Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR289W25124813310.0
Kwal_26.91542322286812e-90
Sklu_2401.22242286638e-88
CAGL0M04763g2342236501e-85
Scas_692.462642266485e-85
AFR560W2292276361e-83
KLLA0D02464g2272315742e-74
KLLA0E22814g136351643.3
CAGL0K08316g32356624.8
KLLA0F11275g38581625.5
Scas_713.4132670627.0
KLLA0C08756g42734609.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR289W
         (248 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR289W (YOR289W) [5073] chr15 (853354..854109) Member of the DU...   517   0.0  
Kwal_26.9154                                                          266   2e-90
Sklu_2401.2 YOR289W, Contig c2401 1376-2050                           259   8e-88
CAGL0M04763g 513555..514259 similar to tr|Q12012 Saccharomyces c...   254   1e-85
Scas_692.46                                                           254   5e-85
AFR560W [3752] [Homologous to ScYOR289W - SH] complement(1436468...   249   1e-83
KLLA0D02464g complement(209705..210388) gi|5679592|emb|CAB51774....   225   2e-74
KLLA0E22814g 2023109..2027200 similar to sp|P47104 Saccharomyces...    29   3.3  
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    28   4.8  
KLLA0F11275g 1038770..1039927 weakly similar to sgd|S0005768 Sac...    28   5.5  
Scas_713.4                                                             28   7.0  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    28   9.3  

>YOR289W (YOR289W) [5073] chr15 (853354..854109) Member of the DUF51
           family of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5986p [756 bp, 251 aa]
          Length = 251

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%)

Query: 1   MALRLFRKSSFFAKISMEGPKGSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFK 60
           MALRLFRKSSFFAKISMEGPKGSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFK
Sbjct: 1   MALRLFRKSSFFAKISMEGPKGSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFK 60

Query: 61  IDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDR 120
           IDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDR
Sbjct: 61  IDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDR 120

Query: 121 RFSPIQKRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTC 180
           RFSPIQKRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTC
Sbjct: 121 RFSPIQKRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTC 180

Query: 181 SATFLPDVMPEQHWNKEDTFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYE 240
           SATFLPDVMPEQHWNKEDTFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYE
Sbjct: 181 SATFLPDVMPEQHWNKEDTFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYE 240

Query: 241 EFNKQLKD 248
           EFNKQLKD
Sbjct: 241 EFNKQLKD 248

>Kwal_26.9154
          Length = 232

 Score =  266 bits (681), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 168/228 (73%), Gaps = 12/228 (5%)

Query: 22  GSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKID---YNEKTSLFITWKKKSN 78
           GSSPFAFYAFYQLY+HL+    + L  ED++  L+P+ +I+    +EKTSLFITWKKKS 
Sbjct: 6   GSSPFAFYAFYQLYAHLHGEDGAELRFEDVQE-LFPEQRIESQELSEKTSLFITWKKKSG 64

Query: 79  KHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCN 138
              T       Y LRGCIGTFAK+P+  GI++YSLIAALED RFSPI+K EL  L+CSCN
Sbjct: 65  SRTT-------YELRGCIGTFAKLPLLKGIQQYSLIAALEDHRFSPIKKSELASLRCSCN 117

Query: 139 ILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKED 198
           IL NF+TI+  GG+  GD +DW++G HGIEL F+  ++    SATFLP+V+PEQ W+K +
Sbjct: 118 ILHNFRTIY-SGGDSAGDAYDWKIGVHGIELKFRDARSNRLLSATFLPEVIPEQGWDKRE 176

Query: 199 TFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQL 246
           TF NLI+KAG W N   ++DN+  YF+EVIRYEG KS I+Y+EF + L
Sbjct: 177 TFRNLIQKAGCWENADAILDNWAQYFVEVIRYEGSKSEISYKEFARLL 224

>Sklu_2401.2 YOR289W, Contig c2401 1376-2050
          Length = 224

 Score =  259 bits (663), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 132/228 (57%), Positives = 162/228 (71%), Gaps = 14/228 (6%)

Query: 23  SSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDYN---EKTSLFITWKKKSNK 79
           SSPFA YAFYQLY+H    ++ +L+ + I   L+P + +  +   E TSLFITWKKK + 
Sbjct: 7   SSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITWKKKDSS 66

Query: 80  HHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNI 139
                    +YILRGCIGTFAK+P+  GIEKYSL++AL+D RF PI   EL  LK SCNI
Sbjct: 67  G--------DYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNI 118

