Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR227W1246122456440.0
Scas_640.21119991723090.0
Scas_700.38123992421370.0
YPL137C127695121140.0
CAGL0J04026g1198107720430.0
Kwal_26.8687108892520240.0
CAGL0M02607g120492419520.0
KLLA0D07216g127898318450.0
ACR113W110292717880.0
CAGL0J00803g13145376408e-68
Kwal_23.548811126106262e-66
Scas_690.3314235786096e-64
KLLA0E11847g12645225774e-60
YJL042W (MHP1)13985025703e-59
ACR059W12165214651e-46
AGR323C40244760.75
KLLA0F04818g49398741.5
Kwal_26.820650666687.8
YAL043C (PTA1)78586687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR227W
         (1224 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...  2178   0.0  
Scas_640.21                                                           894   0.0  
Scas_700.38                                                           827   0.0  
YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protei...   818   0.0  
CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...   791   0.0  
Kwal_26.8687                                                          784   0.0  
CAGL0M02607g complement(298560..302174) similar to tr|Q03016 Sac...   756   0.0  
KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058 Sacch...   715   0.0  
ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH] co...   693   0.0  
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...   251   8e-68
Kwal_23.5488                                                          245   2e-66
Scas_690.33                                                           239   6e-64
KLLA0E11847g complement(1044591..1048385) some similarities with...   226   4e-60
YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interac...   224   3e-59
ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH] complement(...   183   1e-46
AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...    34   0.75 
KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces c...    33   1.5  
Kwal_26.8206                                                           31   7.8  
YAL043C (PTA1) [24] chr1 complement(58698..61055) Component of p...    31   7.9  

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
            function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score = 2178 bits (5644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1091/1224 (89%), Positives = 1091/1224 (89%)

Query: 1    MSSKLKYTDIDVPLDWLYKGKXXXXXXXXXXXXXXXXXXXXVKKTATLPSTAAVPTKTIA 60
            MSSKLKYTDIDVPLDWLYKGK                    VKKTATLPSTAAVPTKTIA
Sbjct: 1    MSSKLKYTDIDVPLDWLYKGKRRNRTKSAASTRTSEATTTSVKKTATLPSTAAVPTKTIA 60

Query: 61   SPQRPLSGQNVNNELSNSKPAVSAEKVSQQGQVPTRRTRSHSVSYGLLQKKNNNDDTTDS 120
            SPQRPLSGQNVNNELSNSKPAVSAEKVSQQGQVPTRRTRSHSVSYGLLQKKNNNDDTTDS
Sbjct: 61   SPQRPLSGQNVNNELSNSKPAVSAEKVSQQGQVPTRRTRSHSVSYGLLQKKNNNDDTTDS 120

Query: 121  PKISRIRTAQDQPVKETKSSTLAEPIVXXXXXXXXXXXXXXXXXXXKKSLFGSLFGRRPS 180
            PKISRIRTAQDQPVKETKSSTLAEPIV                   KKSLFGSLFGRRPS
Sbjct: 121  PKISRIRTAQDQPVKETKSSTLAEPIVSKKGRSRSSSISTSLNERSKKSLFGSLFGRRPS 180

Query: 181  TTPSHVVERPLSSQNDHKKSTELPPIDTRQXXXXXXXXXXXXXXXXXXXXGGNRHSDGSL 240
            TTPSHVVERPLSSQNDHKKSTELPPIDTRQ                    GGNRHSDGSL
Sbjct: 181  TTPSHVVERPLSSQNDHKKSTELPPIDTRQSKISTPTSTPTTASSKPSSSGGNRHSDGSL 240

Query: 241  TSKLLSIPHNILETSSTNFNAHHHIQSHHSSGREQDSPHSESSDLPPILEKETTQKQLQK 300
            TSKLLSIPHNILETSSTNFNAHHHIQSHHSSGREQDSPHSESSDLPPILEKETTQKQLQK
Sbjct: 241  TSKLLSIPHNILETSSTNFNAHHHIQSHHSSGREQDSPHSESSDLPPILEKETTQKQLQK 300

Query: 301  VSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXXXXX 360
            VSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITN       
Sbjct: 301  VSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNSSDQSSF 360

Query: 361  XXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKARQLKTSPL 420
                     KDSKEYKL                   YYVAERMAQEVANYKARQLKTSPL
Sbjct: 361  QSNISPSYSKDSKEYKLALENFKKAAKEAEKHQKDAYYVAERMAQEVANYKARQLKTSPL 420

Query: 421  TGATNSAADSATDQESSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSHLEQTLDVA 480
            TGATNSAADSATDQESSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSHLEQTLDVA
Sbjct: 421  TGATNSAADSATDQESSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSHLEQTLDVA 480

Query: 481  YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFD 540
            YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFD
Sbjct: 481  YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFD 540

Query: 541  NVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDISQTKA 600
            NVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDISQTKA
Sbjct: 541  NVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDISQTKA 600

Query: 601  RTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNP 660
            RTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNP
Sbjct: 601  RTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNP 660

Query: 661  KNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARLPYKHLE 720
            KNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARLPYKHLE
Sbjct: 661  KNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARLPYKHLE 720

Query: 721  YFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRI 780
            YFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRI
Sbjct: 721  YFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRI 780

Query: 781  HFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXXXXXXXXXXXXXXXXQI 840
            HFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKI                QI
Sbjct: 781  HFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKISDSTDEPDKSKDEKKEQI 840

Query: 841  VFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDEL 900
            VFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDEL
Sbjct: 841  VFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDEL 900

Query: 901  TVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDS 960
            TVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDS
Sbjct: 901  TVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDS 960

Query: 961  MFEKRKSGEXXXXXXXXXXXXXXXXXXXXXXXDIFASMPNIADVVPFSKADNSFPNIGDS 1020
            MFEKRKSGE                       DIFASMPNIADVVPFSKADNSFPNIGDS
Sbjct: 961  MFEKRKSGELPLQEKENLLRLLLLEKNLSNILDIFASMPNIADVVPFSKADNSFPNIGDS 1020

Query: 1021 TVSANYNDGIRPSLKHLDSDRLINDVSIPENDSSIRPHLMATDSGRIIDVTTGKALLFKS 1080
            TVSANYNDGIRPSLKHLDSDRLINDVSIPENDSSIRPHLMATDSGRIIDVTTGKALLFKS
Sbjct: 1021 TVSANYNDGIRPSLKHLDSDRLINDVSIPENDSSIRPHLMATDSGRIIDVTTGKALLFKS 1080

Query: 1081 SSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSANSSRISGSLTPDSSVAGGKK 1140
            SSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSANSSRISGSLTPDSSVAGGKK
Sbjct: 1081 SSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSANSSRISGSLTPDSSVAGGKK 1140

Query: 1141 GESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKNVTSEKVGLESLYGDELNS 1200
            GESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKNVTSEKVGLESLYGDELNS
Sbjct: 1141 GESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKNVTSEKVGLESLYGDELNS 1200

Query: 1201 RSPSNDSLQESQQKAPLQRPLVED 1224
            RSPSNDSLQESQQKAPLQRPLVED
Sbjct: 1201 RSPSNDSLQESQQKAPLQRPLVED 1224

>Scas_640.21
          Length = 1199

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/917 (51%), Positives = 629/917 (68%), Gaps = 32/917 (3%)

Query: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXX 357
            L  +S ++L+RV  +V +F  DPPQQLPSRKPK G+VLIP DMIS  P IS+GIT     
Sbjct: 246  LNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNN 305

Query: 358  XXXXXXXXX--XXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEV---ANYKA 412
                          KDSKEYK+                      AER+A+EV   + ++A
Sbjct: 306  SGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRA 365

Query: 413  RQLKTSPLTGATNSAADSATDQESSSLD----ARASKLHIDKPINVGAHPFETHQDDNIK 468
              L +S     +N++++  + Q S+ LD     +A  L IDKPI++  + F    DD   
Sbjct: 366  NSLTSSLTKTTSNTSSNPLSKQNSNELDTKVDVKAKTLSIDKPIHMHQNNF---GDD--- 419

Query: 469  YSSHL--EQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFC 526
            +S+H   E TLDV YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP+PTL+DILSFC
Sbjct: 420  FSTHNTNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFC 479

Query: 527  DFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQ 586
            DFI+I PIH I+FDNV+LT +MF+IV+ S+V S V+EKLGLRNV I+E+ WK+ CKFL+ 
Sbjct: 480  DFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLID 539

Query: 587  NKTLIKLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFS 646
            NK+LIKLDISQTK R + + S YR+ MDW LFC+VL+ R+G+PLEELLLNG++F+++   
Sbjct: 540  NKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLG 599

Query: 647  HFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKR 706
             F+++L  FA+MNPK  +RLG+A  + S  C   LF WMS+Y+V+GVDLA+NNL  L K 
Sbjct: 600  IFQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKP 659

