Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR223W29228813320.0
Scas_640.24*2892797293e-96
CAGL0J04092g3012806592e-85
Sklu_2012.22532906421e-83
Kwal_26.86732762765884e-75
ACR110W2522884961e-61
KLLA0D07095g2462674943e-61
Kwal_26.732465053810.040
KLLA0B08239g1729102681.5
KLLA0A00715g59140672.1
KLLA0F04521g134434628.1
YJL178C (ATG27)27133619.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR223W
         (288 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...   517   0.0  
Scas_640.24*                                                          285   3e-96
CAGL0J04092g complement(382821..383726) similar to tr|Q12015 Sac...   258   2e-85
Sklu_2012.2 YOR223W, Contig c2012 1288-2049                           251   1e-83
Kwal_26.8673                                                          231   4e-75
ACR110W [1157] [Homologous to ScYOR223W - SH] complement(548056....   195   1e-61
KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyce...   194   3e-61
Kwal_26.7324                                                           36   0.040
KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...    31   1.5  
KLLA0A00715g complement(69861..71636) similar to sp|P43620 Sacch...    30   2.1  
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...    28   8.1  
YJL178C (ATG27) [2745] chr10 complement(89280..90095) Protein in...    28   9.0  

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/288 (88%), Positives = 255/288 (88%)

Query: 1   MSAEPLLPTHNGSQGGEVRSPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCR 60
           MSAEPLLPTHNGSQGGEVRSPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCR
Sbjct: 1   MSAEPLLPTHNGSQGGEVRSPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCR 60

Query: 61  ELRPQQTQKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHC 120
           ELRPQQTQKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHC
Sbjct: 61  ELRPQQTQKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHC 120

Query: 121 IIGTEELTQAELANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYG 180
           IIGTEELTQAELANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYG
Sbjct: 121 IIGTEELTQAELANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYG 180

Query: 181 DLEEEEERLAQNGNRDDEGHDIRQLEEQWMEXXXXXXXXXXXXXXXEDRFNSVPIANIKH 240
           DLEEEEERLAQNGNRDDEGHDIRQLEEQWME               EDRFNSVPIANIKH
Sbjct: 181 DLEEEEERLAQNGNRDDEGHDIRQLEEQWMESGSGTAQGNGAGGGNEDRFNSVPIANIKH 240

Query: 241 NKDXXXXXXXXXXXXXXXXXXMKFDGLFNRRQKMAIFAGVIVNVMFCL 288
           NKD                  MKFDGLFNRRQKMAIFAGVIVNVMFCL
Sbjct: 241 NKDLLLGICVGFFFGVFGILLMKFDGLFNRRQKMAIFAGVIVNVMFCL 288

>Scas_640.24*
          Length = 289

 Score =  285 bits (729), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 145/279 (51%), Positives = 188/279 (67%), Gaps = 13/279 (4%)

Query: 20  SPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGS 79
           +P QKFIVIRFSDV++ DLQ+NI+ VP SNINTHWLR+MCR+LRP++TQ  RLKFIR+G+
Sbjct: 10  TPTQKFIVIRFSDVTIADLQINITQVPISNINTHWLRQMCRDLRPRETQSHRLKFIRSGA 69

Query: 80  ILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANEDLKD 139
           +LN+ S +A ++  YF T+ + +         E N +YIHCIIG++ L++ ELA ED  D
Sbjct: 70  LLNSRSSLALQIQDYFRTSASDHTPQQEEEEEEANKFYIHCIIGSDLLSEDELAREDAMD 129

Query: 140 DATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEG 199
           D  P+ +  TTQAIGFDRLR+VGF+E+EIELLRQQFR+TYGDL   EERL  N   ++EG
Sbjct: 130 DLGPNEEGRTTQAIGFDRLRAVGFSEREIELLRQQFRSTYGDL---EERLQGNDEFEEEG 186

