Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR222W (ODC2)30730215360.0
Kwal_26.866929629710221e-140
Scas_640.2530630410121e-138
ACR109W2992999761e-133
YPL134C (ODC1)3103079761e-133
CAGL0J04114g3033029751e-133
KLLA0D07073g2972979721e-133
Scas_589.103163047891e-105
ADL049W9123183234e-33
YPR021C (AGC1)9022993182e-32
Sklu_2359.69023013102e-31
Kwal_47.173218813013093e-31
Scas_691.43343382914e-30
Scas_602.88853003004e-30
CAGL0K02365g9193002925e-29
YJR095W (SFC1)3223002801e-28
KLLA0E13453g9062982837e-28
Sklu_2334.23192872693e-27
CAGL0M09020g3483222626e-26
Kwal_47.182163333282591e-25
AGL311C3623162541e-24
Kwal_33.154463053052474e-24
Scas_489.42973052431e-23
KLLA0F03212g3052962431e-23
AFR131C3443332381e-22
Sklu_2075.33452822381e-22
Kwal_23.43543433412353e-22
CAGL0L02079g2973122316e-22
Scas_667.223062972318e-22
Sklu_1926.23052902301e-21
YBR104W (YMC2)3293102311e-21
Kwal_27.120813693292311e-21
YBR291C (CTP1)2993052272e-21
KLLA0B12826g3192892282e-21
CAGL0K12210g3113112263e-21
Scas_645.93912562293e-21
Kwal_26.79672973052263e-21
Scas_718.53243162264e-21
Sklu_1275.13112872264e-21
KLLA0E23705g3683222284e-21
KLLA0E09680g3073052238e-21
Sklu_1149.22962902221e-20
Sklu_2431.53703212222e-20
Scas_721.273743282223e-20
KLLA0E18810g3773062189e-20
YBR085W (AAC3)3073002151e-19
YMR166C3683342143e-19
KLLA0F17864g3073012105e-19
Kwal_27.125993043012105e-19
Sklu_2398.43093032107e-19
CAGL0D01606g3053012097e-19
ACR260W3112882071e-18
YPR058W (YMC1)3073042062e-18
Kwal_56.230113032862043e-18
CAGL0B03883g3062872044e-18
Kwal_33.129883032932035e-18
Kwal_26.76533251812036e-18
YEL006W3352922011e-17
Scas_709.93653012021e-17
CAGL0F07711g3683132021e-17
CAGL0J02002g3612952012e-17
AEL253W3652922012e-17
YJL133W (MRS3)3143021992e-17
KLLA0A09383g3663492002e-17
YBR192W (RIM2)3773241993e-17
Scas_379.23013021964e-17
CAGL0F08305g3742591967e-17
CAGL0M05225g3813331951e-16
YGR257C (MTM1)3663531951e-16
CAGL0K08250g2973031921e-16
Scas_582.73293041922e-16
KLLA0B08503g3032841912e-16
Kwal_14.22103153071913e-16
Sklu_2127.52782941893e-16
AFL196W3612881905e-16
CAGL0L05742g3053081885e-16
CAGL0F04213g3062891885e-16
KLLA0E15532g3262921887e-16
YKL120W (OAC1)3242911879e-16
KLLA0D15015g3172971879e-16
AER184W3052951851e-15
Scas_721.1293231781852e-15
CAGL0J09790g3002841832e-15
YOR130C (ORT1)2923021832e-15
Sklu_2430.103243001842e-15
Kwal_33.140503142931833e-15
YBL030C (PET9)3182891824e-15
Sklu_2363.23233141824e-15
CAGL0H03839g2822931814e-15
YIL006W3732971825e-15
Kwal_55.213353172931816e-15
Kwal_0.2322742961796e-15
CAGL0G08910g2893001806e-15
CAGL0J01661g3273121816e-15
YDL198C (YHM1)3002851806e-15
ADL009W3793111827e-15
CAGL0K11616g3201671799e-15
YKR052C (MRS4)3042991781e-14
KLLA0E02772g2842941752e-14
Kwal_55.208683803011773e-14
Kwal_27.124813042931744e-14
KLLA0E12353g3053001744e-14
Scas_669.63732991755e-14
YMR056C (AAC1)3092911736e-14
Kwal_23.35293952881747e-14
CAGL0K10362g3013001727e-14
Scas_667.43083011701e-13
Scas_558.22893041701e-13
Scas_632.92921711691e-13
AGL047C3163011682e-13
KLLA0D09889g3642901693e-13
YPR011C3263131683e-13
Scas_562.123003001673e-13
Scas_718.243372971674e-13
KLLA0F13464g3002921665e-13
CAGL0G01166g2952911657e-13
AAL014C2713001647e-13
KLLA0D14036g4313221677e-13
Sklu_2037.23103151648e-13
Scas_662.123083011622e-12
YNL003C (PET8)2843021602e-12
Kwal_23.39653073131603e-12
Sklu_2432.52882991593e-12
Sklu_2442.82753001559e-12
ABL023W3093091561e-11
Scas_697.473282881561e-11
Sklu_2117.22982941551e-11
Kwal_27.116262992931551e-11
AGR191W2982981551e-11
AGR383W2932891541e-11
Sklu_1119.13072371532e-11
CAGL0F00231g3072341532e-11
YLR348C (DIC1)2982911514e-11
CAGL0D04774g3222981515e-11
Scas_716.293163041515e-11
Scas_714.183053061506e-11
AAR036W3172961506e-11
Scas_715.453052901497e-11
Scas_702.103023021462e-10
AER450C3081871443e-10
Kwal_33.155973052331444e-10
YIL134W (FLX1)3113141444e-10
AFR146W2813041434e-10
YJR077C (MIR1)3112331435e-10
YOR100C (CRC1)3272881382e-09
KLLA0D04950g2743021372e-09
Scas_673.173142351339e-09
YGR096W (TPC1)3142911339e-09
Scas_705.93232971321e-08
Kwal_23.47313141801312e-08
KLLA0B14454g3051891312e-08
YPR128C (ANT1)3282871293e-08
Sklu_2115.42992821284e-08
YER053C3002901275e-08
KLLA0F04697g3073111266e-08
ADL264C3292951268e-08
CAGL0G03135g3073011258e-08
AGL065C3353031251e-07
Kwal_55.213383232601232e-07
Kwal_27.114192981721232e-07
CAGL0H10538g2973031222e-07
KLLA0E08877g2941721222e-07
CAGL0B04543g3173031204e-07
KLLA0D04290g1881871174e-07
AGL064W296831204e-07
Kwal_55.211063283181204e-07
KLLA0C13431g3282831204e-07
Sklu_2127.43231491196e-07
KLLA0C11363g5173111198e-07
YNL083W5453191181e-06
AFR147C3151251161e-06
AER419W493901162e-06
CAGL0J05522g5191901152e-06
Kwal_23.30425423101134e-06
AER366W2931801124e-06
Kwal_26.79723583091125e-06
AFR253W3441381107e-06
Sklu_2374.7513901118e-06
Sklu_2260.53021531099e-06
YHR002W (LEU5)3571591082e-05
Scas_578.3*5243011072e-05
Scas_328.1227731034e-05
Sklu_2435.23443321045e-05
KLLA0D04312g10386975e-05
YMR241W (YHM2)3142851035e-05
CAGL0K02915g3423251028e-05
ADR036C3401391019e-05
CAGL0K07436g3072971011e-04
KLLA0A00979g343711011e-04
Kwal_47.19228281851001e-04
Kwal_23.57573071541001e-04
Scas_687.15*328330992e-04
KLLA0E18788g381327983e-04
Scas_717.20356151973e-04
KLLA0B11319g355320974e-04
CAGL0C02013g32963910.002
Scas_696.9312274910.002
AFR542W310127900.002
Sklu_2194.3312320890.004
YDL119C30759890.004
Sklu_2433.842085890.004
Kwal_34.15907312148860.007
Kwal_23.2913320180850.009
KLLA0F08547g308128830.015
YFR045W285201820.022
Scas_671.1*12359760.040
Scas_613.24177175770.054
KLLA0E02750g304303750.17
KLLA0E22880g436100681.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR222W
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   596   0.0  
Kwal_26.8669                                                          398   e-140
Scas_640.25                                                           394   e-138
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   380   e-133
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   380   e-133
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   380   e-133
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   379   e-133
Scas_589.10                                                           308   e-105
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   129   4e-33
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   127   2e-32
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         124   2e-31
Kwal_47.17321                                                         123   3e-31
Scas_691.4                                                            116   4e-30
Scas_602.8                                                            120   4e-30
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   117   5e-29
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   112   1e-28
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   113   7e-28
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        108   3e-27
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   105   6e-26
Kwal_47.18216                                                         104   1e-25
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   102   1e-24
Kwal_33.15446                                                         100   4e-24
Scas_489.4                                                             98   1e-23
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    98   1e-23
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    96   1e-22
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                96   1e-22
Kwal_23.4354                                                           95   3e-22
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    94   6e-22
Scas_667.22                                                            94   8e-22
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          93   1e-21
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    94   1e-21
Kwal_27.12081                                                          94   1e-21
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    92   2e-21
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    92   2e-21
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    92   3e-21
Scas_645.9                                                             93   3e-21
Kwal_26.7967                                                           92   3e-21
Scas_718.5                                                             92   4e-21
Sklu_1275.1 , Contig c1275 314-1249                                    92   4e-21
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    92   4e-21
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    91   8e-21
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         90   1e-20
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            90   2e-20
Scas_721.27                                                            90   3e-20
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    89   9e-20
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    87   1e-19
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    87   3e-19
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    86   5e-19
Kwal_27.12599                                                          86   5e-19
Sklu_2398.4 , Contig c2398 9476-10405                                  86   7e-19
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    85   7e-19
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    84   1e-18
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    84   2e-18
Kwal_56.23011                                                          83   3e-18
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    83   4e-18
Kwal_33.12988                                                          83   5e-18
Kwal_26.7653                                                           83   6e-18
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    82   1e-17
Scas_709.9                                                             82   1e-17
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    82   1e-17
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    82   2e-17
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    82   2e-17
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    81   2e-17
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    82   2e-17
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    81   3e-17
Scas_379.2                                                             80   4e-17
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    80   7e-17
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    80   1e-16
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    80   1e-16
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    79   1e-16
Scas_582.7                                                             79   2e-16
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    78   2e-16
Kwal_14.2210                                                           78   3e-16
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         77   3e-16
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    78   5e-16
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    77   5e-16
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    77   5e-16
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    77   7e-16
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    77   9e-16
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    77   9e-16
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    76   1e-15
Scas_721.129                                                           76   2e-15
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    75   2e-15
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    75   2e-15
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         75   2e-15
Kwal_33.14050                                                          75   3e-15
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    75   4e-15
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          75   4e-15
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    74   4e-15
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    75   5e-15
Kwal_55.21335                                                          74   6e-15
Kwal_0.232                                                             74   6e-15
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    74   6e-15
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    74   6e-15
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    74   6e-15
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    75   7e-15
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    74   9e-15
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    73   1e-14
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    72   2e-14
Kwal_55.20868                                                          73   3e-14
Kwal_27.12481                                                          72   4e-14
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    72   4e-14
Scas_669.6                                                             72   5e-14
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    71   6e-14
Kwal_23.3529                                                           72   7e-14
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    71   7e-14
Scas_667.4                                                             70   1e-13
Scas_558.2                                                             70   1e-13
Scas_632.9                                                             70   1e-13
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    69   2e-13
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    70   3e-13
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    69   3e-13
Scas_562.12                                                            69   3e-13
Scas_718.24                                                            69   4e-13
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    69   5e-13
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    68   7e-13
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    68   7e-13
KLLA0D14036g complement(1203522..1204817) some similarities with...    69   7e-13
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         68   8e-13
Scas_662.12                                                            67   2e-12
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    66   2e-12
Kwal_23.3965                                                           66   3e-12
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       66   3e-12
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          64   9e-12
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    65   1e-11
Scas_697.47                                                            65   1e-11
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            64   1e-11
Kwal_27.11626                                                          64   1e-11
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    64   1e-11
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    64   1e-11
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             64   2e-11
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    64   2e-11
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    63   4e-11
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    63   5e-11
Scas_716.29                                                            63   5e-11
Scas_714.18                                                            62   6e-11
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    62   6e-11
Scas_715.45                                                            62   7e-11
Scas_702.10                                                            61   2e-10
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    60   3e-10
Kwal_33.15597                                                          60   4e-10
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    60   4e-10
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    60   4e-10
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    60   5e-10
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    58   2e-09
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    57   2e-09
Scas_673.17                                                            56   9e-09
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    56   9e-09
Scas_705.9                                                             55   1e-08
Kwal_23.4731                                                           55   2e-08
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    55   2e-08
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    54   3e-08
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            54   4e-08
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    54   5e-08
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    53   6e-08
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    53   8e-08
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    53   8e-08
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    53   1e-07
Kwal_55.21338                                                          52   2e-07
Kwal_27.11419                                                          52   2e-07
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    52   2e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    52   2e-07
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    51   4e-07
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    50   4e-07
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    51   4e-07
Kwal_55.21106                                                          51   4e-07
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    51   4e-07
Sklu_2127.4 , Contig c2127 6322-7293                                   50   6e-07
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    50   8e-07
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    50   1e-06
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    49   1e-06
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    49   2e-06
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    49   2e-06
Kwal_23.3042                                                           48   4e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    48   4e-06
Kwal_26.7972                                                           48   5e-06
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    47   7e-06
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       47   8e-06
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         47   9e-06
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    46   2e-05
Scas_578.3*                                                            46   2e-05
Scas_328.1                                                             44   4e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         45   5e-05
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    42   5e-05
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    44   5e-05
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    44   8e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    44   9e-05
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    44   1e-04
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    44   1e-04
Kwal_47.19228                                                          43   1e-04
Kwal_23.5757                                                           43   1e-04
Scas_687.15*                                                           43   2e-04
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    42   3e-04
Scas_717.20                                                            42   3e-04
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    42   4e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    40   0.002
Scas_696.9                                                             40   0.002
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    39   0.002
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            39   0.004
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    39   0.004
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       39   0.004
Kwal_34.15907                                                          38   0.007
Kwal_23.2913                                                           37   0.009
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    37   0.015
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    36   0.022
Scas_671.1*                                                            34   0.040
Scas_613.24                                                            34   0.054
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    33   0.17 
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    31   1.5  