Query: 707  MIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTS 766
            +I+ L+ L +KHL+YFTLNSTNI+SVDDM+ ++KYLS+LP+++FLDLSNLPQLFP I+  
Sbjct: 660  IIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPD 719

Query: 767  GYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXXXX 826
             +KY PQFP LKRI+F+ +DL+ +E +M+ +IL KC+ +SHVSL+ Q P    S +    
Sbjct: 720  LHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHP---PSTLENEN 776

Query: 827  XXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHN 886
                        + +F R+TLWA+LY+  R S NLVSLD+DYD++ +E++SRIALCLM N
Sbjct: 777  HIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRN 836

Query: 887  MKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEK 946
            M+R MDSSF+LDE  +QD+L+FDGSLI+ETA+ VL +LND+S    D  +KYLLKKY EK
Sbjct: 837  MQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRKYLLKKYLEK 896

Query: 947  MEKVHHNVQNTIDSMFEKRKSGEXXXXXXXXXXXXXXXXXXXXXXXDIFASMPNIADVVP 1006
            +E +H++VQ TIDSMFEKRKSGE                       +IF+ +P ++DV  
Sbjct: 897  LENLHNSVQQTIDSMFEKRKSGELPLEEKENLVRLLLLEKNLSNILEIFSKIPFLSDV-- 954

Query: 1007 FSKADNSFPNIGDSTVSANYNDGI---RPSLKHLDSDRLINDVSIPENDSSIRPHLMATD 1063
            F+    S P I  +  +A  +D +   RP LKHLDS RL++   +P ++++  PH+MAT+
Sbjct: 955  FNSTLASSP-IQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIMATE 1013

Query: 1064 SGRIIDVTTGKALLFKSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNS--GLPSSAN 1121
            +G +ID  TGK +L KSSSNTSL  K+QEEEEGELHKWGVFVQ +  + N+  G  SS+N
Sbjct: 1014 AGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENAVPGSESSSN 1073

Query: 1122 SSR--ISGSLTPDSSVAGGKKGESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDL 1179
             S+  IS   +P    +        +T+   PKILPKIP+G +LR+AII AKGI S+DDL
Sbjct: 1074 LSKESISSQASPTHRSSPTSLQLEDKTAT--PKILPKIPSGPQLREAIINAKGIASIDDL 1131

Query: 1180 IKNVTSEKVGLESLYGD 1196
            I+NV  ++V +ES+ GD
Sbjct: 1132 IQNVNEKRVEVESINGD 1148

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/14 (92%), Positives = 14/14 (100%)

Query: 8  TDIDVPLDWLYKGK 21
          +DIDVPLDWLYKGK
Sbjct: 27 SDIDVPLDWLYKGK 40

>Scas_700.38
          Length = 1239

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/924 (49%), Positives = 600/924 (64%), Gaps = 57/924 (6%)

Query: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXX 357
            +QK+S + LKRVT AV +F +DP QQLPSR PK+GNVL+P+DMIS  P IS+GI+     
Sbjct: 258  IQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGIS----A 313

Query: 358  XXXXXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKA---RQ 414
                        K+SKEY+L                   ++ A+R+A EVAN+KA    Q
Sbjct: 314  NTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQ 373

Query: 415  LKTSPLTG-ATNSAADSATDQESSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSHL 473
              + P+T   + +AADS  +++ +         +IDKPI+V  H FE       +  S  
Sbjct: 374  KSSIPVTLLPSTTAADSELNEKIN---------NIDKPIHVHEHHFE-------QEISTG 417

Query: 474  EQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITP 533
            E TLD+ YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTL+DILSFCDFI+I P
Sbjct: 418  EVTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVP 477

Query: 534  IHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKL 593
            I+ IIFDNVSLT +MFKI+I S+V S V+EKLGLRNV+I++++WKLLCKF+L NK+++KL
Sbjct: 478  INTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKL 537

Query: 594  DISQTKARTDLND--SNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNI 651
            DISQTK RT+ ND  + YR  MDWELF  VL+ R G+PLEE+LLNG++F+ +    FK++
Sbjct: 538  DISQTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDL 597

Query: 652  LLTF-AQMNPKN-PIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIK 709
            L +  +Q N  +  IR+G+A  + S +C   + NW+S  NVQGVDL++N+L +  K ++ 
Sbjct: 598  LHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVG 657

Query: 710  KLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYK 769
            KL+ L + +LEYFTLN+TNI+S  D++ ILKYL +LP++KFLDLSNLPQ++P +L   YK
Sbjct: 658  KLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYK 717

Query: 770  YFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXXXXXXX 829
            Y P+FPQLKRIHFD ++LS KE T++ +IL KC +L+HVS++ Q   P A+         
Sbjct: 718  YLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAA-----ASDS 772

Query: 830  XXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKR 889
                     Q  F RN LWA+LYA  +DS NLV LD+DYD++P+EIQ RIALCLM NM R
Sbjct: 773  STNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNR 832

Query: 890  IMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLN------DKSLLQNDVGKKYLLKKY 943
             MDS+F+LDEL  QDDL+FDG+LITETAE+VL +LN        S  + DV K+YLLKKY
Sbjct: 833  AMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTKRYLLKKY 892

Query: 944  FEKMEKVHHNVQNTIDSMFEKRKSGEXXXXXXXXXXXXXXXXXXXXXXXDIFASMPNIAD 1003
             EK+ +VH N Q+ ID MFEKR SGE                       +I  ++P ++ 
Sbjct: 893  LEKLHRVHFNTQHKIDCMFEKRNSGELTLQEKENLLRLLLLEKNLSNLMEILGALPQVSS 952

Query: 1004 VVPFSKADNSFPNIGDSTVSANYNDGI------RPSLKHLDSDRLINDVSIPENDSSIRP 1057
            V+  +K D+  P    S   +    G          LKH++S   I  V  PE     RP
Sbjct: 953  VLGSNKEDSMQPVYQQSQEGSTVTSGTSSESVSSVVLKHVESVEPI--VVPPET----RP 1006

Query: 1058 HLMATDSGRIIDVTTGKALLF-KSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGL 1116
            HLMATDSGR +DV TGK +LF + SS+TS+ GK+Q EEEGELHKWG FVQ Q S +    
Sbjct: 1007 HLMATDSGRTVDVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENE 1066

Query: 1117 PSSANSS-----RISGSLTPDSSVAGGKKGESSRTSGTRPKILPKIPTGAELRDAIIKAK 1171
             + +  +       + +    S+ +      +  TS T   I+PKIP+G ELR AIIKAK
Sbjct: 1067 VTKSKETVNPPTPTTPTTASTSTTSTATHTPTPTTSKTPIIIVPKIPSGTELRKAIIKAK 1126

Query: 1172 GIDSVDDLIKNVTSEKVGLESLYG 1195
            GIDS+DDLI+NV  ++  L ++YG
Sbjct: 1127 GIDSIDDLIQNVNQDEDELINIYG 1150

>YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protein of
            unknown function, has low similarity to a region of S.
            cerevisiae Mhp1p, which is a microtubule-interacting
            protein that functions in stabilization of microtubules
            [3831 bp, 1276 aa]
          Length = 1276

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/951 (48%), Positives = 601/951 (63%), Gaps = 59/951 (6%)

Query: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGIT--NXX 355
            ++ +S V+LKRV+ AV +F SDPPQQLPSR PK+GN+LIP+DMIS  P IS+GI+  N  
Sbjct: 274  VKDLSTVSLKRVSFAVDKFESDPPQQLPSRTPKKGNILIPDDMISEVPSISVGISSSNQS 333

Query: 356  XXXXXXXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKARQL 415
                          K SKEY L                   ++ A R+A EVAN+K    
Sbjct: 334  AKSTNSNIKGPLYTKKSKEYILALENQKLALREAAKHQQEAHFAANRIAFEVANFKTASD 393

Query: 416  KTSPLTGATNSAADSATDQESSSLDARA-------------SKLHIDKPINVGAHPFETH 462
                LT  ++    +   +E S  +  A             SK  IDKPI++  H F+  
Sbjct: 394  AGGKLTEKSSEGTITKQREEVSPPNVEADRELENNKLAENLSKAGIDKPIHMHEHYFKEP 453

Query: 463  QDDNIKYSSHLEQ---TLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTL 519
              D  +    +E    TLDV YTRCCHLREILPIPSTLRQVK KTAPLQ LKFLNPKPTL
Sbjct: 454  DQDKYQDGHSIENNEVTLDVIYTRCCHLREILPIPSTLRQVKDKTAPLQILKFLNPKPTL 513