Query: 200 H-----DIRQLEEQWMEXXXXXXXXXXX-----XXXXEDRFNSVPIANIKHNKDXXXXXX 249
           +     DIRQLEEQWM                     +DRFNS+PI N+KHNKD      
Sbjct: 187 NNNSTTDIRQLEEQWMGKWWTWTHEMKMGWLIIMSFDDDRFNSIPITNLKHNKDLLIGIF 246

Query: 250 XXXXXXXXXXXXMKFDGLFNRRQKMAIFAGVIVNVMFCL 288
                       M  DGL N+RQ+M++FAG+IVN++FCL
Sbjct: 247 IGFCFGIFAFILMNIDGLLNKRQRMSMFAGIIVNILFCL 285

>CAGL0J04092g complement(382821..383726) similar to tr|Q12015
           Saccharomyces cerevisiae YOR223w, hypothetical start
          Length = 301

 Score =  258 bits (659), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/280 (47%), Positives = 178/280 (63%), Gaps = 19/280 (6%)

Query: 24  KFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGSILNT 83
           +FIV+RF+D ++ DL+LNI++V    INT WLRR+CRELR +QT +RRL+FIRNG+ILN+
Sbjct: 22  RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNS 81

Query: 84  HSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANEDLKDDATP 143
            + +  E+  YF+     N    T     +  +Y+HCIIGTE+LT  +LA+ED+ D   P
Sbjct: 82  RANLGSEILQYFERLQAEN----TEGTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGP 137

Query: 144 SNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEG---- 199
           S DS+TTQAIGFDRL SVGF+E+EIELLRQQFR+TYGD EEE++ L  + ++ + G    
Sbjct: 138 SADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGG 197

Query: 200 ---HDIRQLEEQWMEXXXXXXXXXXXXXX--------XEDRFNSVPIANIKHNKDXXXXX 248
               DIRQLEE WME                       EDRFNS+P+ +I+HNKD     
Sbjct: 198 NARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGI 257

Query: 249 XXXXXXXXXXXXXMKFDGLFNRRQKMAIFAGVIVNVMFCL 288
                        MK +GLFN+RQ+M+I  GV  NV+FCL
Sbjct: 258 TTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCL 297

>Sklu_2012.2 YOR223W, Contig c2012 1288-2049
          Length = 253

 Score =  251 bits (642), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 182/290 (62%), Gaps = 43/290 (14%)

Query: 1   MSAEPLLPTHNGSQGGEVRSPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCR 60
           MS+EPL+P+   SQ           IV+RFSDV++ DL L+ISN+P+ +INT+WLRRMCR
Sbjct: 1   MSSEPLIPSSQQSQLS---------IVVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCR 51

Query: 61  ELRPQQTQKRRLKFIRNGSILNTHSKIAEELTHYF--DTANNSNVATGTSVAPEQNNYYI 118
           +LR + T  +RLKFIR+G  LN+++  A EL  +F  DT N                YY+
Sbjct: 52  QLRKEATTNKRLKFIRSGRPLNSNTNFASELQQFFQQDTENT--------------KYYV 97

Query: 119 HCIIGTEELTQAELANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRAT 178
           HCI+G ++LT+ ELANED+ DD  PSN+  TTQA+GFDRLRSVGF+++EIELLR+QFR+T
Sbjct: 98  HCIVG-QDLTEEELANEDVLDDIGPSNEGTTTQAVGFDRLRSVGFSDEEIELLREQFRST 156

Query: 179 YGDLEEEEERLAQNGNRDDEGHDIRQLEEQWMEXXXXXXXXXXXXXXXEDRFNSVPIANI 238
           YGDLE   +           G DIRQLEEQWME               ED+FNSVPIA+ 
Sbjct: 157 YGDLENVVQ-------ESQGGRDIRQLEEQWME----------SGVSDEDQFNSVPIADY 199