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/302 (96%), Positives = 290/302 (96%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN
Sbjct: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
           GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI
Sbjct: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180
           SI            VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180

Query: 181 WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
           WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ
Sbjct: 181 WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF
Sbjct: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300

Query: 301 RD 302
           RD
Sbjct: 301 RD 302

>Kwal_26.8669
          Length = 296

 Score =  398 bits (1022), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 183/297 (61%), Positives = 233/297 (78%), Gaps = 7/297 (2%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           ++A+PLPF YQF +GAVAGISE+ VMYPLDVVKTR QL+V+      +G Q   Y GV+D
Sbjct: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS----GGLGPQ---YKGVVD 54

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX 124
           C+K+IV KEG SRLY+GISSP+LMEAPKRATKFACND++QKI+K  F   + TQ +SI  
Sbjct: 55  CIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS 114

Query: 125 XXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                     V+VPFEL+KIR+QDV SSY GP+D ++K I  EG++ +Y G+EST+WR+ 
Sbjct: 115 GASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
           +WN GYFG+I+QVR  +P AK+K Q+TRNDLIAG+IGGT+G++++TPFDVVKSRIQ+   
Sbjct: 175 VWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV 234

Query: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           V+   +KYNW  PS+  IY+EEGFRALYKGFVPKV RL PGG ++LVVFTG M+FFR
Sbjct: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291

>Scas_640.25
          Length = 306

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 234/304 (76%), Gaps = 5/304 (1%)

Query: 1   MSSDSNAK-PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY 59
           MSS+ N + PLPF YQF++GA+AGISEL VMYPLDVVKTR QL+V+T    A G     Y
Sbjct: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVST---GAAGASATHY 57

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
            GVIDCL +IVKKEG   +Y+GISSPMLMEAPKRA KFA ND++ K++K++F T + TQ+
Sbjct: 58  KGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ 117

Query: 120 ISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIEST 179
           IS+            VIVPFEL+KIR+QDV S + GP++ LK  IK +G+ GLY G+EST
Sbjct: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST 177

Query: 180 MWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           +WRNA+WN GYFGVI+QVR  +PVAK+K +KTRNDL AG +GGT G M NTPFDVVKSRI
Sbjct: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237

Query: 240 QSV-DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
           QS  + + + V+KYNW  PS++ IY EEGFRALYKGFVPKV RL PGG+++LVVFT +MN
Sbjct: 238 QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMN 297

Query: 299 FFRD 302
            FR+
Sbjct: 298 VFRE 301

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  380 bits (976), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 176/299 (58%), Positives = 222/299 (74%), Gaps = 7/299 (2%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGV 62
           S S+ K LPF+YQF +GAVAG+SE+ VMYPLDVVKTR QL+V        G     Y GV
Sbjct: 2   SSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQ-------GGAGPHYTGV 54

Query: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI 122
           +DCLKKIV  EG  RLY+GISSP+LMEAPKRATKFACND++QK++K  F   + +Q +S+
Sbjct: 55  VDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSM 114

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                       V+VPFEL+KIR+QD  SSY GP+D ++K +  EG++ +Y G+EST+WR
Sbjct: 115 LAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174

Query: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242
           +ALWNGGYFG+I+Q R  +P A  K Q   NDLI+ +IG ++G ML+TPFDVVKSRIQ+ 
Sbjct: 175 HALWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNT 234

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
             +   V+KYNW LPSLL IYREEGFRALYKGFVPKV RL PGG ++LVVFTG+++F R
Sbjct: 235 AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCR 293

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 201 MPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL 260
           M  + TK         AGA+ G    ++  P DVVK+R+Q +     A   Y   +  L 
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLK 59

Query: 261 VIYREEGFRALYKGFVPKVCRLAP 284
            I   EG   LYKG    +   AP
Sbjct: 60  KIVAGEGVGRLYKGISSPILMEAP 83

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  380 bits (976), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/307 (59%), Positives = 232/307 (75%), Gaps = 9/307 (2%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTT---PTAAAVGKQVE 57
           M+S  N +PLPFIYQF +GA+AG+SEL VMYPLDVVKTR QL+VTT   P   A    V+
Sbjct: 1   MTSIDN-RPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVD 59

Query: 58  RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT--NE 115
            Y GV+DCL KIVKKEGFS LY+GI+SP+LMEAPKRA KF+ ND +Q  +K +F T   E
Sbjct: 60  HYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGE 119

Query: 116 TTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKG 175
            TQKI+I            V+ PFEL+KIR+QDV S +  P++ +K ++   G++ L+ G
Sbjct: 120 MTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNG 179

Query: 176 IESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVV 235
           +E+T+WR+ LWN GYFG+I+Q+R  +P AKT  +KTRNDLIAGAIGGTVG +LNTPFDVV
Sbjct: 180 LEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVV 239

Query: 236 KSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTG 295
           KSRIQ     S  ++KYNW LPS+L++YREEGF+ALYKGF PKV RLAPGG L+LVVFT 
Sbjct: 240 KSRIQR---SSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTN 296

Query: 296 MMNFFRD 302
           +M+FFR+
Sbjct: 297 VMDFFRE 303

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  380 bits (975), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 189/302 (62%), Positives = 224/302 (74%), Gaps = 10/302 (3%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           + KPLPFIYQF+SGA AG+SEL VMYPLDVVKTR QL+V + T + V      YNGVIDC
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVA-----YNGVIDC 56

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXX 125
           L +IVK+EGFSRLY+GISSPMLMEAPKRATKFACND YQK+FK+L+  ++ TQ+ISI   
Sbjct: 57  LGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSG 116

Query: 126 XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNAL 185
                    VIVPFEL+KIR+QDV S + GPM+ + KTI+  GI+ LY G+ESTMWRNA 
Sbjct: 117 SLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAF 176

Query: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVG-TMLNTPFDVVKSRIQS--- 241
           WNGGYFGVI+Q+R  +P AKT  +KT NDLIAG IGG    +  +T   VVKSRIQS   
Sbjct: 177 WNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236

Query: 242 -VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
              A  + V KYNW  PSL  IY EEGF ALYKGF+PK+ RL PGG +MLVVF GMM FF
Sbjct: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFF 296

Query: 301 RD 302
           ++
Sbjct: 297 QE 298

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  379 bits (972), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 172/297 (57%), Positives = 226/297 (76%), Gaps = 7/297 (2%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S+ KPLPF+YQF++GAVAG+SE+ VMYPLD+VKT  QL+V+       G    +Y GV D
Sbjct: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS-------GGSGPQYKGVFD 54

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX 124
           CLK+I  KEG SRLY+GISSP+LMEAPKRATKFACND++QKI+K+LF   + TQ +SI  
Sbjct: 55  CLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS 114

Query: 125 XXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                     V+VPFEL+KIR+QDV S +  P+  +K  ++ EGI+ +Y G+ESTMWR+ 
Sbjct: 115 GASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHG 174

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
           +WN GYFG+I+QVR  +P A TK ++TRNDL+AG +GGT+ ++L+TPFDVVKSR+Q+   
Sbjct: 175 IWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAV 234

Query: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           +    +KYNW  P+L  IY+EEGF+ALYKGFVPKV RL PGG ++LVVFTG+M+FFR
Sbjct: 235 IPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291

>Scas_589.10
          Length = 316

 Score =  308 bits (789), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 201/304 (66%), Gaps = 8/304 (2%)

Query: 4   DSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVT----TPTAAAVGKQVERY 59
           D +   LPFIYQFISGAVAG+SE  +MYPLDVVKTRFQL++       ++ AV KQ E +
Sbjct: 5   DKDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPE-H 63

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
           + ++ CL KI+K+EGF  LY+G+S P+LME PKRA KFA N+Q+Q+I    F   E T  
Sbjct: 64  SSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTST 123

Query: 120 ISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIEST 179
           +++            ++VPFEL+KIR+QD +S Y  P+ C +  I+N+G+ G+Y G EST
Sbjct: 124 VTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFEST 183

Query: 180 MWRNALWNGGYFGVIYQVRNSMPVAK--TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKS 237
           +WRN +WN  YFG+I+QV+  +P AK  TK Q  RND + GAI G +   L+ PFDVVK+
Sbjct: 184 IWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKT 243

Query: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297
           R+Q     SS +  Y W   S+ +IYR EG + +YKG +P +CR  PGG L+LVVF G+ 
Sbjct: 244 RMQGSKKTSSGM-CYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVN 302

Query: 298 NFFR 301
             FR
Sbjct: 303 ELFR 306

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  129 bits (323), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 92/318 (28%), Positives = 145/318 (45%), Gaps = 35/318 (11%)

Query: 1   MSSDSNAKPLPF------IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGK 54
           + S+S +  L F      IY F  G+VAG     V+YP+D+VKTR Q +          +
Sbjct: 507 IESESRSSNLYFYPIFDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQ----------R 556

Query: 55  QVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN 114
              +Y   IDCL KI+ KEG   LY G+   ++  AP++A K   ND  +          
Sbjct: 557 DFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAG--RDG 614

Query: 115 ETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKT------IKNEG 168
           + +    I               P E++KIR+Q VKS Y+   D  + +      IKN G
Sbjct: 615 KLSLPCEIISGATAGACQVVFTNPLEIVKIRLQ-VKSDYVA--DAARNSVNAISVIKNLG 671

Query: 169 IMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRND------LIAGAIGG 222
           ++GLY+G  + + R+  ++  YF     +++++     K    RN       L++G + G
Sbjct: 672 LIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAG 731

Query: 223 TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282
                L TPFDV+K+R+Q       +V  YN    +   I +EEG ++ +KG   +V R 
Sbjct: 732 MPAAFLTTPFDVIKTRLQIDPKKGESV--YNGIWDAARTILKEEGIKSFFKGGPARVLRS 789

Query: 283 APGGSLMLVVFTGMMNFF 300
           +P     L  +    N F
Sbjct: 790 SPQFGFTLAAYEIFHNLF 807

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  127 bits (318), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/299 (30%), Positives = 139/299 (46%), Gaps = 40/299 (13%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +Y F  G++AG    TV+YP+D +KTR Q +          + + +Y   IDCL KI+ +
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQ----------RSLAQYKNSIDCLLKIISR 580

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI-------SIXXX 125
           EG   LY G+   ++  AP++A K   ND         F  N  T K         I   
Sbjct: 581 EGIKGLYSGLGPQLIGVAPEKAIKLTVND---------FMRNRLTDKNGKLSLFPEIISG 631

Query: 126 XXXXXXXXXVIVPFELIKIRMQDVKSSYLGP-----MDCLKKTIKNEGIMGLYKGIESTM 180
                       P E++KIR+Q V+S Y+G       +   + +K  G+ GLY G+ + +
Sbjct: 632 ASAGACQVIFTNPLEIVKIRLQ-VQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACL 690