Query: 140 LGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDT 199
           L +FKTIF    +  GDIFDW++G HGIEL FKHPKT   CSATFLP+VMPEQ W+KEDT
Sbjct: 119 LHDFKTIF---NDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDT 175

Query: 200 FANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQLK 247
           F NLIEKAG W +I  +M+N+E YF+EVIRY+G KS I Y EF   L+
Sbjct: 176 FQNLIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLE 223

>CAGL0M04763g 513555..514259 similar to tr|Q12012 Saccharomyces
           cerevisiae YOR289w, hypothetical start
          Length = 234

 Score =  254 bits (650), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 167/223 (74%), Gaps = 4/223 (1%)

Query: 21  KGSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDYNEKTSLFITWKKKSNKH 80
           K +  +AFYAF QLY H+   +    SL  +   LY D  +   E TSLFITWK+  ++ 
Sbjct: 4   KNNELYAFYAFLQLYKHMGHVQRD-YSLRQVAEALY-DTTLIIKEDTSLFITWKRLDSQK 61

Query: 81  HTIDTNEEN-YILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNI 139
            +ID+++++ Y LRGCIGTFAK+PI  GI++YSLIAALED RF+PI +REL  LKCSCNI
Sbjct: 62  TSIDSDDDDGYALRGCIGTFAKLPIEAGIQRYSLIAALEDSRFTPISERELKTLKCSCNI 121

Query: 140 LGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDT 199
           L +F+ I+   G+ +GDI +WE+GK+GIEL FKHPK+G TCSATFLPDVM EQ W+K++T
Sbjct: 122 LRHFEKIY-SSGDDHGDIDNWEIGKNGIELLFKHPKSGKTCSATFLPDVMVEQGWDKKET 180

Query: 200 FANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEF 242
           F NLI+KAG W    ++++++E YF+EVI+YEGKKS ITY+ F
Sbjct: 181 FLNLIQKAGCWNEAGQILNDYEKYFLEVIKYEGKKSEITYDAF 223

>Scas_692.46
          Length = 264

 Score =  254 bits (648), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 167/226 (73%), Gaps = 6/226 (2%)

Query: 22  GSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDYNEKTSLFITWKKKSNKHH 81
            SSP+AFYAFY+LY +L    +   +L  +   LYPDFK++    TSLFITWKK++ K+ 
Sbjct: 39  ASSPYAFYAFYELYKYLGL-TAKRHTLNQVGEILYPDFKLNPKLITSLFITWKKQTKKYL 97

Query: 82  TIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNILG 141
               +++ YILRGCIGTFAKMPI  GIE++S+IAA ED RF P+ + E+  LKC CNIL 
Sbjct: 98  QF-ADDDGYILRGCIGTFAKMPIDKGIERFSIIAATEDNRFPPVGEEEISKLKCCCNILQ 156

Query: 142 NFKTIF-RGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDTF 200
           NF+TIF + G +  GDIF+WELG HGIEL FK+       S+TFLP+VM EQ W+KEDTF
Sbjct: 157 NFETIFSKNGDDKEGDIFNWELGVHGIELKFKYKGIH---SSTFLPEVMIEQDWDKEDTF 213

Query: 201 ANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQL 246
            NLIEKAG   +++E+MDN+E YFIEVIRYEG+KS+I+Y+ F K+L
Sbjct: 214 RNLIEKAGCERHVTEIMDNYEEYFIEVIRYEGRKSAISYKTFKKEL 259

>AFR560W [3752] [Homologous to ScYOR289W - SH]
           complement(1436468..1437157) [690 bp, 229 aa]
          Length = 229

 Score =  249 bits (636), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 122/227 (53%), Positives = 163/227 (71%), Gaps = 15/227 (6%)

Query: 24  SPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDY---NEKTSLFITWKKKSNKH 80
           SPF+FYAFYQLY++ +   + +++   ++ +LY  + +     NE +S+FITWKK   + 
Sbjct: 10  SPFSFYAFYQLYAYFHK-DAPTVTFGAVKNKLYHHYPMAAGRENEHSSVFITWKKHDER- 67

Query: 81  HTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNIL 140
                    Y LRGCIGTFAK+P+  GIEKYSLIAAL+D RF PI+  EL  LKCSCN+L
Sbjct: 68  -------GEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNVL 120

Query: 141 GNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDTF 200
            +FKT+F  G    G+I+DW++G+HG+ L F+HP TG TCSATFLP+VM EQ W++ +TF
Sbjct: 121 SHFKTVFEEGA---GNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETF 177