Query: 520  VDILSFCDFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKL 579
            +DILSFCDFI I PIH I+FDNV+L  DMF+I+I +LV S V++KL LRNV I++  WKL
Sbjct: 514  IDILSFCDFITIAPIHTIVFDNVALNQDMFRIIISALVNSTVLDKLSLRNVRIDQDGWKL 573

Query: 580  LCKFLLQNKTLIKLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLR 639
            LCKFLL NK+L KLDISQTK ++DL +S YR  MDW LF +VL  R  +P+EELL NG++
Sbjct: 574  LCKFLLLNKSLNKLDISQTKIKSDLAESLYRHNMDWNLFTDVLSQRSHKPIEELLFNGIQ 633

Query: 640  FDKMSFSHFKNILLTFA-QMN-PKNPIRLGMANV---EFSTECFDFLFNWMSEYNVQGVD 694
            F K+ +S F  +L +FA Q N P++ IRLG+A       S +C  F+FNWMS+YNVQGVD
Sbjct: 634  FSKIPYSCFARLLTSFATQKNFPESGIRLGLAGATTSNISQDCLKFIFNWMSQYNVQGVD 693

Query: 695  LAYNNLESLAKRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLS 754
            LA+N+L ++ K M+ KL+ L Y +L YF LNSTNI++  D++ +LKYLS+LP++ FLDLS
Sbjct: 694  LAFNDLSTMIKPMVGKLSALSYDNLRYFILNSTNISTSYDLALLLKYLSKLPNLIFLDLS 753

Query: 755  NLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQS 814
            NL Q FP IL   YKY P+FP LKRIH D ++L++KE  ++ +IL KC++LSHVS+  Q+
Sbjct: 754  NLSQCFPDILPYMYKYLPRFPNLKRIHLDSNNLTLKELAVVCNILIKCKSLSHVSMTNQN 813

Query: 815  PM-------PDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVD 867
                      D+                   +  F +N+  ++LYAF RDS NL+ LD D
Sbjct: 814  VENFYLMNGTDSPVQQTNTDGDLDSSSTLDVKGQFAKNSFSSTLYAFARDSPNLIGLDFD 873

Query: 868  YDQVPDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLN-- 925
            YD + +EIQSRIALCLM NMKR MDS+F+LDEL  QDDL+FDGSL+T TAE VL++LN  
Sbjct: 874  YDLISEEIQSRIALCLMRNMKRTMDSTFQLDELDSQDDLLFDGSLVTMTAESVLEKLNLL 933

Query: 926  -DKSL-LQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGEXXXXXXXXXXXXXX 983
             DKS  ++ D  K+YLLKKY EK   +HHNVQ+TID+MFEKRKSGE              
Sbjct: 934  SDKSTKVKKDTTKRYLLKKYIEKFHILHHNVQHTIDTMFEKRKSGELPLQEKENLVRLLL 993

Query: 984  XXXXXXXXXDIFASMPNIADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKHLDSDRLI 1043
                     ++F+  PN+ DV+  S+ D+S  ++  S       D   P+LKH++S   +
Sbjct: 994  LEQNLCNILELFSHNPNLNDVLGSSR-DDSKESVDSS------EDSKLPALKHVESGYHV 1046

Query: 1044 NDVSI-PENDS-SIRPHLMATDSGRIIDVTTGKALLFK-SSSNTSLAGKRQEEEEGELHK 1100
             +  I PEND  + RPHLMATDSG+ IDV TGK L+FK +SS+TS+  K+QEEEEGELHK
Sbjct: 1047 PEEKIQPENDVITARPHLMATDSGKTIDVFTGKPLVFKHTSSSTSVGCKKQEEEEGELHK 1106

Query: 1101 WGVFVQHQSSRHNSGLPSSANSSRISGSLTPDSSVAGGKK-------------GESSRTS 1147
            WG FVQ Q S +      S   +  +   TP ++   GK                +S  S
Sbjct: 1107 WGFFVQQQRSLYPEN--ESTRQTPFASGDTPINTETAGKSTSSPSVSTSNNETATTSLFS 1164

Query: 1148 GTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKNVTSEKVGLESLYGDEL 1198
               PKILPKIP+GA LR AI+KAKGIDS+DDLI+NV S  + LE++YG+ +
Sbjct: 1165 PANPKILPKIPSGAVLRSAIMKAKGIDSIDDLIQNVNSNNIELENIYGESI 1215

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 13/14 (92%)

Query: 8  TDIDVPLDWLYKGK 21
          T+ DVP+DWLYKGK
Sbjct: 5  TEFDVPVDWLYKGK 18

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
            Saccharomyces cerevisiae YOR227w or tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1077 (42%), Positives = 622/1077 (57%), Gaps = 87/1077 (8%)

Query: 167  KKSLFGSLFGRRPSTT----PSHVVERPLSSQNDHKKSTELP--PIDTRQXXXXXXXXXX 220
            KKS+FGSLFG++  +T    P    + P+S +     ++     PI+             
Sbjct: 105  KKSIFGSLFGKKSDSTDKKPPQSSAKSPVSVKTSTSSASPTASVPINI------------ 152

Query: 221  XXXXXXXXXXGGNRHSDGSLTSKLLSIPHNILETSSTNFNAHHHIQSHHSSGREQDSPHS 280
                        NR    S   K  S P  +     +N  +H    S  S     D P  
Sbjct: 153  ----------NVNREKPKSHEPKSPSSPLRLFHFGQSNSESHAAPISRGSPSPSMD-PLD 201

Query: 281  ESSDLPPILEKETTQKQ------LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNV 334
            E  +          Q Q      ++K++K++LKRV+ A+ +F+ +P QQLPSRKPK G++
Sbjct: 202  ERIESSKHHHSHHDQGQSRDKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDI 261

Query: 335  LIPEDMISAPPLISLGITNXXXXXXXXXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXX 394
            ++PEDMIS  P IS+GIT                 KDS+EYK+                 
Sbjct: 262  VVPEDMISEEPKISVGITT-TSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQL 320

Query: 395  XXYYVAERMAQEVANYKAR--QLKTSPLTGATNSAADSATDQESS--------SLDARAS 444
              + VAER+A EV  Y+ R   L  +      N     ++  E+S        +LD+R +
Sbjct: 321  EAHRVAERIANEVTGYRIRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVA 380

Query: 445  KLHIDKPINVGAHPFETHQDDNIK---------YSSHLEQTLDVAYTRCCHLREILPIPS 495
            +L IDKPI+     FET   D+           +  H E  LDV YTRCCHLREILPIPS
Sbjct: 381  ELTIDKPIHAHETFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPS 440

Query: 496  TLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFDNVSLTHDMFKIVICS 555
            TLRQVKGKTAPLQTLKFLNPKPTL+DILSFCDFI+ITPI  ++FDNV+L  DM +IV+ S
Sbjct: 441  TLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSS 500

Query: 556  LVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDISQTKARTDLNDSNYRDQMDW 615
            L+ S  +EKLG+RNVV++ + W++LCKFLL NK++I+LD+SQTK + DL    YR  M+W
Sbjct: 501  LINSKSIEKLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNW 560

Query: 616  ELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNPKNPIRLGMANVEFST 675
            +LFC VLR R GRPLEELLLNG+ FD+MSF  ++++LLTFA  N     RLGMA   FS 
Sbjct: 561  KLFCNVLRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSE 620

Query: 676  ECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARLPYKHLEYFTLNSTNITSVDDM 735
            +C  FLF+ +S+++VQGVDL +N LE     +I KL+ LPY +LEYFTLNS++ +   ++
Sbjct: 621  KCMSFLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNI 680

Query: 736  SYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTML 795
              +LKYLSRLP+++FLD+SN+P++FP +    YKY P FP L+RIHFD + L+ K+  ML
Sbjct: 681  GSLLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIML 740

Query: 796  VSILAKCETLSHVSLIGQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFV 855
              IL KC  L+HVS+  +   P+A K                    F   TL A+LY F 
Sbjct: 741  CEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKE-----FAARTLGATLYGFC 795

Query: 856  RDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITE 915
            RD   L+ LDVDY  + DEIQSRIA+ LM NMK+ +DS+F  DE+T QDDL+FDG +I+E
Sbjct: 796  RDRSTLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISE 855

Query: 916  TAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGEXXXXXX 975
             AE +L RL      Q+D  K YLLKK+ EK+E +H+ VQ  ID MFEKR++G       
Sbjct: 856  NAEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKEK 915

Query: 976  XXXXXXXXXXXXXXXXXDIFAS--------MPNIADVVPFSKADNSFPNIGDSTVSANYN 1027
                              +FAS         P    +   + AD+S  +  +   S N +
Sbjct: 916  ENLLRLVLLEKNLSNIMQLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNSTNTS 975