Query: 239 KHNKDXXXXXXXXXXXXXXXXXXMKFDGLFNRRQKMAIFAGVIVNVMFCL 288
           K N+D                  +K +GLF++RQKMA+ AG++VN+ F L
Sbjct: 200 KRNRDLLIGLIIGCLLGIFSLLLLKQEGLFSKRQKMAVVAGLLVNLFFGL 249

>Kwal_26.8673
          Length = 276

 Score =  231 bits (588), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 166/276 (60%), Gaps = 34/276 (12%)

Query: 14  QGGEVR-SPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRL 72
           QGG    S   K +V+RFSD  + DL LN+SNVP + INT WLRRMCR+LR + T  +RL
Sbjct: 27  QGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRL 86

Query: 73  KFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAEL 132
           +FIRNG  L+ +S +  +L  YF+ +N+               +Y+HCI+G +ELT  EL
Sbjct: 87  RFIRNGRFLDINSDL--QLQQYFEGSNDK--------------FYVHCIVG-QELTPEEL 129

Query: 133 ANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQN 192
            NED+ D+A  + +  T QAIGFDRLRSVGF+E+EIELLRQ+FR+TYGDLEE        
Sbjct: 130 ENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEE-----LSR 184

Query: 193 GNRDDEGHDIRQLEEQWMEXXXXXXXXXXXXXXXEDRFNSVPIANIKHNKDXXXXXXXXX 252
           GN  DE  DIRQLEEQWME                D+  SV IAN KHN D         
Sbjct: 185 GN--DEARDIRQLEEQWME---------TGANEENDQLGSVGIANYKHNTDLLVGLVVGC 233

Query: 253 XXXXXXXXXMKFDGLFNRRQKMAIFAGVIVNVMFCL 288
                    MK DGLFN+RQKMA+  G+++N+ F L
Sbjct: 234 VLGVFSLLLMKQDGLFNKRQKMAMVGGLLMNLCFGL 269

>ACR110W [1157] [Homologous to ScYOR223W - SH]
           complement(548056..548814) [759 bp, 252 aa]
          Length = 252

 Score =  195 bits (496), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 161/288 (55%), Gaps = 39/288 (13%)

Query: 1   MSAEPLLPTHNGSQGGEVRSPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCR 60
           MS EPL+P  +  +   +          RFSD +++DL L +S++P++++ T WLR M R
Sbjct: 1   MSKEPLIPQQSRRRRRFIVV--------RFSDPTLQDLTLEVSSIPYADVTTRWLRAMVR 52

Query: 61  ELRPQQTQKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHC 120
           ++RP +T + RLKFIRNG  LN  S +   L  +F++A             E + YYIHC
Sbjct: 53  QIRPAKTVRHRLKFIRNGQPLNAMSNL--RLEQFFESAE------------ENDKYYIHC 98

Query: 121 IIGTEELTQAELANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYG 180
           I+G E LT  +L +ED  D+     D  T + IGFDRLRSVGF+++EIELLRQQFRATYG
Sbjct: 99  IVGPE-LTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSDEEIELLRQQFRATYG 157

Query: 181 DLEEEEERLAQNGNRDDEGHDIRQLEEQWMEXXXXXXXXXXXXXXXEDRFNSVPIANIKH 240
           DL+  ++        D E  D+RQLEEQW+E                 + +S+P AN ++
Sbjct: 158 DLDTSQQ-------PDGERADLRQLEEQWIETGATEQGA---------QLSSIPTANYRY 201

Query: 241 NKDXXXXXXXXXXXXXXXXXXMKFDGLFNRRQKMAIFAGVIVNVMFCL 288
           N D                  +K   LF +RQKMA+FAG++ NV+F +
Sbjct: 202 NMDLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFGM 249

>KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyces
           cerevisiae YOR223w hypothetical protein, start by
           similarity
          Length = 246

 Score =  194 bits (494), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 117/267 (43%), Positives = 157/267 (58%), Gaps = 34/267 (12%)