Query: 181 WRNALWNGGYFGVIYQVRNSM----PVAKTKGQ--KTRNDLIAGAIGGTVGTMLNTPFDV 234
            R+  ++  YF     ++  +    P  KTK    KT   L AGAI G     L TPFDV
Sbjct: 691 MRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDV 750

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           +K+R+Q +D       KYN    ++  I +EE FR+ +KG   +V R +P     L  +
Sbjct: 751 IKTRLQ-IDPRKGET-KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAY 807

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 218 GAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVP 277
           G+I G +G  +  P D +K+R+Q+      ++ +Y   +  LL I   EG + LY G  P
Sbjct: 537 GSIAGCIGATVVYPIDFIKTRMQA----QRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 278 KVCRLAPGGSLMLVVFTGMMNFFRD 302
           ++  +AP  ++ L V   M N   D
Sbjct: 593 QLIGVAPEKAIKLTVNDFMRNRLTD 617

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  124 bits (310), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 138/301 (45%), Gaps = 31/301 (10%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           IY F  G++AG    TV+YP+D+VKTR Q +          +   +Y   IDC  KI  +
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQ----------RSFSQYKNSIDCFAKIFSR 568

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ-KISIXXXXXXXXX 131
           EG   +Y G+   ++  AP++A K   ND  +     L + +   +    I         
Sbjct: 569 EGIRGIYSGLGPQLIGVAPEKAIKLTVNDYMR---GRLMDKHANLKWYFEILSGACAGAC 625

Query: 132 XXXVIVPFELIKIRMQDVKSSYLGPMDCLKK------TIKNEGIMGLYKGIESTMWRNAL 185
                 P E++KIR+Q V+S Y G  D LK        IK  GI GLYKGI + + R+  
Sbjct: 626 QVVFTNPLEVVKIRLQ-VRSEYAG--DVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVP 682

Query: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRND------LIAGAIGGTVGTMLNTPFDVVKSRI 239
           ++  YF     ++  +     K +K RN       L+AG + G     L TPFDV+K+R+
Sbjct: 683 FSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRL 742

Query: 240 QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
           Q +D       +Y     +   I +EE F++ +KG   +V R +P     L  +    N 
Sbjct: 743 Q-IDPRKGET-RYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNM 800

Query: 300 F 300
           F
Sbjct: 801 F 801

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 92/217 (42%), Gaps = 24/217 (11%)

Query: 10  LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKI 69
           L + ++ +SGA AG  ++    PL+VVK R  L+V +  A  V K      GVI      
Sbjct: 610 LKWYFEILSGACAGACQVVFTNPLEVVKIR--LQVRSEYAGDVLKSQVTALGVI------ 661

Query: 70  VKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS-------- 121
            K+ G   LY+GI++ ++ + P  A  F     Y  + K++F  +   +K          
Sbjct: 662 -KQLGIKGLYKGIAACLMRDVPFSAIYFPT---YAHLKKDVFKYDPKDKKQRNKLKTWEL 717

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQ----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIE 177
           +            +  PF++IK R+Q      ++ Y G     +  +K E     +KG  
Sbjct: 718 LVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGS 777

Query: 178 STMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRND 214
           + + R++   G         +N  P+ + +   T++D
Sbjct: 778 ARVLRSSPQFGFTLAAYEIFQNMFPLKREESTFTKDD 814

>Kwal_47.17321
          Length = 881

 Score =  123 bits (309), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 141/301 (46%), Gaps = 31/301 (10%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           IY F+ G+VAG    T +YP+D+VKTR Q +          +   +Y   IDC  KI  +
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQ----------RNFSQYKNSIDCFVKIFSR 550

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
           EG   +Y G+   ++  AP++A K   ND  +K+  +    N  T  + I          
Sbjct: 551 EGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMD--ENNRLTLPLEIISGAAAGACQ 608

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKT-------IKNEGIMGLYKGIESTMWRNAL 185
                P E++KIR+Q V+S Y    D L K+       +K+ G+ GLYKG+ + + R+  
Sbjct: 609 VIFTNPLEIVKIRLQ-VRSEY---ADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVP 664

Query: 186 WNGGYFGVIYQVR----NSMPVAKTKGQK--TRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           ++  YF     ++    N  P  K K  +  T   L AG + G     L TPFDV+K+R+
Sbjct: 665 FSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRL 724

Query: 240 QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
           Q +D       +Y   L +   I +EE F++ +KG   +V R +P     L  +    N 
Sbjct: 725 Q-IDPRKGET-RYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNM 782

Query: 300 F 300
           F
Sbjct: 783 F 783

>Scas_691.4
          Length = 334

 Score =  116 bits (291), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 142/338 (42%), Gaps = 63/338 (18%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE--RYN 60
           +D  + PL      ++G  AG+ E    +PLD +K R Q          + K+ E  R +
Sbjct: 7   NDKKSSPL---INLVAGGTAGLFEALCCHPLDTIKVRMQ----------IAKRTEGMRPH 53

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
           G I   + I   EGF  LY+G+ + ++   PK A +F+  + Y+    +      TT   
Sbjct: 54  GFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNT 113

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQD----------------------VKSSYLGPMD 158
            +            V+ P E++KIR+Q                        K  Y   + 
Sbjct: 114 FLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIH 173

Query: 159 CLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI---------YQVRNSMPVAKTKGQ 209
                +K EG   LY+G+  T  R A   G  F V          Y  R S+P  +T   
Sbjct: 174 AAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETS-- 231

Query: 210 KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSS-AVKKYNWCLPSLLVIYREEGF 268
                   G I G +G   N P D +K+R+Q   ++SS +  K  + + + L+  +EEGF
Sbjct: 232 ------CIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLI--KEEGF 283

Query: 269 RALYKGFVPKVCRLAPGGSLMLVVFT------GMMNFF 300
           RALYKG  P+V R+APG ++   V+         +NFF
Sbjct: 284 RALYKGITPRVMRVAPGQAVTFTVYEFVRKHLETLNFF 321

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 21/185 (11%)

Query: 138 PFELIKIRMQDVKSSY----LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
           P + IK+RMQ  K +      G +   +    +EG + LYKG+ + +          F  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 194 IYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQS----------- 241
               RN++   +T+   T N  +AG   G T   ++  P +VVK R+Q+           
Sbjct: 93  YEFYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPA 152

Query: 242 -VDAVSSAVK----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGM 296
            V A  +A      KY   + +   I +EEG  ALY+G      R A        V++ +
Sbjct: 153 GVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYL 212

Query: 297 MNFFR 301
            ++ +
Sbjct: 213 KDYLQ 217

>Scas_602.8
          Length = 885

 Score =  120 bits (300), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 92/300 (30%), Positives = 140/300 (46%), Gaps = 28/300 (9%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I+ F  G+VAG    T++YP+D +KTR Q +          + + +Y   IDCL KI  K
Sbjct: 499 IFNFSLGSVAGCIGATLVYPIDFIKTRMQAQ----------RSLTKYKNSIDCLVKIFGK 548

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ-KISIXXXXXXXXX 131
           EG   LY G+   ++  AP++A K   ND  +   K+L +     Q    +         
Sbjct: 549 EGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMR---KSLVDKKGNLQLGAEVLSGATAGAC 605

Query: 132 XXXVIVPFELIKIRMQDVKSSYLGPMD-----CLKKTIKNEGIMGLYKGIESTMWRNALW 186
                 P E++KIR+Q VKS Y   M         + IK   ++GLYKG+ + + R+  +
Sbjct: 606 QVVFTNPLEIVKIRLQ-VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPF 664

Query: 187 NGGYFGVIYQVRNSM----PVAKTKGQ--KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
           +  YF     ++ ++    P  K K    KT   L AGA+ G     L TPFDV+K+R+Q
Sbjct: 665 SAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQ 724

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
               V     +Y   L ++  I +EE FR+ +KG   +V R +P     L  +    N F
Sbjct: 725 IEPGVGET--RYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMF 782

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  117 bits (292), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 86/300 (28%), Positives = 135/300 (45%), Gaps = 28/300 (9%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +Y F  G+VAG    T++YP+D VKTR Q +          + + +Y   IDC  KI+ +
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQ----------RSLSQYKNSIDCFLKILSR 593

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
           EG   +Y G+   ++  AP++A K   ND  +   K+     +      I          
Sbjct: 594 EGIRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKD--KNGKLGLLSEIISGASAGACQ 651

Query: 133 XXVIVPFELIKIRMQDVKSSYL------GPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
                P E++KIR+Q VK  Y+        +  L + IK  G+ GLYKG  + + R+  +
Sbjct: 652 VIFTNPLEIVKIRLQ-VKGEYVAENAENAKLTAL-QIIKRLGLPGLYKGAAACLLRDVPF 709

Query: 187 NGGYFGVIYQVRNSM----PVAKTKGQK--TRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
           +  YF     ++  +    P  K K  +  T   L AGA+ G     L TPFDV+K+R+Q
Sbjct: 710 SAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQ 769

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
                   +  Y   + +   I REE F++ +KG   +V R +P     L  +    N F
Sbjct: 770 IDPKKGETI--YKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELFHNIF 827

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 53/216 (24%), Positives = 92/216 (42%), Gaps = 24/216 (11%)

Query: 4   DSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI 63
           D N K L  + + ISGA AG  ++    PL++VK R Q++        V +  E  N  +
Sbjct: 630 DKNGK-LGLLSEIISGASAGACQVIFTNPLEIVKIRLQVK-----GEYVAENAE--NAKL 681

Query: 64  DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN--TNETTQKIS 121
             L +I+K+ G   LY+G ++ +L + P  A  F     Y  + ++LFN   N+  ++  
Sbjct: 682 TAL-QIIKRLGLPGLYKGAAACLLRDVPFSAIYFP---TYAHLKRDLFNFDPNDKNKRSR 737

Query: 122 ------IXXXXXXXXXXXXVIVPFELIKIRMQ-DVKSS---YLGPMDCLKKTIKNEGIMG 171
                 +            +  PF++IK R+Q D K     Y G +   +  ++ E    
Sbjct: 738 LNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKS 797

Query: 172 LYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTK 207
            +KG  + + R++   G          N  P+   K
Sbjct: 798 FFKGGAARVLRSSPQFGFTLAAYELFHNIFPLPNDK 833

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 218 GAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVP 277
           G++ G +G  +  P D VK+R+Q+  ++S    +Y   +   L I   EG R +Y G  P
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQRSLS----QYKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 278 KVCRLAPGGSLMLVVFTGMMNFFRD 302
           ++  +AP  ++ L V   M N  +D
Sbjct: 606 QLIGVAPEKAIKLTVNDYMRNKLKD 630

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  112 bits (280), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 133/300 (44%), Gaps = 38/300 (12%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ++G  AG+ E    +PLD +K R Q+          G +  +  G I   + I +KEGF
Sbjct: 14  LMAGGTAGLFEALCCHPLDTIKVRMQI-----YRRVAGIEHVKPPGFIKTGRTIYQKEGF 68

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
             LY+G+ + ++   PK A +F+  + Y+ +  N  +   +T    +            V
Sbjct: 69  LALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLV 128

Query: 136 IVPFELIKIRMQ---------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
           + P E++KIR+Q         +    Y   +      +K EG+  LY+G+  T  R A  
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 187 NGGYFGVI---------YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKS 237
            G  F V          Y   + +P  +T           G I G +G   N P D +K+
Sbjct: 189 QGANFTVYSKLKEFLQNYHQMDVLPSWETS--------CIGLISGAIGPFSNAPLDTIKT 240

Query: 238 RIQSVDAVS----SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           R+Q   ++S    S +KK       LL   +EEGFRALYKG  P+V R+APG ++   V+
Sbjct: 241 RLQKDKSISLEKQSGMKKIITIGAQLL---KEEGFRALYKGITPRVMRVAPGQAVTFTVY 297

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 83/194 (42%), Gaps = 11/194 (5%)

Query: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
           F++G  AGI+E + V+ P++VVK R Q +  TP+    G    +YN  I     IVK+EG
Sbjct: 114 FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAG---PKYNNAIHAAYTIVKEEG 170

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
            S LYRG+S     +A  +   F    + ++  +N    +      +             
Sbjct: 171 VSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPF 230

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTI-------KNEGIMGLYKGIESTMWRNALWN 187
              P + IK R+Q  KS  L     +KK I       K EG   LYKGI   + R A   
Sbjct: 231 SNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQ 290