Query: 1028 DGIRPSLKHLDSDRLINDVS-----IPENDSSIRPHLMATDSGRIIDVTTGKALLFKSSS 1082
              IRP LKHLDSDR+    S      P+ D+S  PH MAT+SG+++D TTGKALL+K+SS
Sbjct: 976  H-IRPFLKHLDSDRIFGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGKALLYKTSS 1034

Query: 1083 NTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSANSSRISG-SLTPDSSVAGGKKG 1141
            +TSL  K+QE EEGE HKWG FV      H  G  +     + SG   TP+ S     + 
Sbjct: 1035 STSLLVKKQEHEEGEFHKWGFFV------HQKGTTNPDTDDKKSGPEKTPNVS-----EN 1083

Query: 1142 ESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKNVTSEKVGLESLYGDEL 1198
             ++    T PKI   +P+G ELR+AIIKAKGIDS++DLIK V+ +  GL+ +YG+ L
Sbjct: 1084 TNAPERVTVPKI-QTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESL 1139

>Kwal_26.8687
          Length = 1088

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/925 (45%), Positives = 581/925 (62%), Gaps = 77/925 (8%)

Query: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXX 357
            +Q ++K +L+RVT AV +F++DPPQQ+PSRKPKRGNVL+P+DM+   P IS+GITN    
Sbjct: 177  IQSLAKTSLRRVTFAVDKFSTDPPQQIPSRKPKRGNVLVPQDMMCPTPSISVGITNTQGN 236

Query: 358  XXXXXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKARQLKT 417
                        ++SKEYKL                   +Y A+R+A EV  +K R L  
Sbjct: 237  IEQSASPFD---ENSKEYKLALEEHRKALRESEKHQQEAHYAAQRIAHEVLKFKTRPLSG 293

Query: 418  SP--LTGA---TNSAADSATDQESSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSH 472
            +P  LT +   TN  + + +   ++++D RA  L IDKPI++  H F   QDD    + +
Sbjct: 294  APHQLTASSSNTNVESSAPSGTTNAAIDERAKNLEIDKPIHMHEHHF---QDDTSSSAEN 350

Query: 473  LEQ-TLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAI 531
             ++ TLD  YTRCCHLREILPIPSTL+QVKGK+APLQTLKFLNP+PTL+D+LSFCDFIAI
Sbjct: 351  GDKLTLDKIYTRCCHLREILPIPSTLKQVKGKSAPLQTLKFLNPRPTLIDVLSFCDFIAI 410

Query: 532  TPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLI 591
             PIHN++FDNVSLT +M K VI SLVTS V+EK+G RNVV N  +W LLCKFL++  +L+
Sbjct: 411  VPIHNVVFDNVSLTSEMLKNVISSLVTSKVIEKVGFRNVVFNSDTWILLCKFLMRTSSLL 470

Query: 592  KLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNI 651
            KLDISQTK + DL  + YR  MDW+LF +VL+ R GRPLEELL+NG++ +  SF  F ++
Sbjct: 471  KLDISQTKIKPDLEKNLYRANMDWDLFIDVLQRRSGRPLEELLINGVKIE--SFDSFVSL 528

Query: 652  LLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKL 711
            L TFA  + +N  RLG+A  E S +   FL +WMS++ +QGVD+A+N+   L + ++ KL
Sbjct: 529  LNTFAAGSTQNGKRLGIAQSELSADHLKFLMSWMSDFKIQGVDMAFNDFSELVRPLVGKL 588

Query: 712  ARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYF 771
            + LP++HL+YFTLN+TNI +  D + +L+ LSRLP++ FLDLSNLPQ+FP I     KY 
Sbjct: 589  SSLPFQHLQYFTLNNTNIPTAYDAALLLRALSRLPNLYFLDLSNLPQVFPEIFPYLNKYL 648

Query: 772  PQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXXXXXXXXX 831
            P+   LKR+H D ++ + +E  M+ S+L+KC  L H+SL+    +P  S           
Sbjct: 649  PRMANLKRLHLDSNEFTSREVVMITSVLSKCNELLHLSLMN---IPQES----------- 694

Query: 832  XXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIM 891
                           + A+LY  VR    L +LDV Y  +P+EI SRIA+CLM  M+R  
Sbjct: 695  -----------FTTGMCANLYDCVRQCSKLTNLDVTYAYIPEEISSRIAICLMRRMQR-- 741

Query: 892  DSSFKLDELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVH 951
               F+LD+LT QDDL+FDG+L++ETAE VL++LN+   L+ DV ++YLLKKY+EK  +VH
Sbjct: 742  --DFELDDLTNQDDLLFDGTLLSETAENVLEKLNNFEDLETDVTRRYLLKKYWEKFNRVH 799

Query: 952  HNVQNTIDSMFEKRKSGEXXXXXXXXXXXXXXXXXXXXXXXDIFASMPNIADVVPFSKAD 1011
             NVQ+TID MFEKR +GE                       D+  S P +ADV       
Sbjct: 800  DNVQSTIDQMFEKRSAGELNLQSKENLLRLLFLENNLSHILDVLKSYPQVADVA------ 853

Query: 1012 NSFPNIGDSTVSANYNDGIRPSLKHLDSDRLINDV-SIPENDSSIRPHLMATDSGRIIDV 1070
                             GI P+ +   SD L+  + S  EN+S +RPHLMATDSGR IDV
Sbjct: 854  -----------------GIEPNARSAGSDHLLKGITSEAENNSHVRPHLMATDSGRTIDV 896

Query: 1071 TTGKALLFKSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRH--------NSGLPSSANS 1122
            TTG  +L K+ S+ SL GKRQEEEEGE HKWG FVQ Q+S +        N   P     
Sbjct: 897  TTGTPVLVKTPSHVSLVGKRQEEEEGEFHKWGFFVQQQNSIYPDHHSRNTNDEPPEKRPG 956

Query: 1123 SRISGSLTPDSSVAGGKKGESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKN 1182
            S  S + +P SS        +S+ +     ++ KIP+GAELR+A+++AKGIDS+++LI+N
Sbjct: 957  SAASSTESPKSSQPSAISQTASQAAAH--ALISKIPSGAELREAVMRAKGIDSIEELIEN 1014

Query: 1183 VTSEKVGLESLYGDELNSRSPSNDS 1207
            V   +V L+++YG  L+   PS ++
Sbjct: 1015 VNGNRVTLDNIYGVPLHPMPPSTNN 1039

>CAGL0M02607g complement(298560..302174) similar to tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1204

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/924 (46%), Positives = 578/924 (62%), Gaps = 64/924 (6%)

Query: 301  VSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXXXXX 360
            ++K++LKRV  AV +F +DPPQQLPSR PK GN++IP+DMIS  P IS+GIT+       
Sbjct: 261  LTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNL 320

Query: 361  XXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKARQLKTSP- 419
                     KDS EYK                    ++ A R+A EV+N+   +  ++P 
Sbjct: 321  GPQFT----KDSIEYKRALEIHQIALKEAEKHQQEAHHAARRIAHEVSNFSNGKQASAPG 376

Query: 420  -LTGATNSAADSATDQESS--------SLDARASKLHIDKPINVGAHPFETHQDDNIKYS 470
             +      +  S  DQ S+         L  + +K  ID PI++  H F+   D      
Sbjct: 377  FMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFD---DPGSTLE 433

Query: 471  SHLEQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIA 530
             + E TLDV YTRCCHLREILPIPSTL+QV  KTAPLQTLKFLNPKPTL+DILSFCDFIA
Sbjct: 434  GNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIA 493

Query: 531  ITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTL 590
            I PI  I+FDNV+L+ +MFKIVI S+  S V+EK+ LRNV +N++SW+LLCKFLL +++L
Sbjct: 494  IVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSL 553

Query: 591  IKLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREG--RPLEELLLNGLRFDKMSFSHF 648
             K+DISQT+ + +      R  MDW+LF + L  R    RPLEE+L+NG+ FD +    F
Sbjct: 554  NKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDF 613

Query: 649  KNILLTFA-QMNPKNPIRLGMANVE---FSTECFDFLFNWMSEYNVQGVDLAYNNLESLA 704
            +N L+TFA Q +  N IRLG+AN      S + + FL  WMS YNVQGVDL +N+L +L 
Sbjct: 614  QNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLI 673

Query: 705  KRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGIL 764
            K  + KL+ L Y +L YFTLNSTNI S +DM+ +LK LS+LP+++FLDLSNLPQ+FP IL
Sbjct: 674  KPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMALLLKALSKLPNLEFLDLSNLPQVFPDIL 733

Query: 765  TSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXX 824
               YKY P+FPQLKR+H D ++++ KE T++ ++LAKC  L HVS++ Q P    ++   
Sbjct: 734  PYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETE--- 790

Query: 825  XXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLM 884
                            VF +N   A+LYAFVRDS NLV LD+DY  + DE+ SR+ALCLM
Sbjct: 791  -SAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLM 849