Query: 201 ANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQLK 247
            NLIEKAG W ++ E+MDN++ YFIEVI Y G KS ITY++F KQLK
Sbjct: 178 ENLIEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLK 224

>KLLA0D02464g complement(209705..210388) gi|5679592|emb|CAB51774.1
           Kluyveromyces lactis hypothetical protein, start by
           similarity
          Length = 227

 Score =  225 bits (574), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 115/231 (49%), Positives = 155/231 (67%), Gaps = 23/231 (9%)

Query: 23  SSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLY------PDFKIDYNEKTSLFITWKKK 76
           SSP+AFYAFYQLYS     +   ++LE +   LY      P+F      ++ LF+TWKK 
Sbjct: 6   SSPYAFYAFYQLYSQFY--RVPKITLETVNDFLYQGKGLKPEFA-----RSPLFVTWKK- 57

Query: 77  SNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCS 136
                     +  Y LRGCIGTF++  I  G+++Y+LI+AL+D RF+PI++ EL  L+C 
Sbjct: 58  --------LKKGEYQLRGCIGTFSEGKIEEGLKRYALISALQDSRFTPIEREELSQLRCG 109

Query: 137 CNILGNFKTIFRGGGNPN-GDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWN 195
           CN+L  FKTI+   G  N GDI++WE+GKHGIE+ F+HPKT +  SATFLP+V+PEQ W+
Sbjct: 110 CNLLSQFKTIYSSEGTGNSGDIWNWEIGKHGIEIKFRHPKTNSRMSATFLPEVIPEQGWD 169

Query: 196 KEDTFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQL 246
           + +TF NLIEKAG W  + EVM ++E YF EVIRYEG KS I ++EF   L
Sbjct: 170 QRETFENLIEKAGCWNYLEEVMKHWEKYFDEVIRYEGTKSEIAWDEFETGL 220

>KLLA0E22814g 2023109..2027200 similar to sp|P47104 Saccharomyces
           cerevisiae YJR033c RAV1 singleton, start by similarity
          Length = 1363

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 166 GIELYFKHPKTGTTCSATFLPDVMPEQHW-NKEDTFANLIEKAGYWGNISE 215
           G++LY  H  T T+ +   + DV    H  NKE  F+NL  +   W N+ E
Sbjct: 885 GVKLYTSHKSTQTSVN---MRDVSWATHSDNKEILFSNLFNRLKKWDNVKE 932

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 66  KTSLFITWKKKSNKHHTIDTNEENYI--LRGCIGTFAKMPI--AHGIEKYSLIAAL 117
           KTSL I++ +K  KH  I T  ENY+  ++G  G   ++ +    G E+YS +  L
Sbjct: 96  KTSLLISYVEKVFKHENIPTIFENYVTNIQGPKGQIIELALWDTAGQEEYSRLRPL 151

>KLLA0F11275g 1038770..1039927 weakly similar to sgd|S0005768
           Saccharomyces cerevisiae YOR242c SSP2, start by
           similarity
          Length = 385

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 20  PKGSSPFAFYAFYQLYS----HLNPG-------KSSSLSLEDIRRRLYPDFKIDYNEKTS 68
           P  ++ F  YA + L+     HL P         SS  SL DI++ ++PDF  D     S
Sbjct: 218 PDDAAQFMKYARFHLFKVNGVHLVPHWGVIDSLDSSEKSLLDIQQYVHPDFCKDIQNFDS 277

Query: 69  L----FITWKKKSNKHHTIDT 85
                 +  KK S KH +I T
Sbjct: 278 TGARRCLIMKKYSRKHKSIST 298

>Scas_713.4
          Length = 1326

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 9/70 (12%)

Query: 56  YPDFKIDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIA 115
           +PD  + YNE+T   +        HH++  N+   +  G I TF +M +    E Y  + 
Sbjct: 162 FPD--VQYNERTLAILI-------HHSLKNNQGTRVAAGQINTFIRMSLNGTREIYKNLD 212

Query: 116 ALEDRRFSPI 125
            L  + F  +
Sbjct: 213 VLPLKDFEKL 222

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 27.7 bits (60), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 61  IDYNEKTSLFITWKKKSNKHHTIDTNEENYILRG 94
           +D NE      +W+ K N  H+ D+N    +LRG
Sbjct: 316 VDENELKRRLSSWEAKHNTDHSSDSNSITNLLRG 349

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,013,892
Number of extensions: 418612
Number of successful extensions: 1025
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1006
Number of HSP's successfully gapped: 17
Length of query: 248
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 149
Effective length of database: 13,168,927
Effective search space: 1962170123
Effective search space used: 1962170123
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)