Query: 188 GGYFGVIYQVRNSM 201
              F V   VR  +
Sbjct: 291 AVTFTVYEYVREHL 304

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 31/186 (16%)

Query: 138 PFELIKIRMQDVKS----SYLGPMDCLK--KTI-KNEGIMGLYKGIESTMWRNALWNGGY 190
           P + IK+RMQ  +      ++ P   +K  +TI + EG + LYKG+ + +          
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVV---------- 79

Query: 191 FGVI---------YQVRNSMPVAKTKG-QKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRI 239
            G+I         Y+   ++ V K  G   T N  +AG   G T   ++  P +VVK R+
Sbjct: 80  IGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRL 139

Query: 240 QSVDAVSS---AVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGM 296
           Q+     S   A  KYN  + +   I +EEG  ALY+G      R A        V++ +
Sbjct: 140 QAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKL 199

Query: 297 MNFFRD 302
             F ++
Sbjct: 200 KEFLQN 205

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 17/106 (16%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG---VIDCLKKIVKK 72
            ISGA+   S      PLD +KTR Q + +          +E+ +G   +I    +++K+
Sbjct: 222 LISGAIGPFSNA----PLDTIKTRLQKDKSI--------SLEKQSGMKKIITIGAQLLKE 269

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL--FNTNET 116
           EGF  LY+GI+  ++  AP +A  F   +  ++  +NL  F  N+T
Sbjct: 270 EGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLGIFKKNDT 315

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 205 KTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVS--SAVKKYNWCLPSLLVI 262
           K K      +L+AG   G    +   P D +K R+Q    V+    VK   + + +   I
Sbjct: 4   KKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGF-IKTGRTI 62

Query: 263 YREEGFRALYKGFVPKVCRLAP 284
           Y++EGF ALYKG    V  + P
Sbjct: 63  YQKEGFLALYKGLGAVVIGIIP 84

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  113 bits (283), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 138/298 (46%), Gaps = 25/298 (8%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I+ F  G++AG    TV+YP+D+VKTR Q +          +   +Y   IDC+ KI + 
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQ----------RNSVQYKNSIDCVVKIFQT 554

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
           +G   LY G+   ++  AP++A K   ND  ++ F N   T +  Q+  I          
Sbjct: 555 KGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQE--ILSGATAGACQ 612

Query: 133 XXVIVPFELIKIRMQDVKSSYLG----PMDCLKKTIKNEGIMGLYKGIESTMWRNALWNG 188
                P E++KIR+Q ++S Y+G    P       I+  G+ GLYKG  + + R+  ++ 
Sbjct: 613 VVFTNPLEIVKIRLQ-MRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSA 671

Query: 189 GYFGVIYQVR----NSMPVAKTKGQ--KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242
            YF     ++    N  P  K K    KT   L+AG I G     L TPFDV+K+R+Q +
Sbjct: 672 IYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQ-I 730

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           D        Y   + +   I +EE  ++ +KG   +V R +P     L  F      F
Sbjct: 731 DPRKGET-TYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLF 787

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 85/196 (43%), Gaps = 36/196 (18%)

Query: 7   AKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQL------EVTTPTAAAVGKQVERYN 60
           ++ + +  + +SGA AG  ++    PL++VK R Q+      E   P   AVG       
Sbjct: 593 SRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVG------- 645

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN--TNETTQ 118
                   I+++ G   LY+G ++ +L + P  A  F     Y  + K++FN   N+  +
Sbjct: 646 --------IIRQLGLRGLYKGAAACLLRDVPFSAIYFPT---YAHLKKDVFNFDPNDKNK 694

Query: 119 KISIXXXXXXXX------XXXXVIVPFELIKIRMQ----DVKSSYLGPMDCLKKTIKNEG 168
           +  +                  +  PF++IK R+Q      +++Y G +   +  +K E 
Sbjct: 695 RNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEES 754

Query: 169 IMGLYKGIESTMWRNA 184
           I   +KG  + + R++
Sbjct: 755 IKSFFKGGPARVLRSS 770

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G +AG+    +  P DV+KTR Q++   P           Y GVI   + I+K+E   
Sbjct: 705 LAGGIAGMPAAYLTTPFDVIKTRLQID---PRKGETT-----YTGVIHAARTILKEESIK 756

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET 116
             ++G  + +L  +P+     A  + +Q +F + F  +ET
Sbjct: 757 SFFKGGPARVLRSSPQFGFTLAAFEMFQGLFPSHFKNHET 796

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  108 bits (269), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 128/287 (44%), Gaps = 16/287 (5%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            I+G  AG+ E    +PLD +K R Q+   +           +  G I   + I  +EG 
Sbjct: 14  LIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGI------KPPGFIKTGRNIYTEEGL 67

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
             LY+G+ + ++   PK A +F+  + Y+    +    + +T    +            V
Sbjct: 68  LALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLV 127

Query: 136 IVPFELIKIRMQD--------VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
           + P E++KIR+Q             Y   +      +K EGI  LY+G+  T  R A   
Sbjct: 128 VNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQ 187

Query: 188 GGYFGVIYQVRNSM-PVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVS 246
           G  F V  +++  +    KT    +      G I G +G   N P D +K+R+Q  D  +
Sbjct: 188 GANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK-DKST 246

Query: 247 SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           + +  ++  +     + +EEGFRALYKG  P+V R+APG ++   V+
Sbjct: 247 ANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVY 293

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 80/192 (41%), Gaps = 10/192 (5%)

Query: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
           F++G  AG +E + V+ P++VVK R Q +   P  AA      RY   +     IVK+EG
Sbjct: 113 FLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAAS----PRYRNALQACYLIVKEEG 168

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
              LYRG+S     +A  +   F    + ++  +    T+      +             
Sbjct: 169 IGALYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPF 228

Query: 135 VIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
              P + IK R+Q  KS+     +   +   K+ IK EG   LYKGI   + R A     
Sbjct: 229 SNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAV 288

Query: 190 YFGVIYQVRNSM 201
            F V   VR  +
Sbjct: 289 TFTVYEFVREHL 300

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 9/174 (5%)

Query: 138 PFELIKIRMQDVKSSYL------GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           P + IK+RMQ  + S L      G +   +     EG++ LYKG+ + +          F
Sbjct: 30  PLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRF 89

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTV-GTMLNTPFDVVKSRIQS--VDAVSSA 248
                 R+++   +T    T N  +AG   GT    ++  P +VVK R+Q+  +   ++A
Sbjct: 90  SSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAA 149

Query: 249 VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
             +Y   L +  +I +EEG  ALY+G      R A        V++ +  F ++
Sbjct: 150 SPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQE 203

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%)

Query: 204 AKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIY 263
           +K K      +LIAG   G    +   P D +K R+Q     +    K    + +   IY
Sbjct: 3   SKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIY 62

Query: 264 REEGFRALYKGFVPKVCRLAP 284
            EEG  ALYKG    V  + P
Sbjct: 63  TEEGLLALYKGLGAVVIGIIP 83

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  105 bits (262), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 136/322 (42%), Gaps = 50/322 (15%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQL--------------------------EVTT 46
           +   ++G  AG+ E    +PLD +K R Q+                              
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 47  PTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
              AA+     +  G I   + I  +EGF  LY+G+ + ++   PK A +F+  + Y+ +
Sbjct: 72  DATAAI-----KPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTL 126

Query: 107 FKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKK---- 162
             +      +T    I            V+ P E++KIR+Q   + +L P   L K    
Sbjct: 127 LADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQ---AQHLNPNHDLAKPKYT 183

Query: 163 --------TIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSM-PVAKTKGQKTRN 213
                    IK EGI  LY+G+  T  R A   G  F V  ++R  +     T+   +  
Sbjct: 184 NAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWE 243

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL--VIYREEGFRAL 271
               G I G +G   N P D +K+R+Q  D  +S   +  W   + +   + +EEGFRAL
Sbjct: 244 TSCIGLISGAIGPFSNAPLDTIKTRLQK-DKSTSFKGESGWKRIAHIGTQLLKEEGFRAL 302

Query: 272 YKGFVPKVCRLAPGGSLMLVVF 293
           YKG  P+V R+APG ++   V+
Sbjct: 303 YKGITPRVMRVAPGQAVTFTVY 324

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 77/194 (39%), Gaps = 11/194 (5%)

Query: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
           FI+G  AG++E + V+ P++VVK R Q +   P          +Y   +     I+K+EG
Sbjct: 141 FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAK---PKYTNAVQAGYTIIKEEG 197

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
            S LYRG+S     +A  +   F    + ++  +    T       +             
Sbjct: 198 ISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPF 257

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKT-------IKNEGIMGLYKGIESTMWRNALWN 187
              P + IK R+Q  KS+        K+        +K EG   LYKGI   + R A   
Sbjct: 258 SNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQ 317

Query: 188 GGYFGVIYQVRNSM 201
              F V   VR  +
Sbjct: 318 AVTFTVYEFVRRHL 331

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ISGA+   S      PLD +KTR Q + +T      G     +  +     +++K+EGF
Sbjct: 249 LISGAIGPFSNA----PLDTIKTRLQKDKSTSFKGESG-----WKRIAHIGTQLLKEEGF 299

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
             LY+GI+  ++  AP +A  F   +  ++  +NL
Sbjct: 300 RALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENL 334

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 24/151 (15%)

Query: 166 NEGIMGLYKGIESTMWRNALWNGGYFGVI---------YQVRNSMPVAKTKGQ-KTRNDL 215
            EG + LYKG+ + +           G+I         Y+   ++   K  G   T N  
Sbjct: 92  QEGFLALYKGLGAVV----------IGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTF 141

Query: 216 IAGAIGG-TVGTMLNTPFDVVKSRIQSVDAVSS---AVKKYNWCLPSLLVIYREEGFRAL 271
           IAG   G T   ++  P +VVK R+Q+     +   A  KY   + +   I +EEG  AL
Sbjct: 142 IAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISAL 201

Query: 272 YKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           Y+G      R A        V++ +  F ++
Sbjct: 202 YRGVSLTAARQATNQGANFTVYSKLREFLQE 232

>Kwal_47.18216
          Length = 333

 Score =  104 bits (259), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/328 (25%), Positives = 138/328 (42%), Gaps = 44/328 (13%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MS+  N+   P I   ++G  AG+ E    +PLD +K R Q+       +   +Q +R  
Sbjct: 1   MSNRKNSSH-PAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIY------SRAREQGQRAR 52

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
           G I   + I  +EGF  LY+G+ + ++   PK A +F   + ++ +  +      +T   
Sbjct: 53  GFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNT 112

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYL-------------------------- 154
            +            V+ P E++KIR+Q     Y+                          
Sbjct: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATEN 172

Query: 155 --------GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSM-PVAK 205
                     +      +K EG   LY+G+  T  R A   G  F V   +++ +    +
Sbjct: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

Query: 206 TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYRE 265
           T    +    + G I G +G   N P D +K+R+Q  D  +S    ++  L     + RE
Sbjct: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQK-DKSTSKDSGWSRILAIGRQLIRE 291

Query: 266 EGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           EGFRALYKG  P+V R+APG ++   V+
Sbjct: 292 EGFRALYKGITPRVMRVAPGQAVTFTVY 319

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 80/214 (37%), Gaps = 28/214 (13%)

Query: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVT--TPTAAAVGKQVE--------------- 57
           F++G  AGI+E + V+ P++VVK R Q +     P  A +   V                
Sbjct: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATEN 172

Query: 58  -----RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN 112
                +Y   I     IVK+EG   LYRG+S     +A  +   F      +   +    
Sbjct: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

Query: 113 TNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNE 167
           T+      +                P + IK R+Q  KS+     +   +   ++ I+ E
Sbjct: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292

Query: 168 GIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSM 201
           G   LYKGI   + R A      F V   +R  +
Sbjct: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 11/95 (11%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ISGA+   S      PLD +KTR Q + +T   +        ++ ++   ++++++EGF
Sbjct: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKDSG-------WSRILAIGRQLIREEGF 294

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
             LY+GI+  ++  AP +A  F   +  +K  + L
Sbjct: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 72/200 (36%), Gaps = 35/200 (17%)

Query: 138 PFELIKIRMQ------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           P + IK+RMQ      +      G +   +     EG + LYKG+ + +          F
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQSVDAV----- 245
                 R  +   +T    T N  +AG   G T   M+  P +VVK R+Q+         
Sbjct: 90  TSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLK 149

Query: 246 -----------------------SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282
                                   +A  KY   + +  VI +EEG RALY+G      R 
Sbjct: 150 AQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQ 209