Query: 885  HNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKR---LNDKSLLQ-NDVGKKYLL 940
             NM+R MDSSF+LDEL  QD+L+FDGSL+T TA++VL+R   LN K +++  D  K+YLL
Sbjct: 850  RNMRRTMDSSFQLDELDSQDELLFDGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLL 909

Query: 941  KKYFEKMEKVHHNVQNTIDSMFEKRKSGEXXXXXXXXXXXXXXXXXXXXXXXDIFASMPN 1000
            KKY +K+ K+H+NVQ TID++FEKRKSG+                       DIF +MPN
Sbjct: 910  KKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPN 969

Query: 1001 IADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKH-LDSDRLIN-----DVSIPENDS- 1053
            +++V+  +K  +S     DS V         P+L+H +++D L       D+ + END+ 
Sbjct: 970  LSEVLGENKIASS-----DSLVD-------HPNLRHVVETDNLNENSNERDLQVNENDNL 1017

Query: 1054 SIRPHLMATDSGRIIDVTTGKALLFKSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHN 1113
              RPHLMAT+SGR ID  TG+ +  + SS TSLA K+QEEEEG+ HKWG ++Q Q + + 
Sbjct: 1018 QQRPHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYP 1077

Query: 1114 SGLPSSANSSRISGSLTPDS--SVAGGKKGESSRTSGTRPKILPKIPTGAELRDAIIKAK 1171
             G      SS +S S +  +  S+   +K           KI  K+P+G ELR AIIKAK
Sbjct: 1078 DGESQYGESSAVSASTSQTTLPSIDSKEK-----------KIFTKLPSGPELRTAIIKAK 1126

Query: 1172 GIDSVDDLIKNVTS-EKVGLESLY 1194
            G+ S+++LI+ +       +ESLY
Sbjct: 1127 GVSSIEELIQKINDYHCCDIESLY 1150

>KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058
            Saccharomyces cerevisiae YPL137c, start by similarity
          Length = 1278

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/983 (43%), Positives = 582/983 (59%), Gaps = 128/983 (13%)

Query: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXX 357
            +++++++NLKRVT AV EF  DPPQQ+PSRKPK GNVL+P DMIS  P IS GIT     
Sbjct: 263  IKELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQP 322

Query: 358  XXXXXXX-----XXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKA 412
                             KDSKEY+L                   +Y A+R+A EVA +K 
Sbjct: 323  SSHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKL 382

Query: 413  RQLKTSPLTGATNSA---ADSATDQESSS-----LDARASKLHIDKPINV---------- 454
            +   ++ L  + N     + +ATD E+++      D +   L IDKPI++          
Sbjct: 383  KPSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKESSG 442

Query: 455  ---------GAHPFETH--QDDNIKYSSHLEQTLDVAYTRCCHLREILPIPSTLRQVKGK 503
                     GA+P  T   QD+N       E  LDV YTRCCHLREILPIPSTLRQ+K K
Sbjct: 443  SSNGTGSEHGANPSSTSGTQDENGN-----ELMLDVVYTRCCHLREILPIPSTLRQLKEK 497

Query: 504  TAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVE 563
             APLQTLKFLNP+PTL+DILSF DFIAI PIHN++FDNV L+ +MFKIVI SLV S  +E
Sbjct: 498  KAPLQTLKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLE 557

Query: 564  KLGLRNVVINEQSWKLLCKFLLQNKTLIKLDISQTKARTDLNDSNYRDQMDWELFCEVLR 623
            +L +RNVV +E+ WKLLCKFL++NK+L KLDISQTK R DL+   +R QMDW LF +VL 
Sbjct: 558  RLSMRNVVFDERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVLH 617

Query: 624  NREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNPKNPI----RLGMANVEF-STECF 678
             R+G+PLEELLLNG+ F   +   F+N++  F+    KN      +LG+A  +  S+E  
Sbjct: 618  KRQGKPLEELLLNGVSFAN-NLHTFENMINAFSST--KNEFSRKRKLGLAQSQIASSEQL 674

Query: 679  DFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYI 738
            + LF WMSE ++ GVDLA+N+ E+L K +IK+L++  +  L+YFTLNSTNI SV + + I
Sbjct: 675  EILFRWMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALI 734

Query: 739  LKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSI 798
            ++ LS+LP + FLDLS LP LFP I     KY P+FP LKR+HFD ++ + K+ +++  I
Sbjct: 735  IRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQI 794

Query: 799  LAKCETLSHVSLIGQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDS 858
            L KC+ L HVS++ Q   P  S                    VF        LY  +++S
Sbjct: 795  LPKCKELLHVSMMNQ---PQES--------------WAMSAAVF--------LYDCIKNS 829

Query: 859  HNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAE 918
              L++LD +Y+ +P+EI SRIA+ L+ N ++ +DS+++LDEL+ QDDL+FDG LI+ETA 
Sbjct: 830  DKLINLDFNYENIPEEINSRIAIALVRNAQKSIDSNWQLDELSSQDDLLFDGELISETAG 889

Query: 919  EVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGEXXXXXXXXX 978
             +L +LND + LQ D  K+YLLK+Y+EK+  +H NVQ TIDSMFE+R S E         
Sbjct: 890  NILDKLNDSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENL 949

Query: 979  XXXXXXXXXXXXXXDIFASMPNIADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKHLD 1038
                          +  ++ P I ++       N   N  D   S++     RP LKH+D
Sbjct: 950  LRLIFMENTLGNILEYLSTNPYIQEL-------NYAKNKDDDNYSSSDE---RPVLKHVD 999

Query: 1039 SDRLI--------------NDVSIPENDSSIRPHLMATDSGRIIDVTTGKALLFKSSSNT 1084
            S+R++               ++   ++ +S +PHLMATDSGR IDVTTG+ +L K+SS  
Sbjct: 1000 SERIMYAKPLVDPIDQDIDQELEHEQDSNSAKPHLMATDSGRTIDVTTGRPILTKTSSQR 1059

Query: 1085 SLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSS--------ANSSRISGSLT-----P 1131
            S+ GK+QEEEEGELHKWG FVQ Q S +    P S         ++ R    L+     P
Sbjct: 1060 SIFGKKQEEEEGELHKWGFFVQQQRSIYPENTPMSKYQQQQQHKHAQRKEPQLSQIVEKP 1119

Query: 1132 DSSVAGGKK-GESSRT------------------SGTRPKILPKIPTGAELRDAIIKAKG 1172
               V   +K G+ + T                  S    K++ KIP+G ELR+AIIKAKG
Sbjct: 1120 REQVQTSQKTGQPAATPTASTPPTSSNSIPALSKSAASAKLIGKIPSGTELREAIIKAKG 1179

Query: 1173 IDSVDDLIKNVTSEKVGLESLYG 1195
            I+S++DLI NV  ++V L+++YG
Sbjct: 1180 INSIEDLIDNVNCQQVKLDNIYG 1202

>ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH]
            complement(550378..553686) [3309 bp, 1102 aa]
          Length = 1102

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/927 (43%), Positives = 537/927 (57%), Gaps = 72/927 (7%)

Query: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNXXXX 357
            LQ +S V L+RV  AV +F++DPPQQ+PSR+P+RGNVLIP++++   P IS GI+N    
Sbjct: 205  LQLLSGVQLRRVAFAVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGISNPEGI 264

Query: 358  XXXXXXXXXXXXKDSKEYKLXXXXXXXXXXXXXXXXXXXYYVAERMAQEVANYKARQLKT 417
                        KDSKEYK+                   +  A R A EVA +K +Q   
Sbjct: 265  CGQKESQLT---KDSKEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFKYKQ--- 318

Query: 418  SPLTGATNSAADSATDQE---SSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSHLE 474
                        S + +E    +++D RA  L IDKP       F+  +D      S  E
Sbjct: 319  ------------SHSQRELVPEAAVDDRAKHLEIDKPTQANETSFDG-EDTECGDESGKE 365

Query: 475  QTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITPI 534
             TLD  YTRCCHLREILPIPSTL+QVK KTAPL TLKFLNPKPTL+D+LSFCDFIA+ PI
Sbjct: 366  LTLDQIYTRCCHLREILPIPSTLKQVKNKTAPLHTLKFLNPKPTLIDLLSFCDFIAVVPI 425

Query: 535  HNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLD 594
            HN++FDNV+LT +MFKI+I SLV S  +E+L +RNVV +   W  LCKF+L N++LIKLD
Sbjct: 426  HNVVFDNVNLTPEMFKIMITSLVNSTALERLSIRNVVTDADCWAALCKFILSNRSLIKLD 485