Query: 23  QKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQTQKRRLKFIRNGSILN 82
           +K +VIRF++ ++ DLQL+I+N+  + + T WLRRMCR+L+P +T+ +RL+FI+NG  LN
Sbjct: 10  RKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFIKNGRPLN 69

Query: 83  THSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEELTQAELANED-LKDDA 141
           +HS +  E        +N N+             YIH IIG   LT  EL NED L DD 
Sbjct: 70  SHSDLGIE-----SFKDNPNIT----------EMYIHGIIGAG-LTAEELINEDNLDDDF 113

Query: 142 TPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEEERLAQNGNRDDEGHD 201
           + +N++ TTQAIGFDRLRSVGF+EQEI+LLRQQF ATYGDLE    +         +  D
Sbjct: 114 SNTNENGTTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMPNQ---------QQRD 164

Query: 202 IRQLEEQWMEXXXXXXXXXXXXXXXEDRFNSVPIANIKHNKDXXXXXXXXXXXXXXXXXX 261
           IRQLEEQWME                 +FNS+ IAN K N D                  
Sbjct: 165 IRQLEEQWMETGVNDPQGQ--------QFNSIGIANWKSNMDLLIGLSIGSLLGVFSLLL 216

Query: 262 MKFDGLFNRRQKMAIFAGVIVNVMFCL 288
           +K  GLF++RQKM+I AG+I N+ + +
Sbjct: 217 LKQQGLFSQRQKMSIVAGLIFNIAWWI 243

>Kwal_26.7324
          Length = 650

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 2   SAEPLLPTHNGSQGGEVRSPDQKFIVIRFSDV-------SVRDLQLNISNVPF 47
           S EPLLP HN   GG V    Q+    R+S V       S  D + N +NVP 
Sbjct: 317 SVEPLLPEHNNGHGGSVSENAQRIPKSRYSAVDLYLGGNSFFDRKFNDTNVPL 369

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
           cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
           start by similarity
          Length = 1729

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 68  QKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYI-HCIIGTEE 126
           QK  +K I N S++N   K  ++L+ +  T      AT TSV   Q N  +   + G   
Sbjct: 851 QKTDVKKI-NSSVINPVDKSIKDLSDF--TIGKVTKATITSVKKNQLNVTLADNVHGRIS 907

Query: 127 LTQAELANEDLKDDATP-----SNDSMTTQAIGFDRLRSVGF 163
           +++   + ED+K+   P      NDS++ + IGF  ++S  F
Sbjct: 908 ISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKF 949

>KLLA0A00715g complement(69861..71636) similar to sp|P43620
           Saccharomyces cerevisiae YFR048w, hypothetical start
          Length = 591

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 6/40 (15%)

Query: 13  SQGGEVR------SPDQKFIVIRFSDVSVRDLQLNISNVP 46
           S+G  VR        D+K I  RFSDVS+ +L L++S+VP
Sbjct: 66  SKGSRVRRRGYDMHGDKKSISSRFSDVSMDNLLLDVSDVP 105

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, start by similarity
          Length = 1344

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 4/34 (11%)

Query: 82  NTHSKIAEELTHYFDTANNSNVATGTSVAPEQNN 115
           N  SK++  LTHY+ T N   + TGT   P QNN
Sbjct: 647 NAQSKLSYTLTHYYKTKNRL-ILTGT---PLQNN 676

>YJL178C (ATG27) [2745] chr10 complement(89280..90095) Protein
           involved in the cytoplasm-to-vacuole targeting (Cvt)
           pathway, appears to act as a downstream effector of
           Vps34p [816 bp, 271 aa]
          Length = 271

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 137 LKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIE 169
           L D   P  D++TTQ I FD  +++GF  +E E
Sbjct: 80  LTDVILPGKDAITTQIIDFD--KNIGFNVEETE 110

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,845,446
Number of extensions: 368471
Number of successful extensions: 1555
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1528
Number of HSP's successfully gapped: 35
Length of query: 288
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 187
Effective length of database: 13,099,691
Effective search space: 2449642217
Effective search space used: 2449642217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)