Query: 283 APGGSLMLVVFTGMMNFFRD 302
           A        V++ + +  ++
Sbjct: 210 ATNQGANFTVYSTLKSRLQE 229

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 4/88 (4%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           +L+AG   G    +   P D +K R+Q         ++    + +   I  +EGF ALYK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           G    V  + P    M + FT    FFR
Sbjct: 73  GLGAVVIGIIPK---MAIRFTS-YEFFR 96

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  102 bits (254), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/316 (25%), Positives = 131/316 (41%), Gaps = 49/316 (15%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQL-----EVTTPTAAAVGKQ 55
           MSS  +  P       ++G  AG+ E    +PLD +K R Q+     E T P        
Sbjct: 49  MSSKKSTNP---AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP------- 98

Query: 56  VERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE 115
                G +     I   EG    Y+G+ + ++   PK A +F+  + Y+ +  +      
Sbjct: 99  -----GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVV 153

Query: 116 TTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDV-------KSSYLGPMDCLKKTIKNEG 168
           +T    +            V+ P E++KIR+Q         +  Y   +      +K EG
Sbjct: 154 STGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG 213

Query: 169 IMGLYKGIESTMWRNALWNGGYFGVI---------YQVRNSMPVAKTKGQKTRNDLIAGA 219
           I  LY+G+  T  R A   G  F V          Y    ++P  +T         + G 
Sbjct: 214 IGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETS--------LIGL 265

Query: 220 IGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL--VIYREEGFRALYKGFVP 277
           + G +G   N P D +K+R+Q   +  +     NW   + +   + +EEGFRALYKG  P
Sbjct: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLS---NWVRITTIGRQLVQEEGFRALYKGITP 322

Query: 278 KVCRLAPGGSLMLVVF 293
           +V R+APG ++   V+
Sbjct: 323 RVMRVAPGQAVTFTVY 338

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 79/192 (41%), Gaps = 11/192 (5%)

Query: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
           F++G  AG++E + V+ P++VVK R Q +     A     + ++Y   I     IVK+EG
Sbjct: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAA-----EQQKYRNAIQAAYLIVKEEG 213

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
              LYRG+S     +A  +   F    +  +  +    +       +             
Sbjct: 214 IGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPF 273

Query: 135 VIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
              P + IK R+Q  KS+     ++      ++ ++ EG   LYKGI   + R A     
Sbjct: 274 SNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAV 333

Query: 190 YFGVIYQVRNSM 201
            F V   VR  +
Sbjct: 334 TFTVYEFVRRHL 345

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 7/172 (4%)

Query: 138 PFELIKIRMQDVKSSYLG--PMDCLK---KTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
           P + IK+RMQ  + +  G  P   L+        EG++  YKG+ + +          F 
Sbjct: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136

Query: 193 VIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQSVDAVSSA-VK 250
                R  +   +T    T N  +AG   G T   ++  P +VVK R+Q+     +A  +
Sbjct: 137 SYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ 196

Query: 251 KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           KY   + +  +I +EEG  ALY+G      R A        V++ +M   ++
Sbjct: 197 KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248

>Kwal_33.15446
          Length = 305

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 130/305 (42%), Gaps = 32/305 (10%)

Query: 3   SDSNA----KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER 58
           SDSNA    +    +  F+SG  +GI++  V +P D +K R Q    T           R
Sbjct: 5   SDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT----------GR 54

Query: 59  YNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ 118
           + G +DC+ + ++++G    Y G + P++      +    C   Y+ + K     +E   
Sbjct: 55  FKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKL 114

Query: 119 KIS--IXXXXXXXXXXXXVIVPFELIKIRMQ---DVKSS-YLGPMDCLKKTIKNEGIMGL 172
            +S  I            +  P EL K ++Q   D +++ Y GP+D +KK    +GI G+
Sbjct: 115 PLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGM 174

Query: 173 YKGIESTM-WRNAL--WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN 229
           YKG+ ST+ +R     W G      Y++      A T    T  +  AG    + G    
Sbjct: 175 YKGLVSTLIFRTHFVYWWGS-----YELLTRWFKANTNLSDTAINFWAGGFSASFGFWTT 229

Query: 230 T-PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
             P DV+K  I   D    +++ +     +   I+R  G R  +KGFVP   R  P  + 
Sbjct: 230 AYPSDVIKQVILCNDKYDGSLRSWR---NAASDIWRTRGIRGFFKGFVPSFLRSFPANAA 286

Query: 289 MLVVF 293
            L  F
Sbjct: 287 ALASF 291

>Scas_489.4
          Length = 297

 Score = 98.2 bits (243), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 130/305 (42%), Gaps = 26/305 (8%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           KP+  ++ FI+GA+AG  E ++ YP +  KTR QL   T TA+     V  YN       
Sbjct: 6   KPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASR-NPLVLIYN------- 57

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXX 127
              K +G   +Y G  + ++    K   +F   D  + + ++      +  +  +     
Sbjct: 58  -TAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGA 116

Query: 128 XXXXXXXVIVPFELIKIRMQDVKSSY--------LGPMDCLKKTIKNEGIMGLYKGIEST 179
                   + PFE IK  + D K +          G +      ++++GIMGLY+G+   
Sbjct: 117 GLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPV 176

Query: 180 MWRNALWN----GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVV 235
             R A       G Y  +   V++     K +   +    I GA  G V      P D V
Sbjct: 177 SMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTV 236

Query: 236 KSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTG 295
           K+R+QS+DA      KY   +     I++EEG +  +KG  P++ RL   G ++  ++  
Sbjct: 237 KTRMQSLDAT-----KYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEN 291

Query: 296 MMNFF 300
           ++ F 
Sbjct: 292 VLVFL 296

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 98.2 bits (243), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 135/296 (45%), Gaps = 35/296 (11%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            I+G  AG+ E    +PLD +K R Q+        AVG  V +  G I    +I + EGF
Sbjct: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKN-----AVGSGV-KAPGFIKTGGEIYRNEGF 67

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
              Y+G+ + ++   PK A +F+  + Y+ +  +      +T    I            V
Sbjct: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVV 127

Query: 136 IVPFELIKIRMQDVKSSYLGPMDCLKK----------TIKNEGIMGLYKGIESTMWRNAL 185
           + P E++KIR+Q   + +L P++   K           +K EG   LY+G+  T  R A 
Sbjct: 128 VNPMEVVKIRLQ---AQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184

Query: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSRI 239
             G  F V  +++  +     +G   +  L      + G I G +G   N P D +K+R+
Sbjct: 185 NQGANFTVYSKLKEFL-----QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239

Query: 240 QSVDAVS--SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           Q   +    S +K+       L+   +EEGFRALYKG  P+V R+APG ++    +
Sbjct: 240 QKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKGITPRVMRVAPGQAVTFTAY 292

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 14/98 (14%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ISGA+   S      PLD +KTR Q + +T   + + +       +    K+++++EGF
Sbjct: 219 LISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKR-------ITIIGKQLIQEEGF 267

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT 113
             LY+GI+  ++  AP +A  F     Y+ I K L  T
Sbjct: 268 RALYKGITPRVMRVAPGQAVTFTA---YEFIRKELEKT 302

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 209 QKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSV-DAVSSAVKKYNWCLPSLLVIYR 264
           QK+ N   +LIAG   G +  +   P D +K R+Q   +AV S VK   + + +   IYR
Sbjct: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGF-IKTGGEIYR 63

Query: 265 EEGFRALYKGFVPKVCRLAP 284
            EGF A YKG    V  + P
Sbjct: 64  NEGFLAFYKGLGAVVIGITP 83

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 75/173 (43%), Gaps = 10/173 (5%)

Query: 138 PFELIKIRMQDVKSSY------LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           P + IK+RMQ  K++        G +    +  +NEG +  YKG+ + +          F
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQS--VDAVSSA 248
                 R  +   +T    T N  IAG   G T   ++  P +VVK R+Q+  ++ V  A
Sbjct: 90  SSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGA 149

Query: 249 VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
             KY   + +   I +EEGF ALY+G      R A        V++ +  F +
Sbjct: 150 -PKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQ 201

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 96.3 bits (238), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 134/333 (40%), Gaps = 51/333 (15%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGK-------------------- 54
           + +S +   +     + PLDVV+ R   +   P+    G+                    
Sbjct: 14  RMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGC 73

Query: 55  --QVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN 112
                R  G ++ L+KI + EG   L+RG+   ++M  P     F+    Y+ +  N   
Sbjct: 74  REPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNSPL 130

Query: 113 TNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDV-------KSSYLGPMDCLKKTIK 165
            +       +             I P EL++ R+Q V       ++ YL   D L++   
Sbjct: 131 ASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYL-IGDLLREMRH 189

Query: 166 NEGIMG---LYKGIESTMWRNALWNGGYFGVI------YQVRNSMPVAKTKGQKTRNDLI 216
              +MG   L+KG+E T+WR+  ++  Y+G        +  R++     +          
Sbjct: 190 EVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFA 249

Query: 217 AGAIGGTVGTMLNTPFDVVKSRIQ---------SVDAVSSAVKKYNWCLPSLLVIYREEG 267
            G++GG V  +L  PFDV K+R+Q         +V   ++           L  I + EG
Sbjct: 250 CGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEG 309

Query: 268 FRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            RALY G +P+V ++AP  ++M+  +     FF
Sbjct: 310 IRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN---GVIDCLKK 68
           FI  F  G++ G     + +P DV KTR Q+ + +P    VG +  + +   G+   L  
Sbjct: 244 FIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA 303

Query: 69  IVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109
           I K EG   LY G+   ++  AP  A   +  +  +K F +
Sbjct: 304 IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFTS 344

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 70/190 (36%), Gaps = 23/190 (12%)

Query: 7   AKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCL 66
           A  LP     + GA A I   T + PL++++TR Q   + P A    + +     ++  +
Sbjct: 131 ASRLPVANPLVCGAFARILAATTIAPLELLRTRLQ---SVPRARDTERTIYLIGDLLREM 187

Query: 67  KKIVKKEGFSRLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNTNETTQKI-S 121
           +  V   G+  L++G+   +  + P  A  +     C  Q+        N +     I S
Sbjct: 188 RHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGS 247

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQDVKSS---------------YLGPMDCLKKTIKN 166
                        +  PF++ K RMQ   +S                 G    L    K+
Sbjct: 248 FACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKS 307

Query: 167 EGIMGLYKGI 176
           EGI  LY G+
Sbjct: 308 EGIRALYTGL 317

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 96.3 bits (238), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 119/282 (42%), Gaps = 28/282 (9%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I  F+SG  +GI++  V +P D +K R Q            +   R+ G +DC+ K   +
Sbjct: 61  IMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----------TSQDSTRFKGPLDCVYKTFTQ 110

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IXXXXXXXX 130
           +G    Y G + P++      +    C   Y+ + K     NE    +S  I        
Sbjct: 111 QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGW 170

Query: 131 XXXXVIVPFELIKIRMQ---DVKSS-YLGPMDCLKKTIKNEGIMGLYKGIESTM-WRN-- 183
               +  P EL K ++Q   D K++ Y GP+D +KK   + G+ GLYKG+ ST+ +R   
Sbjct: 171 SVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNF 230

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT-PFDVVKSRIQSV 242
             W G      Y++        T    T  +  +G    + G      P DV+K  +   
Sbjct: 231 VFWWGS-----YELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCN 285

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           D      +  +W L +   I+R  G+R  +KGFVP   R  P
Sbjct: 286 DKYDGTFR--SWKLAA-KDIWRTRGYRGFFKGFVPSFLRSFP 324

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           N + LP     ISG +AG S   +  P+++ K + Q++    T         +Y G +D 
Sbjct: 152 NEEKLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTT--------KYTGPVDV 203

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEA 90
           +KK+    G   LY+G++S ++   
Sbjct: 204 IKKVYSSNGVRGLYKGLTSTLIFRT 228

>Kwal_23.4354
          Length = 343

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 140/341 (41%), Gaps = 58/341 (17%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTP----------TAAAV 52
           +D   K +    + +S  V  +    ++ P+DVV+ R Q +   P          T+ A 
Sbjct: 2   ADEKQKGIGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRAS 61

Query: 53  GKQV----------------ERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATK 96
            K V                 RYN   D   KI K EG   L+RG+S  +LM AP     
Sbjct: 62  SKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVY 121

Query: 97  FACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDV------K 150
           F     Y+ +       ++      +             + P EL + R+Q +       
Sbjct: 122 FI---GYESLRDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKS 178