Query: 595  ISQTKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNILLT 654
            ISQTK R DL  + YR  M+W LF EVL+ R+  PLEELLLNG++F  +S   F  +L  
Sbjct: 486  ISQTKVRQDLARTLYRSNMNWPLFIEVLQRRQHAPLEELLLNGIQFFDLSI--FNGLLHA 543

Query: 655  FAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIKKLARL 714
            F  + P +  RLG+A+     E    LF+W S YNVQG+DLA+NNL  L K M+ KL  +
Sbjct: 544  FT-LRPASKKRLGVAHSFLKEEHLKLLFDWASTYNVQGIDLAFNNLTDLVKPMVSKLTTM 602

Query: 715  PYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQF 774
             + HL YFTLNST +    D +  L+ LS+LP++ FLDLS+LP +FP I     KY P+F
Sbjct: 603  NFDHLHYFTLNSTAL-GFCDAALCLRALSKLPNLYFLDLSSLPAIFPEIFPFLNKYLPRF 661

Query: 775  PQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXXXXXXXXXXXX 834
            P LKR+H D +D  +   ++L  IL KC+ L H+S++ Q   P++S              
Sbjct: 662  PFLKRLHLDSNDFMMDHISLLSQILQKCKELLHLSMLYQ---PESS-------------- 704

Query: 835  XXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSS 894
                       +  A+LY FV +S  L +LDVDY+ +P+EI SRIA+CL+ N ++ ++  
Sbjct: 705  --------YGMSACAALYDFVANSPKLKNLDVDYEYIPEEISSRIAVCLIRNAQKSLNED 756

Query: 895  FKLDELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQN-DVGKKYLLKKYFEKMEKVHHN 953
            F+LDELT QDDL+FDG LIT+TA  +L +L   S   N D  ++YLLKKY++K+ +VH N
Sbjct: 757  FELDELTSQDDLLFDGELITKTAGGILSKLGTSSEKSNDDSSRRYLLKKYWQKINRVHTN 816

Query: 954  VQNTIDSMFEKRKSGEXXXXXXXXXXXXXXXXXXXXXXXDIFASMPNIADVVPFSKADNS 1013
            VQ+TID +FEKR   E                       +I A    +A ++  +    S
Sbjct: 817  VQSTIDDLFEKRSKDELTLQGKENLLRLLFVENTLSKILEILADSQEVASLLDDNPEGIS 876

Query: 1014 FPNIGDSTVSANYNDGIRPSLKHLDSDRLINDVSIPENDSSIRPHLMATDSGRIIDVTTG 1073
             PN+     S       R    +LD+  +     +       RPH MATDSGR IDVTTG
Sbjct: 877  APNLEAVDSSTLLMPATRLEDGYLDTQGISASTQVD------RPHFMATDSGRTIDVTTG 930

Query: 1074 KALLFKSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSANSSRISGSLTPDS 1133
            + ++ + SS TS+  K+QEEEEGELHKWG FV    ++  SGLP     S       P  
Sbjct: 931  RPVVLRQSSQTSIVCKKQEEEEGELHKWGYFV----AQKRSGLPLPQYVSEHPAQSQP-- 984

Query: 1134 SVAGGKKGESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDSVDDLIKNVTSEKVGLESL 1193
                    ++   +  R  I+ KIP+GAEL+ AIIKAKGI S++DLI NV   +V L+++
Sbjct: 985  -------SQADNATDMR-VIISKIPSGAELKAAIIKAKGIASMEDLIDNVNHNRVHLDNI 1036

Query: 1194 YGDELNSRSPSNDSLQESQQKAPLQRP 1220
            YG   ++R  S D    S Q   +  P
Sbjct: 1037 YGIPYSTRPVSADRASVSSQSRSVCTP 1063

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
            Saccharomyces cerevisiae YJL042w MHP1, hypothetical start
          Length = 1314

 Score =  251 bits (640), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 166/537 (30%), Positives = 276/537 (51%), Gaps = 84/537 (15%)

Query: 478  DVAYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHN 536
            DV YTRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P+L++I SF DF++I+P+  
Sbjct: 510  DVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISPVLC 569

Query: 537  IIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLL-QNKTLIKLDI 595
            +  D VSLT +M +I++ SLV++P +EKL +RN  +NE  WK+L  F+  Q K  + LD+
Sbjct: 570  VSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFVALDL 629

Query: 596  SQTKA------------------------RTDLNDSNYRDQMDWELFCEVLRNREGRPLE 631
            +                            R + N  N R  M+W+L    +  +EG  +E
Sbjct: 630  TMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHN-RSDMNWDLLTAAVATKEG-GIE 687

Query: 632  ELLLNGLRFDKMSFSHFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQ 691
            E +L G     MS++ FKN    F ++   N  RLG+A  + + E    L  W+   N++
Sbjct: 688  EFVLAGA---CMSYTQFKN----FIELACTNTDRLGLAYNKLTMEQCKVLAEWIVTSNIR 740

Query: 692  GVDLAYNNLES----LAKRMIKKLARLPYKH-LEYFTLNSTNITSVDDMS----YILKYL 742
            G+DL +N+L+         +  K+  +  K+ ++Y +LNSTN++   D +     +L+ L
Sbjct: 741  GLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVLRLL 800

Query: 743  SRL---PSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSIL 799
            S L    ++KFLDLSN P++FP  + +     P +  L R+H D++DL      +L   L
Sbjct: 801  SVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVLAESL 860

Query: 800  AKCETLSHVSLIGQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSH 859
              C  L H+SL+G       SK+                           +L   V  S+
Sbjct: 861  PLCSKLHHLSLLG-------SKLNLASAK---------------------ALTEAVNKSN 892

Query: 860  NLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLDE---LTV----QDDLIFDGSL 912
             L++LD++Y+ VP+ I+ R++L  M N++  +D+  K      L++    Q+++  +   
Sbjct: 893  TLMTLDLEYNTVPESIKERMSLYTMRNIQNELDNVQKTKRKAGLSLPSVPQEEMAANEKQ 952

Query: 913  ITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGE 969
            I+   EE+   L DK   ++ +    L+ ++ EK+ KV   ++  +  +F+ R   E
Sbjct: 953  ISTLQEELSSLLTDK--FEDSLEYDKLVVEFIEKITKVRTKIEKVVSDLFDLRVKNE 1007

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 306 LKRVTIAVQEFNSDPPQQLPSRKPKRGNVLI 336
           LK V  A   + +DPPQQ+ S+ P++G V +
Sbjct: 328 LKHVAFATTTYFNDPPQQICSKNPRKGEVEV 358

>Kwal_23.5488
          Length = 1112

 Score =  245 bits (626), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 175/610 (28%), Positives = 298/610 (48%), Gaps = 99/610 (16%)

Query: 399  VAERMAQEVANYKARQLKTSPLTGATNSAADSATDQESSSLDARASKLHIDKPI------ 452
             +E+ AQ+ A   + Q+              S  ++E   +   AS++ IDKP+      
Sbjct: 493  ASEKAAQKAAESTSEQVNQP-----------SGDNEEEVIISKSASEVKIDKPMISRRSA 541

Query: 453  -----NVGAHPFETHQDDNIKYSSHLEQTLDVAYTRCCHLREILPIPSTLRQVK-GKTAP 506
                  + A   E   DDNI     ++   D+ YTRCCHLREILPIP+TL+Q+K G T P
Sbjct: 542  SSLSTMIPAADPEEDDDDNIFPPPGMKIPHDLVYTRCCHLREILPIPATLKQLKKGSTDP 601

Query: 507  LQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLG 566
            +  L+  NPKP+L+++LSF DF+ ITP+  +  D V+L+  M +I++CSL+     EKL 
Sbjct: 602  IPLLQMRNPKPSLIEVLSFSDFLGITPVLCLSLDGVNLSAGMLRIILCSLMNKKQFEKLS 661

Query: 567  LRNVVINEQSWKLLCKFLLQNKTLIKLDI-------------SQTKARTDL----NDSNY 609
            LRN  ++ + WK+LC F+ Q K+L  +D+             S++  R+ +         
Sbjct: 662  LRNTPLDHEGWKILCYFISQCKSLNSIDLTMVPGISINVQKPSKSSQRSRVVRMTCSMTD 721

Query: 610  RDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNILLTFAQMNPKNPIRLGMA 669
            R +M+W L    L + EG  LEE++++G    KMS   FK+    F Q+     +RLG+A
Sbjct: 722  RKEMNWNLLVASLISVEG--LEEIIISGA---KMSLKEFKD----FLQLGCTKTLRLGLA 772

Query: 670  NVEFSTECFDFLFNWMSEYNVQGVDLAYNNLE----SLAKRMIKKLARLPYKHLEYFTLN 725
              E +TE  + L  W++  NV G+D+ +N+L     + A  +I +  +      +YF+L+
Sbjct: 773  YNELTTEQCNVLAGWLAHSNVTGIDIGFNDLRGKLGAFASGIIDR-TKSSRNVFKYFSLS 831

