIITIVVPP----A 740
           D     ++  +  I +  FCV     I++    ++      I+ A+ ++ +  P     A
Sbjct: 807 DKIASYFVPTIIGITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLA 866

Query: 741 LPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVL 794
           +P    I +  A  R    G+   S   + ++     + FDKTGTLTE  L V+
Sbjct: 867 VPIVFVIASGVAAKR----GVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVV 916

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 12/70 (17%)

Query: 1156 NSSIYARMSPDEKHELM---IQLQKLDYT-------VGFCGDGANDCGALKAADVGISLS 1205
            +S+I +  +P EK E +   ++ +  D +       V FCGDG ND   L  A +G+ ++
Sbjct: 1066 SSNIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHIN 1125

Query: 1206 EAE--ASVAA 1213
            E    A +AA
Sbjct: 1126 EGSEVAKLAA 1135

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..514400)
            [2433 bp, 810 aa]
          Length = 810

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 1157 SSIYARMSPDEKHELMIQL-QKLDYTVGFCGDGANDCGALKAADVGISLS 1205
            +++++   P+ K +++ QL QK DY V F GDG ND  AL  +D+GISLS
Sbjct: 630  NNVFSERLPEGKCDVLRQLRQKYDY-VAFIGDGINDSVALAESDLGISLS 678

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 569 LVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATE 617
           L  GD+  V  P  T LP D  +L  +  V+ES++TGES  V K+P + 
Sbjct: 270 LQAGDVV-VMRPG-TKLPADGTVLEGEAEVDESLMTGESTLVPKYPGSR 316

>Kwal_55.21575
          Length = 989

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 1157 SSIYARMSPDEKHELMIQLQKLDY-TVGFCGDGANDCGALKAADVGISLS 1205
            +++Y+ ++P +K++L+  LQ      V F GDG ND  AL  +D+G+S+S
Sbjct: 790  NNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 1015 VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR 1074
            V+ N E +G     + +KK+ +E ++ L +   R  M TGDN  +A+ V  E G I+ + 
Sbjct: 733  VKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELG-IEANN 791

Query: 1075 VY 1076
            VY
Sbjct: 792  VY 793

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
            Saccharomyces cerevisiae YDR270w CCC2, start by
            similarity
          Length = 1012

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 32/51 (62%)

Query: 1157 SSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEA 1207
            +++Y+ ++PD K + +  L++    + F GDG ND  AL  +D+GI++S  
Sbjct: 806  NNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSG 856

>Scas_505.4
          Length = 1025

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 93/209 (44%), Gaps = 38/209 (18%)

Query: 1097 NEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEI--L 1154
            N  DKI+    LK  KL      S  E N TLA+  D   L +  E+++ E+YL  +  +
Sbjct: 537  NMRDKIM---ALKEHKL------SQHEMN-TLALVIDGKSLSYALESDL-EDYLLALGKI 585

Query: 1155 LNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVA 1212
              + +  R+SP +K  L++++  +K    +   GDGAND   ++AA VG+ +S  E   A
Sbjct: 586  CKAVVCCRVSPLQK-ALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 644

Query: 1213 APFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYS---AIQFITITILYSRGSNLGD 1269
            A                R    A V  F   + + L     + Q I++ ILYS   N   
Sbjct: 645  A----------------RSADIA-VGQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTAL 687

Query: 1270 F--QFLYIDLLLIVPIAICMSWSKSYEKI 1296
            +  QF ++        +I  SW+ SY  +
Sbjct: 688  YMTQFWFVFANAFSGQSIMESWTMSYYNV 716

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 1137 LLFRDENEIPEEYLNEILLN-SSIYARMSPDEKHELM--IQLQKLDYTVGFCGDGANDCG 1193
            ++  D N   +    E+ ++  ++Y+ +SP  K +L+  IQ ++ +  V   GDG ND  
Sbjct: 785  MITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAP 844

Query: 1194 ALKAADVGISLS 1205
            AL  +D+GI++S
Sbjct: 845  ALALSDLGIAIS 856

>Scas_615.9
          Length = 942

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 1157 SSIYARMSPDEKHELMIQLQKLDYT-VGFCGDGANDCGALKAADVGISLS 1205
            +++Y+ ++P  K E++  LQ      V F GDG ND   L  +D+G++LS
Sbjct: 745  NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS 794

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 129/334 (38%), Gaps = 77/334 (23%)

Query: 499 YVFQVFSIILW-----GIDEYYYYAACIFLISVLSI----FDSLNEQKKVSRNLAEMSHF 549
           Y+F +FSII       G +E       +F  SV+ I    F  L E K  ++  + +S  
Sbjct: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKL 350

Query: 550 ----HCDVRVLRDKFWTTISSSE-------LVPGDIYEVSDPNITILPCDSILLSSDCIV 598
                    +L+DK    I SS        L   DI E+  P + I P D I++  +  +
Sbjct: 351 IQLTPSKCIILQDK--NNIQSSHIEIETNLLQRNDIIEIK-PGMKI-PADGIIIQGESEI 406

Query: 599 NESMLTGESVPVSKFPATEETMYQL-------------CDDFQSTQI-----SSFVSKSF 640
           +ES++TGES+ V K   ++     L              DD +  QI     S+ ++K+ 
Sbjct: 407 DESLMTGESILVHKQKGSQVIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAP 466

Query: 641 LYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVR-SMVFPKPTGFKFYRDSFKYIGF 699
           + N  + + +   P     L+++    + T    L +  ++F      KFY  SF+    
Sbjct: 467 IQNNADYLASIFVP-TILCLSIITFITWITLSNLLTKPPVIFTNNNNGKFYT-SFQ---- 520

Query: 700 MSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEK 759
              IAI    V+C     LGL                   A P  + +GT        + 
Sbjct: 521 ---IAISVIVVACP--CALGL-------------------ATPTAIMVGTGIG----AQH 552

Query: 760 GIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV 793
           G+       L     I  + FDKTGT+T   + V
Sbjct: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTV 586

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 1024 FIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGL 1069
            F+  +++L+ E  E +++L +  I   M +GDN L A +V  E G+
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI 1058

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 1167 EKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEA 1207
            EK + + +       +   GDG ND  A+ AADVGISL+  
Sbjct: 1072 EKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASG 1112

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,900,738
Number of extensions: 2049382
Number of successful extensions: 5503
Number of sequences better than 10.0: 87
Number of HSP's gapped: 5469
Number of HSP's successfully gapped: 172
Length of query: 1446
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1332
Effective length of database: 12,649,657
Effective search space: 16849343124
Effective search space used: 16849343124
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)