Query: 151 SSYLGPMDCLKKT---IKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTK 207
           ++ +   D +K++   I   G   L++G+E T+WR+  ++  Y+G     ++++ +   K
Sbjct: 179 TTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEK 238

Query: 208 G---------QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPS 258
                         N  + G+ GG V  +L  PFDV K+R+Q     S+  KK     PS
Sbjct: 239 SIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKK-----PS 293

Query: 259 ------LLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                 L  + + EG  ALY G VP+V ++AP  ++M+  +
Sbjct: 294 KNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTY 334

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 7/106 (6%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPT-AAAVGKQVERYNG 61
           + SN+    F+  F+ G+  G     + +P DV KTR Q+     T      K + +Y  
Sbjct: 242 NSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKY-- 299

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF 107
               L ++ K EG + LY G+   ++  AP  A   +  +  +++F
Sbjct: 300 ----LNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 93.6 bits (231), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 131/312 (41%), Gaps = 28/312 (8%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MS DS  K +     F++GA+AG  E ++ YP +  KTR QL +   + A+    V  YN
Sbjct: 1   MSKDS--KKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQL-IDKSSKASRNPLVLIYN 57

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
                     K +G   +Y G  + ++    K AT+F   D  + + K+      +  + 
Sbjct: 58  --------TAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRG 109

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRM----QDVKSSYLGPMDCLKKT----IKNEGIMGL 172
            +             + PFE IK  +    Q V+  Y      + +     +K+EG  GL
Sbjct: 110 VLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGL 169

Query: 173 YKGIESTMWRNALWN----GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTML 228
           Y G+     R A       G Y  +   V++     K K   +    I GA  G V    
Sbjct: 170 YGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYA 229

Query: 229 NTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
             P D VK+R+QS+ A      KY+  L     IY+EEG +  +KG  P++ RL   G +
Sbjct: 230 TMPIDTVKTRMQSLTA-----SKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGI 284

Query: 289 MLVVFTGMMNFF 300
           +  ++  ++ + 
Sbjct: 285 VFTIYENVLLYL 296

>Scas_667.22
          Length = 306

 Score = 93.6 bits (231), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 138/297 (46%), Gaps = 40/297 (13%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I   ++G   GI+++ V  P D  K R Q   +TPT A            ++ ++K++K 
Sbjct: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPTTA------------MEVIRKLLKN 72

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX----XXXX 128
           EG    Y+G  +P++      + +F  N+  ++ F +  N + T+Q +S+          
Sbjct: 73  EGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTSQILSLPQYYICGLTG 131

Query: 129 XXXXXXVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                 +  P E ++IR+Q    S     + GP+DC++K ++ +G  G  +G+  TM R 
Sbjct: 132 GITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRK-LRAQG--GFMRGLTPTMLRE 188

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKS 237
               G YF ++Y+   +  +   KG K R ++ A      GA+ GT   M+  P DV+KS
Sbjct: 189 GHGCGTYF-LVYEAMVANEI--NKGFK-RTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244

Query: 238 RIQSVDAVSSAVKKYNWCLPSLL-VIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
            +Q+ +  S    KY   + S+   +Y + G  A +KGF P + R AP        F
Sbjct: 245 VMQTDNLKSP---KYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATF 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 85/194 (43%), Gaps = 17/194 (8%)

Query: 4   DSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI 63
           DS ++ L     +I G   GI+   +  P++ V+ R Q      T    G  VE + G +
Sbjct: 113 DSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQ------TQTGSGPNVE-FKGPL 165

Query: 64  DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQY--QKIFKNLFNTNETTQKIS 121
           DC++K+  + GF    RG++  ML E     T F   +     +I K    T     K+ 
Sbjct: 166 DCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLC 222

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQ--DVKS-SYLGPMDCLKKTIKNEGIMG-LYKGIE 177
           +            ++ P ++IK  MQ  ++KS  Y   +  + KT+  +G +G  +KG  
Sbjct: 223 L-FGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFG 281

Query: 178 STMWRNALWNGGYF 191
            TM R A  NG  F
Sbjct: 282 PTMLRAAPANGATF 295

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           DL+AG  GG    ++  PFD  K R+Q+    ++A++     L       + EG +  YK
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVIRKLL-------KNEGPKGFYK 80

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           G +  +  +    SL   V   M  FF  
Sbjct: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHS 109

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 93.2 bits (230), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 127/290 (43%), Gaps = 31/290 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ++G   G+S++ +  P D  K R Q   + PT A            +D +KK+VK EGF
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTS-SVPTTA------------LDVVKKLVKNEGF 73

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX----XXXXXXX 131
              Y+G  +P++      + +F  N+  ++ F +    +   + + +             
Sbjct: 74  RGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTA 133

Query: 132 XXXVIVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
              +  P E ++IR+Q        + + GP+DC+KK   N  +M   +G+  TM R +  
Sbjct: 134 NSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLM---RGLTPTMLRESHG 190

Query: 187 NGGYFGVIYQ--VRNSMPVAKTKGQ-KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243
            G YF + Y+  + N +    ++ +  T    + GA  GT   ++  P DV+KS +Q+ D
Sbjct: 191 CGVYF-LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQT-D 248

Query: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           ++    +  N  L     IY   G  + +KGF P + R AP        F
Sbjct: 249 SLLQPKQGKNM-LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 13/92 (14%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSA---VKKYNWCLPSLLVIYREEGFRA 270
           DL+AG  GG    ++  PFD  K R+Q+    ++A   VKK          + + EGFR 
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTALDVVKK----------LVKNEGFRG 75

Query: 271 LYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
            YKG +  +  +    S+   V   M  FF  
Sbjct: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHS 107

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/310 (29%), Positives = 136/310 (43%), Gaps = 50/310 (16%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           +G + GI+++ V  P D  K R Q   T  T              ++ L+ +VK EG   
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-------------LEVLRNLVKNEGVFA 86

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF---NTNETTQKISIXXXXXXXXXXXX 134
            Y+G  +P+L      + +F  N+  ++ F+N     N N ++Q + +            
Sbjct: 87  FYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYY 146

Query: 135 VI------------VPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIE 177
           V              P E I+IR+Q   S+     + GP DC+KK +K +G  GL +G+ 
Sbjct: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKK-LKAQG--GLMRGLF 203

Query: 178 STMWRNALWNGGYFGVIYQVRNSMPVAKTKGQK-TRNDL------IAGAIGGTVGTMLNT 230
            TM R     G YF ++Y+      VA+  G   TRN++      + GA  GT+  +   
Sbjct: 204 PTMIRAGHGLGTYF-LVYEAL----VAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVY 258

Query: 231 PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
           P DVVKS IQ+ D      K  N        IY +EG RA +KGF P + R AP      
Sbjct: 259 PLDVVKSIIQNDDLRKPKYK--NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATF 316

Query: 291 VVFTGMMNFF 300
           + F  +M F 
Sbjct: 317 LTFELVMRFL 326

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 76/195 (38%), Gaps = 21/195 (10%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S +  LP    ++ G   G+    +  P++ ++ R Q      T  + G   E + G  D
Sbjct: 135 SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ------TQTSNGGDRE-FKGPWD 187

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--- 121
           C+KK+  + G   L RG+   M+       T F     Y+ +      T  T  +I    
Sbjct: 188 CIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWK 241

Query: 122 -IXXXXXXXXXXXXVIVPFELIKIRMQD---VKSSYLGPMDCLKKTI-KNEGIMGLYKGI 176
                          + P +++K  +Q+    K  Y   +  + KTI   EGI   +KG 
Sbjct: 242 LCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301

Query: 177 ESTMWRNALWNGGYF 191
             TM R+A  NG  F
Sbjct: 302 GPTMVRSAPVNGATF 316

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           D+ AG IGG    ++  PFD  K R+Q+    ++        L  L  + + EG  A YK
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-------LEVLRNLVKNEGVFAFYK 89

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           G +  +  +    S+   V   M  FF++
Sbjct: 90  GALTPLLGVGICVSVQFGVNEAMKRFFQN 118

>Kwal_27.12081
          Length = 369

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 140/329 (42%), Gaps = 33/329 (10%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAA---------AVG 53
           S  +A+  P+++ F++G   G++   V  P DVVKTR Q +V   T A          V 
Sbjct: 44  SSVSAEVKPWVH-FVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVS 102

Query: 54  KQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT 113
             +  +      +  + K EGF  L++G+   ++   P R+  F      ++I+   FN 
Sbjct: 103 SGIRHFRETFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNN 162

Query: 114 NETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKS----SYLGPMDCLKKTIKNEGI 169
            E    I +               P  LIK R+Q  K+     Y    DCLK  I+ EG 
Sbjct: 163 GEEAPWIHLISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGF 222

Query: 170 MGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKT--------KGQKTRNDLI----- 216
            GLYKG+ ++   +    G    ++Y+    M   ++        +G+K  ++ I     
Sbjct: 223 FGLYKGLSASYLGSV--EGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQ 280

Query: 217 ---AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
              +  +   + +++  P +VV++R++     +  +K Y   + S  VI +EEG  ++Y 
Sbjct: 281 RSGSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLK-YTGLIQSFRVIIKEEGLASMYG 339

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           G  P + R  P   +M   +  ++    D
Sbjct: 340 GLTPHLLRTVPNSIIMFGTWELVIKLLSD 368

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 127/305 (41%), Gaps = 26/305 (8%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MSS +    +  ++ F++G++AG +E  + YP +  KTR QL         + K  +   
Sbjct: 1   MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQL---------IDKASKASR 51

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
             +  + K  K +G   +Y G  + ++    K   +F   D  + + ++      +  + 
Sbjct: 52  NPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRG 111

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYL--------GPMDCLKKTIKNEGIMGL 172
            I             + PFE IK  + D K S          G +      ++++G  GL
Sbjct: 112 VIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGL 171

Query: 173 YKGIESTMWRNALWN----GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTML 228
           Y+G+     R A       G Y  +   +++     K K   +    + GA  G V    
Sbjct: 172 YRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYS 231

Query: 229 NTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
             P D VK+R+QS+D+      KY+  +     I++EEG +  +KG  P++ RL   G +
Sbjct: 232 TMPLDTVKTRMQSLDST-----KYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGI 286

Query: 289 MLVVF 293
           +  ++
Sbjct: 287 VFTIY 291

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 10/201 (4%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISE-LTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY 59
           M  DS    L      I+G  AG+ E +  + P + +KT     +     +A  K     
Sbjct: 97  MLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKT----ALIDDKQSATPKYHNNG 152

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET--- 116
            GV+     +V+ +GFS LYRG+    + +A  +A +  C ++ + + ++  ++ +    
Sbjct: 153 RGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPL 212

Query: 117 TQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS-YLGPMDCLKKTIKNEGIMGLYKG 175
           +  ++               +P + +K RMQ + S+ Y   M+C     K EG+   +KG
Sbjct: 213 SSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKG 272

Query: 176 IESTMWRNALWNGGYFGVIYQ 196
               + R  L +GG    IY+
Sbjct: 273 ATPRLGRLVL-SGGIVFTIYE 292

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 79/176 (44%), Gaps = 10/176 (5%)

Query: 135 VIVPFELIKIRMQ---DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           +  PFE  K R+Q       +   P+  + KT K +GI  +Y G  + +  N    G  F
Sbjct: 29  ITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRF 88

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN-TPFDVVKSRIQSVDAVSSAVK 250
                +++ +  ++T        +IAG   G + ++   TPF+ +K+ +  +D   SA  
Sbjct: 89  LGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTAL--IDDKQSATP 146

Query: 251 KYN----WCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           KY+      + +   + R++GF  LY+G +P   R A   ++ L  +  +    +D
Sbjct: 147 KYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQD 202

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 123/289 (42%), Gaps = 25/289 (8%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           F++G +A    +TV  P D VKTR QL+      AA     + Y   I     I K EG 
Sbjct: 24  FVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAA-----KVYTNPIQAFGVIFKNEGI 78

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK-----ISIXXXXXXXX 130
           + L +G++S  L +     ++    +  + I  N+F  N  + K     I++        
Sbjct: 79  AGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGV 138

Query: 131 XXXXVIVPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
               +  P  L+K RMQ          ++ Y    + L    ++EGI GL++G+++ M R
Sbjct: 139 VGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLR 198

Query: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQS 241
             + +     +    +N +         T   L++  I G  VG  +N P+DVV +R+ +
Sbjct: 199 TGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMN-PWDVVLTRVYN 257