Query: 726  STNIT-------SVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLK 778
            STN+          DD   ++  L     +K LD+SN P+LFP + +    Y P F  L 
Sbjct: 832  STNLEVSEDSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPYVTSHLTNYMPVFVNLL 891

Query: 779  RIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSPMPDASKIXXXXXXXXXXXXXXXX 838
            R+H D +++       L  +L  C+ LSHVS+ G                          
Sbjct: 892  RLHMDNNNIPAPSVVALAEVLPMCQKLSHVSMRGTK------------------------ 927

Query: 839  QIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNMKRIMDSSFKLD 898
                +      +L A +R S +L+++D+D + +P++I+ +++L  M NM++ ++   K  
Sbjct: 928  ----LDYATGCALAAAMRQSSSLLTIDLDAENLPNKIKDKMSLYSMKNMEKTLNRVDKST 983

Query: 899  ELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKYFEKMEKVHHNVQNTI 958
               + D L     L  E A+ + ++ N     + DV  + + + +  ++ K    ++   
Sbjct: 984  SPEMSDTL---ACLQKELADLLTEQPN-----KQDV--EVMAQNFLLRLSKARSFIKKVT 1033

Query: 959  DSMFEKRKSG 968
            + +F+ R  G
Sbjct: 1034 EDLFKLRVEG 1043

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 306 LKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPED 339
            ++V+ A   + +DPPQQ+ S+ P+RG V +  D
Sbjct: 389 FRKVSFATNTYFNDPPQQICSKNPRRGEVEVKPD 422

>Scas_690.33
          Length = 1423

 Score =  239 bits (609), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 172/578 (29%), Positives = 294/578 (50%), Gaps = 85/578 (14%)

Query: 433  DQESSSLDARASKLHIDKPI----NVGAHPFET-------HQDDNIKYSSHLEQTLDVAY 481
            ++E  +++  AS L IDKP+    +  +   E+         D  +  S +L+   DV Y
Sbjct: 609  NEEEVTVNKLASHLTIDKPMISRRSGTSLSLESMTSQDSVESDATVFPSPNLKIPYDVVY 668

Query: 482  TRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHNIIFD 540
            TRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P++V+I SF DF++I P+  +  D
Sbjct: 669  TRCCHLREILPIPATLKQLKPGSTDPIPLLQLRNPRPSMVEIWSFSDFLSIAPVSCLSLD 728

Query: 541  NVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDIS---- 596
             VSLT DM K+++ SL     +EK+ LRN  ++++ WKLLC F+ ++++L+ +D++    
Sbjct: 729  GVSLTVDMLKVLLASLSAKRNLEKISLRNTPLDDEGWKLLCYFISKSRSLVSIDLTMVPH 788

Query: 597  -----QTKARTDLN--------DSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKM 643
                 Q  +++ L         D + R + +W L    +  + G  LEEL+++G+   KM
Sbjct: 789  IKTNVQKPSKSSLKSNIIRMECDLDNRTKRNWNLLAGSIAMKGG--LEELVVSGV---KM 843

Query: 644  SFSHFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLE-- 701
            S +HFKN    F ++   +  RLG+A    S E  D L  W+ +  V G+DL +N+L   
Sbjct: 844  SLNHFKN----FIEVACISTERLGLAYNNLSKEQCDILAKWLVKSKVTGLDLGFNDLRGK 899

Query: 702  --SLAKRMIKKLARLPYKHL-EYFTLNSTNIT----SVDDMSYILKYLSRL---PSIKFL 751
              + +  + +K+     K++ +Y +LN T++     +  + + +L+ LS L     +KFL
Sbjct: 900  LTTFSDAVWQKIQSNEVKNVFKYLSLNDTSLEVEEGATSETNEVLRLLSILCYSEDLKFL 959

Query: 752  DLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLI 811
            DLSN P+ FP  L +  K  P F  L RIH D + L+     ML   L  C  L H S++
Sbjct: 960  DLSNNPKCFPHCLDTLVKCLPVFVNLVRIHLDNEQLTSTNIIMLAEALPLCSRLIHFSML 1019

Query: 812  GQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQV 871
            G +P+  AS                             +L    R S +L++LDV+Y  +
Sbjct: 1020 G-TPLDLAS---------------------------CKALAEAFRRSTSLLTLDVNYVYM 1051

Query: 872  PDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQ 931
            PD I+ +I +  M NM+  +    K++     D    DG  ++   +E+ + L +    +
Sbjct: 1052 PDNIKEKITMYSMRNMQNELR---KVNSENEADGKATDGFHLSNLQQELSELLTEN--YE 1106

Query: 932  NDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGE 969
             D  K   +  +  ++E++   +   ++ +F  +  G+
Sbjct: 1107 ADSTKNADI--FITRIEQIRSKISRVVEDLFNLKVQGQ 1142

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 306 LKRVTIAVQEFNSDPPQQLPSRKPKRGNVLI 336
           LK V+ +   + +DPPQQ+ S+ P++G V +
Sbjct: 455 LKHVSFSTNTYFNDPPQQICSKNPRKGEVEV 485

>KLLA0E11847g complement(1044591..1048385) some similarities with
            sp|P43638 Saccharomyces cerevisiae YJL042w MHP1
            microtubule-associated protein, hypothetical start
          Length = 1264

 Score =  226 bits (577), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 152/522 (29%), Positives = 256/522 (49%), Gaps = 78/522 (14%)

Query: 478  DVAYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHN 536
            DV YTRCCHLREILPIP+T++Q+K G T P+  L+  NPKP+ V++LSF DF++I P+  
Sbjct: 622  DVVYTRCCHLREILPIPATMKQLKKGSTEPIPFLQLRNPKPSKVEVLSFSDFLSIAPVLC 681

Query: 537  IIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDIS 596
            +  D VSL+ +M +I++ S+      EKL LRN  ++   WK+L  F+ + K+L  LD++
Sbjct: 682  LSLDGVSLSVEMLRIILSSITYKDKFEKLSLRNTPVDHDGWKVLSYFVSKCKSLNSLDVT 741

Query: 597  Q------------------TKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGL 638
                               T  R   N  N R  M+W L    +  + G  LEE++++G 
Sbjct: 742  MIPGLALNVQKPSKSSNGSTVPRMVCNMEN-RSDMNWSLLSAAVAAKGG--LEEMIVSGA 798

Query: 639  RFDKMSFSHFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYN 698
              +++   +F +I  T         +RLG+A    + E    L  WM+   +QGVD+ YN
Sbjct: 799  FMNQVQLQNFIDIAWT-------KTLRLGLAYNNLTLEQCQCLATWMTNSKIQGVDVGYN 851

Query: 699  NLESLAKRMIKKLARLPYKH---LEYFTLNSTNI-------TSVDDMSYILKYLSRLPSI 748
            +L       I  +     K     ++ +LNSTN+       +  +++  +L  L    S+
Sbjct: 852  DLNGKLGPFISAVIEKTKKGKNVFKFLSLNSTNLSVPKGAKSEDNEVLSLLNGLCYCDSL 911

Query: 749  KFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHV 808
            KFLDLSN P LFP  + +     P F  L R+H D ++LS         +L  C+ ++++
Sbjct: 912  KFLDLSNNPGLFPYGMRTLTAILPVFVSLLRLHLDNNNLSTTAVMQFAEVLPMCQRINYI 971

Query: 809  SLIGQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDY 868
            SL+G +                            +     ++L A V++S  ++++D+DY
Sbjct: 972  SLLGTN----------------------------LNIISASALAAAVKNSKTIITMDIDY 1003

Query: 869  DQVPDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKR-LNDK 927
              VPD I+ +I++  M N +R ++         +      DG    ++ +E L R L + 
Sbjct: 1004 AHVPDRIKEKISVYSMRNTQRELEQ--------INKSGGDDGHEKLKSLQEELGRLLTED 1055

Query: 928  SLLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGE 969
            S  ++D     L+  + E+++ V   +   I+ +F+ R +GE
Sbjct: 1056 SSTRSDY--DTLVSNFLERIQTVRAKLHAAIEELFKLRLNGE 1095

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 306 LKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPED 339
           LKRV  A   + +DPPQQ+ SR P++G V +  D
Sbjct: 435 LKRVAFAANTYFNDPPQQICSRNPRKGEVEVKAD 468

>YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interacting
            protein, functions in stabilization of microtubules [4197
            bp, 1398 aa]
          Length = 1398

 Score =  224 bits (570), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 250/502 (49%), Gaps = 84/502 (16%)