Query: 242 VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
                     Y+  +   +   R EG  ALYKGF  ++ R+ P   L L
Sbjct: 258 QKG-----NLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCL 301

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 82/181 (45%), Gaps = 21/181 (11%)

Query: 138 PFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNG-- 188
           PF+ +K RMQ       +    Y  P+       KNEGI GL KG+ S        NG  
Sbjct: 40  PFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSR 99

Query: 189 -GYFGVIYQVRNSMPVAKTKGQKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
            G++  I  + N++     +  K ++   ++ AGA  G VG  + +P  +VK+R+QS   
Sbjct: 100 LGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQS--- 156

Query: 245 VSSAVK-----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
            S+A+       Y      L  I+R EG + L++G    + R   G ++ L ++    NF
Sbjct: 157 YSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNF 216

Query: 300 F 300
            
Sbjct: 217 L 217

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 91.7 bits (226), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 135/311 (43%), Gaps = 45/311 (14%)

Query: 9   PLPF---IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           P P+   +    +G + G++++ V  P D  K R Q   T               GVI+ 
Sbjct: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK-------------IGVIEV 66

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXX 125
           ++ +++ EG    Y+G+ +P+L      + +F  N+  ++ F   +N +    +  +   
Sbjct: 67  VQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAA-YNADRVDPQKHVPLP 125

Query: 126 XXXX--------XXXXXVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGL 172
                            +  P E ++IR+Q   S      + GP DC+KK  K + +M  
Sbjct: 126 LHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALM-- 183

Query: 173 YKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGT 226
            +G+  TM R     G YF        ++ V + +    RN + A      GA+ GT+  
Sbjct: 184 -RGLLPTMIRAGHGLGTYFAAY----EALVVKEFEKGTPRNQIPAWKLCSFGALSGTILW 238

Query: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGG 286
           +   P DVVKS +Q+ D++ +  K  N  + +   +Y++ G  A +KGFVP + R AP  
Sbjct: 239 LTVYPVDVVKSVLQT-DSIENP-KYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPAN 296

Query: 287 SLMLVVFTGMM 297
           +   V F   M
Sbjct: 297 AATFVSFEMTM 307

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 7/87 (8%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           D+ AG +GG    ++  PFD  K R+Q+       ++     L       R EG  A YK
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGVIEVVQNLL-------RNEGALAFYK 81

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           G +  +  +    S+   V   M  FF
Sbjct: 82  GMLTPLLGVGICVSVQFGVNESMKRFF 108

>Scas_645.9
          Length = 391

 Score = 92.8 bits (229), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 119/256 (46%), Gaps = 27/256 (10%)

Query: 58  RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT 117
           R+NG ++   KI K EG + L+RGIS  +LM  P     F     Y+ +  N      + 
Sbjct: 128 RFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFT---GYEYLRDNSPLATSSP 184

Query: 118 QKISIXXXXXXXXXXXXVIVPFELIKIRMQDV------KSSYLGPMDCLKKTIKNEGIMG 171
               +             + P EL+K ++Q +       +S++   + LK+T +   I G
Sbjct: 185 TFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISG 244

Query: 172 ----LYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTR----NDLIAGAIGGT 223
               L+KG+E T+WR+  ++  Y+G     +  + +  +K         N  I G+I GT
Sbjct: 245 ASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGT 304

Query: 224 VGTMLNTPFDVVKSRIQ---------SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274
           +  ++  PFDV K+R Q         SV   S  +++       L  I++ EG+ ALY G
Sbjct: 305 IAALVTHPFDVGKTRWQISFMGNNDKSV-VKSPDIEQTKNMFKFLRNIWKLEGWGALYTG 363

Query: 275 FVPKVCRLAPGGSLML 290
            VP++ ++AP  ++M+
Sbjct: 364 LVPRMVKIAPSCAIMI 379

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGK--QVERY 59
           +S S++    FI  FI G+++G     V +P DV KTR+Q+        +V K   +E+ 
Sbjct: 282 TSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQT 341

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF 107
             +   L+ I K EG+  LY G+   M+  AP  A   +  +  +++F
Sbjct: 342 KNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

>Kwal_26.7967
          Length = 297

 Score = 91.7 bits (226), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 126/305 (41%), Gaps = 29/305 (9%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MS      PL   + F++G++AG  E ++ YP +  KTR QL   + TA+          
Sbjct: 1   MSQKKQVDPL---HSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTAS---------R 48

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
             +  + +  K +G   +Y G  + ++    K   +F   D  + I ++      +  + 
Sbjct: 49  NPLTLIYRTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRG 108

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSY--------LGPMDCLKKTIKNEGIMGL 172
            +             + PFE IK  + D K S          G +      + ++G  GL
Sbjct: 109 IVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGL 168

Query: 173 YKGIESTMWRNALWN----GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTML 228
           Y+G+     R A       G Y  +   +++    AK K   +    + GA  G V    
Sbjct: 169 YRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYT 228

Query: 229 NTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
             P D VK+R+QS+D+      KY+  +     ++REEG +  +KG  P++ RL   G +
Sbjct: 229 TMPIDTVKTRMQSLDS-----SKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGI 283

Query: 289 MLVVF 293
           +  ++
Sbjct: 284 VFTIY 288

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 82/185 (44%), Gaps = 10/185 (5%)

Query: 17  ISGAVAGISELTV-MYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           ++G  AG+ E  V + P + +KT     +     +A  K      G++     +V  +GF
Sbjct: 110 VAGLGAGLLESVVAVTPFEAIKT----ALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGF 165

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET---TQKISIXXXXXXXXXX 132
           S LYRG+    + +A  +A +  C ++ + + ++  N+ +    +  ++           
Sbjct: 166 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVT 225

Query: 133 XXVIVPFELIKIRMQDVKSS-YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
               +P + +K RMQ + SS Y   ++C     + EG+   +KG    + R  + +GG  
Sbjct: 226 VYTTMPIDTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGR-LILSGGIV 284

Query: 192 GVIYQ 196
             IY+
Sbjct: 285 FTIYE 289

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 78/176 (44%), Gaps = 10/176 (5%)

Query: 135 VIVPFELIKIRMQDVKSSYLG---PMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           +  PFE  K R+Q V  S      P+  + +T K +G+  +Y G  + +  N    G  F
Sbjct: 26  ITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPAFIVGNTAKAGVRF 85

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN-TPFDVVKSRIQSVDAVSSAVK 250
                ++N +    T        ++AG   G + +++  TPF+ +K+ +  +D   SA  
Sbjct: 86  LGFDAIKNILRDPTTGELSGPRGIVAGLGAGLLESVVAVTPFEAIKTAL--IDDKQSASP 143

Query: 251 KYNWCLPSLLVIYR----EEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           KY+     +L  Y     ++GF  LY+G +P   R A   ++ L  +  +    +D
Sbjct: 144 KYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQD 199

>Scas_718.5
          Length = 324

 Score = 91.7 bits (226), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 141/316 (44%), Gaps = 37/316 (11%)

Query: 2   SSDSNAKPLPFIYQ-FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           SS S AK    + +  ++G   GIS++ V  P D  K R Q      +A +VG       
Sbjct: 28  SSHSMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQ-----TSAKSVG------- 75

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
             +D ++K+VK EG    Y+G   P++      + +F  N+  ++ F+  +NT+  TQ  
Sbjct: 76  -ALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFRE-WNTSRGTQHR 133

Query: 121 S--------IXXXXXXXXXXXXVIVPFELIKIRMQDV-----KSSYLGPMDCLKKTIKNE 167
                                 +  P E ++IR+Q       +  + GP+DC++K +K +
Sbjct: 134 DGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK 193

Query: 168 GIMGLYKGIESTMWRNALWNGGYFGVIYQ--VRNSMPVAKTKGQKTRNDLIA-GAIGGTV 224
            +M   +G+   M R     G YF + Y+  + N +   K + +     L + G++ G V
Sbjct: 194 SLM---RGLRPMMLRAGHGLGCYF-LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVV 249

Query: 225 GTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
             +   P DVVKS IQ+ D + +   K N     +  +YRE+G  A +KGF P + R AP
Sbjct: 250 LWLAIYPLDVVKSMIQT-DTLRNPRFK-NSMKNVINHLYREQGISAFFKGFAPTMLRAAP 307

Query: 285 GGSLMLVVFTGMMNFF 300
                 V F  +M   
Sbjct: 308 VNGATFVTFELVMRLL 323

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           D++AG  GG    ++  PFD  K R+Q+      A       L  +  + + EG  A YK
Sbjct: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA-------LDIIRKLVKNEGVWAFYK 94

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           G +  +  +    S+   V   M  FFR+
Sbjct: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFRE 123

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 91.7 bits (226), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 127/287 (44%), Gaps = 39/287 (13%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I   ISG   GI+++ V  P D+ K R Q    +PTA             I+ +K +VK 
Sbjct: 24  IKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA-------------IEVIKNLVKN 70

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXX----X 128
           EG    Y+G   P++      + +F  N+  ++ F  +    +  Q +S+          
Sbjct: 71  EGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKD--QHLSLLQYYTCGFVS 128

Query: 129 XXXXXXVIVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                 +  P E ++IR+Q       K+ Y G +DC+KK +K + +M   +G  +T+ R 
Sbjct: 129 GSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALM---RGFTATLMRT 185

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKS 237
           +  +G  FGV +    ++ + + K    R D+      + GA  G     +  PFDVVKS
Sbjct: 186 S--HG--FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKS 241

Query: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
            +Q+ D + S V   N        I+   G+ A  KGFVP + R  P
Sbjct: 242 IMQA-DRLVSPVHGKN-VFQVAKSIHATRGWGAFVKGFVPTMLRSLP 286

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 209 QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGF 268
           +K   D+I+G  GG    ++  PFD+ K R+Q+     +A++     + +L+   + EG 
Sbjct: 21  RKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTAIE----VIKNLV---KNEGL 73

Query: 269 RALYKG-FVPKV 279
            A YKG  VP +
Sbjct: 74  LAFYKGTLVPLI 85

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           + L  +  +  G V+G +   +  P++ V+ R QL+      A        Y G +DC+K
Sbjct: 114 QHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKA-------EYRGSLDCMK 166

Query: 68  KIVKKEGFSRLYRGISSPML 87
           K++K++    L RG ++ ++
Sbjct: 167 KLLKQKA---LMRGFTATLM 183

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 92.4 bits (228), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 141/322 (43%), Gaps = 36/322 (11%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEV-------------TTP 47
           +  DS     P+++ F++G + G++   V  P DVVKTR Q +V              + 
Sbjct: 40  IKDDSQPAVKPWVH-FVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSS 98

Query: 48  TAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF 107
           T   V + +  +      +  + ++EGF  L++G+   ++   P R+  F      + I+
Sbjct: 99  TLHFVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIY 158

Query: 108 KNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKS---SYLGPMDCLKKTI 164
               N  +    I +            V  P  L+K R+Q  K+   +Y   +DC+K  +
Sbjct: 159 SRTLNNGQEAPWIHLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVV 218

Query: 165 KNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKT--------KGQKTRNDLI 216
           KNEG++GLYKG+ ++   +    G    ++Y+    +   ++        +  K+ +D +
Sbjct: 219 KNEGVLGLYKGLSASYLGSV--EGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKV 276

Query: 217 --------AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGF 268
                   +  +   V +++  P +VV++R++     +  + KY   + S  VI +EEG 
Sbjct: 277 KEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKL-KYTGLVQSFRVIIKEEGL 335

Query: 269 RALYKGFVPKVCRLAPGGSLML 290
            ++Y G  P + R  P   +M 
Sbjct: 336 VSMYSGLTPHLLRTVPNSIIMF 357

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 19/82 (23%)

Query: 231 PFDVVKSRIQS-------------------VDAVSSAVKKYNWCLPSLLVIYREEGFRAL 271
           PFDVVK+R+QS                   +  VS ++  +      +  +YR+EGFR+L
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 272 YKGFVPKVCRLAPGGSLMLVVF 293
           +KG  P +  + P  S+  + +
Sbjct: 130 FKGLGPNLVGVIPARSINFLTY 151

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 90.5 bits (223), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 122/305 (40%), Gaps = 39/305 (12%)

Query: 1   MSSDSNAKPLPF-----------IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTA 49
           MS  SNA   P            I  F++G  +G+++  V +P D +K R Q        
Sbjct: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-------- 52

Query: 50  AAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109
               +   R+ G +DC+ K  + +G    Y G + P++      +    C   Y+ +   
Sbjct: 53  --TSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHK 110