Query: 433  DQESSSLDARASKLHIDKPI-------------NVGAHPFETHQDDN--IKYSSHLEQTL 477
            ++E  ++   AS L IDKP+              V +    T+ DD   I     L+   
Sbjct: 579  NEEEVTVSKTASHLTIDKPMISRRGASTSSLASMVSSDTNGTNADDEGEILPPPSLKIPH 638

Query: 478  DVAYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHN 536
            D+ YTRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P++V+I SF DF++I P+  
Sbjct: 639  DIVYTRCCHLREILPIPATLKQLKKGSTDPIPILQLRNPRPSMVEIWSFSDFLSIAPVLC 698

Query: 537  IIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDIS 596
            +  D V LT  M +I++ SLV     +KL LRN  ++E+ WK+LC F+ + K+L  +D++
Sbjct: 699  LSLDGVQLTVQMLRIILSSLVYKQHFQKLSLRNTPLDEEGWKVLCYFVSKAKSLHSIDLT 758

Query: 597  QTKA------------------RTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGL 638
               +                  R   N  N R  M+W+L    +    G  LEE++++G 
Sbjct: 759  MVPSIKTNVQKPSKSSLKSKILRMQCNLEN-RSDMNWDLLTASIALMGG--LEEIVISGA 815

Query: 639  RFDKMSFSHFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYN 698
               KM+ + FKN +L           RLG+A    S    D L  WM +  V G+D+ +N
Sbjct: 816  ---KMNSAQFKNFILVACIATE----RLGLAYNGLSKSQCDDLAKWMVQSKVTGLDVGFN 868

Query: 699  NLE----SLAKRMIKKLARLPYKHL-EYFTLNSTNITSVDDMSY-------ILKYLSRLP 746
            +L     S    ++ K+ +   K++ ++ +LN TN+   +  ++       ++  L  L 
Sbjct: 869  DLNGKLSSFTDAVLGKIQKANEKNVFKFLSLNGTNLRVNEHDTFENNEVLKLISVLCYLE 928

Query: 747  SIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLS 806
            ++KFLD+SN P +FP  + +   + P F  L R+H D+++LS     ML  IL  C  L+
Sbjct: 929  NLKFLDISNNPAIFPHCVPTLIDFLPVFVNLVRLHIDYNNLSSTSVVMLAEILPMCSRLN 988

Query: 807  HVSLIGQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDV 866
            + S++G      +SK                            +L   VR S +L++LDV
Sbjct: 989  YFSMLGTELDLASSK----------------------------ALAEAVRKSSSLMTLDV 1020

Query: 867  DYDQVPDEIQSRIALCLMHNMK 888
            DY  +P+ I+ +I+L  + N++
Sbjct: 1021 DYVYMPENIKEKISLYALRNIQ 1042

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 306 LKRVTIAVQEFNSDPPQQLPSRKPKRGNVLI 336
           LK V+ A   + +DPPQQ+ S+ P++G V +
Sbjct: 446 LKHVSFATNTYFNDPPQQICSKNPRKGEVEV 476

>ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH]
           complement(459751..463401) [3651 bp, 1216 aa]
          Length = 1216

 Score =  183 bits (465), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 137/521 (26%), Positives = 246/521 (47%), Gaps = 79/521 (15%)

Query: 478 DVAYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLVDILSFCDFIAITPIHN 536
           D+ YTRCC+LREILPIP+ L+Q+K G + P+  L+  NPKP++++ILS  DF++I P+  
Sbjct: 475 DMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLLQLRNPKPSMIEILSLGDFLSIAPVLC 534

Query: 537 IIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKLDI- 595
              D VSL+  M  I++ SL     +EKL +RN  ++E+ WK L  F+  +KTL  LD+ 
Sbjct: 535 FSMDGVSLSVQMLHIILSSLRCMGRLEKLSMRNTPLDEEGWKTLAYFISSSKTLRGLDLT 594

Query: 596 ------------SQTKARTDL----NDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLR 639
                       S++  +  +     D   R + +W LF   +       LEEL+++G  
Sbjct: 595 MIPGIPLNVQKPSKSSGQCSIPRMKCDLTSRAEQNWNLFTAAIAINGN--LEELIISGA- 651

Query: 640 FDKMSFSHFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNN 699
             K+S   FK ILL     + +   RLG+A  + S    + L +W+    V G+D+ +N 
Sbjct: 652 --KISLGQFK-ILLDIGCHSLE---RLGLAFNDLSHGHCEALASWLPGCKVTGLDIGFNP 705

Query: 700 LES----LAKRMIKKLARLPYKHLEYFTLNSTNIT-------SVDDMSYILKYLSRLPSI 748
           L      LA+ +++K +++    +   +LNST++           D+  +L  L    ++
Sbjct: 706 LNGKMRPLAEALMRK-SKVGNNSIACISLNSTDLAIPPNATVETSDVVALLSALGYCENL 764

Query: 749 KFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHV 808
           KFL LSN P +F   +       P      R+  D+++LS      L  +L  C T+ ++
Sbjct: 765 KFLPLSNNPNMFIYGMKPLTDILPVLVGFARLQLDYNNLSSTSIITLAEVLPMCTTIGYL 824

Query: 809 SLIGQSPMPDASKIXXXXXXXXXXXXXXXXQIVFMRNTLWASLYAFVRDSHNLVSLDVDY 868
           SL+G                              +  +  A+L   ++ S +L ++D D+
Sbjct: 825 SLVGSK----------------------------LDTSSGAALVLALKKSGSLFTIDADF 856

Query: 869 DQVPDEIQSRIALCLMHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLNDKS 928
            ++PD I+  +++  + N++ +++ S          D+    SL  E A  +  +  DK 
Sbjct: 857 SEMPDAIRHDVSIYSLKNLENVLELS------KTGHDMGKSTSLQQELAVLLAGKTQDKE 910

Query: 929 LLQNDVGKKYLLKKYFEKMEKVHHNVQNTIDSMFEKRKSGE 969
                    +L++ + +++  +   ++     +F+ R  GE
Sbjct: 911 ------DYDHLVESFAKRICDIRKRLKTVTKDLFKLRVRGE 945

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 306 LKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPED 339
           LKRV+ A   + + PPQQ+ SR P++G V +  D
Sbjct: 335 LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKAD 368

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 71  VNNELSNSKPAVSAEKVSQQGQVPTRRTRSHSVSYGLLQKKNNN 114
           V +E      A  + KVS+Q   P R+T S +VS G+LQ+ + N
Sbjct: 119 VTSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKN 162

>KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces
           cerevisiae YKL045w PRI2 DNA-directed DNA polymerase
           alpha, 58 KD subunit (DNA primase) singleton, start by
           similarity
          Length = 493

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 5/98 (5%)

Query: 690 VQGVDLAY-NNLESLAKRMIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSI 748
           +  +DL Y N+++   K+ +         HL  F LN T  T         KY  +LP  
Sbjct: 157 ISSLDLPYVNSIDEEEKQSLSTELYQTVSHLLTFQLNLTEETQRRQFFNREKYY-KLPME 215

Query: 749 KFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIHFDFDD 786
             +DL    Q+F   +  G+ Y PQF QL  I  +F D
Sbjct: 216 NVMDLVGSRQIF---IKKGWAYVPQFQQLNLISNEFSD 250

>Kwal_26.8206
          Length = 506

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 722 FTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIH 781
           F LN T+ T         K++ +LP    +DL    Q+F   +  GY Y PQF QL  I 
Sbjct: 194 FQLNLTDETQRRQYFNQEKFI-KLPFESVIDLVGSRQVF---IKKGYAYLPQFQQLNHIA 249

Query: 782 FDFDDL 787
            +F ++
Sbjct: 250 NEFSNM 255

>YAL043C (PTA1) [24] chr1 complement(58698..61055) Component of
           pre-mRNA cleavage factor II (CFII), required for both
           cleavage and polyadenylation of mRNA precursor [2358 bp,
           785 aa]
          Length = 785

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 7/86 (8%)

Query: 43  KKTATLPSTAAVPTKTIASPQRPLSGQNVNNELSNSK--PAVSAEKVSQQGQV-----PT 95
           ++ + L ST  V TKT      P +G +  N L   K     +  K S QG       P 
Sbjct: 363 RQLSALLSTLGVSTKTPTPVSAPATGSSTENMLDQLKILQKYTLNKASHQGNTFFNNSPK 422

Query: 96  RRTRSHSVSYGLLQKKNNNDDTTDSP 121
             + ++S  Y L+   N+N D T  P
Sbjct: 423 PISNTYSSVYSLMNSSNSNQDVTQLP 448

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,238,734
Number of extensions: 1527726
Number of successful extensions: 5343
Number of sequences better than 10.0: 48
Number of HSP's gapped: 5437
Number of HSP's successfully gapped: 69
Length of query: 1224
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1111
Effective length of database: 12,684,275
Effective search space: 14092229525
Effective search space used: 14092229525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)