Query: 110 LFNTNETTQKIS--IXXXXXXXXXXXXVIVPFELIKIRMQ----DVKSSYLGPMDCLKKT 163
               N+    +S  I            +  P EL K ++Q       + Y GP+D +KK 
Sbjct: 111 YVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKI 170

Query: 164 IKNEGIMGLYKGIESTM-WRNAL--WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAI 220
              +GI GLYKG+ ST+ +R     W G Y  +    R +     TK  +   +  AG  
Sbjct: 171 YSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFREN-----TKMSEAAINFWAGGF 225

Query: 221 GGTVGTMLNT-PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKV 279
             + G      P DVVK  +   D    + K +     ++  IY+ +G    +KGFVP  
Sbjct: 226 SASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWR---TAVKDIYQSKGINGFFKGFVPSF 282

Query: 280 CRLAP 284
            R  P
Sbjct: 283 LRSFP 287

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 122/290 (42%), Gaps = 26/290 (8%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           FI+G +AG  E +V YP +  KTR QL +   + A+    V  YN          K +G 
Sbjct: 13  FIAGCLAGAVEASVTYPFEFAKTRLQL-LDKASKASRNPLVLIYN--------TAKTQGI 63

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
             +Y G  + ++    K   +F   D  + + ++      +  +  I             
Sbjct: 64  GSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLLESVVA 123

Query: 136 IVPFELIKIRMQDVKSSYL--------GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
           + PFE IK  + D K S          G +      ++ +G+ GLY+G+     R A   
Sbjct: 124 VTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQ 183

Query: 188 ----GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243
               G Y  +   V++     K K   +    + GA  G V      P D VK+R+QS+D
Sbjct: 184 AVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLD 243

Query: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           +     K+Y+  +     I++EEG +A +KG  P++ RL   G ++  V+
Sbjct: 244 S-----KRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVY 288

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 13/188 (6%)

Query: 17  ISGAVAGISELTV-MYPLDVVKTRF--QLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKE 73
           I+G  AG+ E  V + P + +KT      +  TP     GK      G++     +V+K+
Sbjct: 110 IAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGK------GMLRNYTALVRKQ 163

Query: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET---TQKISIXXXXXXXX 130
           G S LYRG+    + +A  +A +  C ++ + + ++  N  +    +  ++         
Sbjct: 164 GLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGI 223

Query: 131 XXXXVIVPFELIKIRMQDVKSS-YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
                 +P + +K RMQ + S  Y   ++C     K EG+   +KG    + R  L  G 
Sbjct: 224 VTVYTTMPIDTVKTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGI 283

Query: 190 YFGVIYQV 197
            F V  +V
Sbjct: 284 VFTVYEKV 291

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIY---REEGFRA 270
             IAG + G V   +  PF+  K+R+Q +D  S A +        L++IY   + +G  +
Sbjct: 12  SFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRN------PLVLIYNTAKTQGIGS 65

Query: 271 LYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           +Y G    +        +  + F  + N  RD
Sbjct: 66  VYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRD 97

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 137/321 (42%), Gaps = 35/321 (10%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEV-----------TTPTAA 50
           SS  N K +     F++G + G++   V  P DVVKTR Q +V             P  A
Sbjct: 42  SSQQNIKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQA 101

Query: 51  AVGKQ-VERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109
            V  Q V  +      +  + + EGF  L++G+   ++   P R+  F      ++I+  
Sbjct: 102 NVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK 161

Query: 110 LFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKS----SYLGPMDCLKKTIK 165
             N  +    I +               P  L+K R+Q  K+     Y    DCLK  ++
Sbjct: 162 TLNNGQEAVWIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQ 221

Query: 166 NEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAK--------TKGQKTRNDLI- 216
            EGI+GLYKG+ ++   +    G    V+Y+    +   +        ++ +K+ +D I 
Sbjct: 222 KEGILGLYKGLSASYLGSV--EGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIK 279

Query: 217 -------AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFR 269
                  +  +   V +++  P +VV++R++    + +   KY   + S+ VI +EEG  
Sbjct: 280 EWCQRSGSAGLAKFVASIITYPHEVVRTRLRQA-PLENGKLKYTGLVQSIRVIIKEEGLA 338

Query: 270 ALYKGFVPKVCRLAPGGSLML 290
           ++Y G  P + R  P   +M 
Sbjct: 339 SMYGGLTPHLLRTVPNSIIMF 359

>Scas_721.27
          Length = 374

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 140/328 (42%), Gaps = 50/328 (15%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEV---------TTPTAAAVG 53
           S  N KP      F++G + G++   V  P D+VKTR Q ++          T TAA   
Sbjct: 46  SHPNVKPW---VHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNS 102

Query: 54  KQVE-------RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
           K           +      L  + K+EGF  L++G+   ++   P R+  F      ++I
Sbjct: 103 KIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEI 162

Query: 107 FKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS----YLGPMDCLKK 162
           +   FN  + T  I +               P  +IK R+Q  K+     Y    DCLK 
Sbjct: 163 YSKAFNNGQETPLIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKT 222

Query: 163 TIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQV----------RNSMPVAKTKGQ--K 210
            +K+EGI GLY+G+      +A + G   G++  +          + S+     +GQ  K
Sbjct: 223 VLKSEGIYGLYRGL------SASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTK 276

Query: 211 TRNDLI--------AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVI 262
           +R + I        +  +   + +++  P +VV++R++ +  + +   KY   + S  VI
Sbjct: 277 SRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQM-PMENGKPKYTGLVQSFRVI 335

Query: 263 YREEGFRALYKGFVPKVCRLAPGGSLML 290
            +EEG  ++Y G  P + R  P   +M 
Sbjct: 336 IKEEGLASMYSGLTPHLMRTVPNSIIMF 363

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 88.6 bits (218), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 132/306 (43%), Gaps = 29/306 (9%)

Query: 2   SSDSNAKPL--PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY 59
           S+ S+ KP   PF + F++G++AG  E ++ YP +  KTR QL V   + A+    V  Y
Sbjct: 79  STMSSNKPAVDPF-HSFLAGSIAGAIEASITYPFEFAKTRLQL-VDKASKASRNPLVLIY 136

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
           N          K  G S +Y G  + ++    K   +F   D  + + ++      +  +
Sbjct: 137 N--------TGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFR 188

Query: 120 ISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYL--------GPMDCLKKTIKNEGIMG 171
             +             + PFE IK  + D K + +        G +    K + ++G  G
Sbjct: 189 GVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSG 248

Query: 172 LYKGIESTMWRNALWN----GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTM 227
           LY+G+     R A       G Y  +   V++   V K K   +    I GA  G V   
Sbjct: 249 LYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVY 308

Query: 228 LNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGS 287
              P D VK+R+QS++A      +Y+  +     I++EEG +  +KG  P++ RL   G 
Sbjct: 309 TTMPIDTVKTRMQSLNA-----GQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGG 363

Query: 288 LMLVVF 293
           ++  ++
Sbjct: 364 IVFTIY 369

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 82/185 (44%), Gaps = 10/185 (5%)

Query: 17  ISGAVAGISELTV-MYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           ++G  AG+ E  V + P + +KT     +     AAV K      G++    K++  +GF
Sbjct: 191 VAGLGAGLLESVVAVTPFEAIKT----ALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGF 246

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET---TQKISIXXXXXXXXXX 132
           S LYRG+    + +A  +A +  C ++ + + ++  N  +    +  ++           
Sbjct: 247 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVT 306

Query: 133 XXVIVPFELIKIRMQDVKS-SYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
               +P + +K RMQ + +  Y   ++C     K EG+   +KG    + R  + +GG  
Sbjct: 307 VYTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGR-LILSGGIV 365

Query: 192 GVIYQ 196
             IY+
Sbjct: 366 FTIYE 370

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 10/176 (5%)

Query: 135 VIVPFELIKIRMQDVKSSYLG---PMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           +  PFE  K R+Q V  +      P+  +  T KN GI  +Y G  + +  N    G  F
Sbjct: 107 ITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPAFIVGNTAKAGIRF 166

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN-TPFDVVKSRIQSVDAVSSAVK 250
                ++N +   KT        ++AG   G + +++  TPF+ +K+ +  +D   +AV 
Sbjct: 167 LGFDTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKTAL--IDDKQAAVP 224

Query: 251 KYNWCLPSLLVIY----REEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           KY      ++  Y     ++GF  LY+G +P   R A   ++ L  +  +    +D
Sbjct: 225 KYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQD 280

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 130/300 (43%), Gaps = 20/300 (6%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MSSD+  +   F   F+ G V+     T   P++ VK   Q +        + K   +Y+
Sbjct: 1   MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDK---KYS 57

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
           G++DC K+  K+EG    +RG ++ ++   P +A  FA  D+ + +F   F   E   K 
Sbjct: 58  GIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG--FKKEEGYGKW 115

Query: 121 ---SIXXXXXXXXXXXXVIVPFELIKIRM-QDVKSS-------YLGPMDCLKKTIKNEGI 169
              ++             +   +  + R+  D KSS       + G  D  KKT+K++GI
Sbjct: 116 FAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 170 MGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN 229
            GLY+G   ++    ++ G YFG+   ++  +      G    + L+ G +  T  +  +
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLL-GWVVTTGASTCS 234

Query: 230 TPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
            P D V+ R+      S    KYN  +  L  I   EG  +L+KG    + R   G  ++
Sbjct: 235 YPLDTVRRRMM---MTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVI 291

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 140/334 (41%), Gaps = 50/334 (14%)

Query: 4   DSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI 63
           DS+    P  +  +SG + G    + M+ LD VKTR Q              V++Y  +I
Sbjct: 45  DSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ----------GAPNVKKYRNMI 94

Query: 64  DCLKKIVKKEGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI 122
              + I  +EG  R LY G  + ML   P  A  F   +  ++     +  N+T   +S 
Sbjct: 95  SAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS- 153

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPM-----------DCLKKTIKNEGIMG 171
                       V VP E++K R+Q ++  +  P            + +K  IK EG   
Sbjct: 154 -AGFLGDFISSFVYVPSEVLKTRLQ-LQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRS 211

Query: 172 LYKGIESTMWRNALWNGGYFGVIYQVRN-SMPVAKTKGQKTR----NDLIAGAIGGTVGT 226
           L+ G ++T+ R+  ++   F    + R  +  + +  G+       N+++ GA  G +  
Sbjct: 212 LFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAG 271

Query: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWCLP----------------SLLVIYREEGFRA 270
           ++ TP DVVK+R+Q+    S + K Y+   P                SL  +Y+ EG   
Sbjct: 272 IITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLG 331

Query: 271 LYKGFVPKVCRLAPGGSLMLVVFT----GMMNFF 300
            + G  P+    +   S+ML+++     G+ N F
Sbjct: 332 FFSGVGPRFVWTSVQSSIMLLLYQMTLRGLSNAF 365

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 128/301 (42%), Gaps = 38/301 (12%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
            SG V G++++ V  P D++K R Q   T P  A        +  + D    +VK EGF 
Sbjct: 29  FSGTVGGVAQVLVGQPFDIIKVRLQ---TMPGNATA------WEAITD----LVKYEGFM 75

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT-----NETTQKISIXXXXXXXXX 131
             Y+G  +P++      + +F  N+  ++ F++L  +     N  +              
Sbjct: 76  GFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSA 135

Query: 132 XXXVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
              +  P E ++IR+Q  K +     Y   +DC +K +K   +M   +G  +T+ R +  
Sbjct: 136 NALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLM---RGFTATLMRTS-- 190

Query: 187 NGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKSRIQ 240
           +G  FG+ +    ++  ++      R D+ A      GA+ G     +  PFDVVKS +Q
Sbjct: 191 HG--FGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQ 248

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           +   V+ A       +     IYRE G RA  KGF+P + R  P        F   M   
Sbjct: 249 ADKLVNPAYGTN--VVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

Query: 301 R 301
           +
Sbjct: 307 K 307

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 209 QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGF 268
           +KT  D+ +G +GG    ++  PFD++K R+Q++   ++A     W   + LV Y  EGF
Sbjct: 22  RKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATA-----WEAITDLVKY--EGF 74

Query: 269 RALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
              YKG +  +  +    S    +   M  +FRD
Sbjct: 75  MGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRD 108

>Kwal_27.12599
          Length = 304

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 130/301 (43%), Gaps = 35/301 (11%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +   ++G   G++++ V  P D  K R Q   TTPT A            ++ +KK+VK 
Sbjct: 25  LKDLLAGTAGGMAQVLVGQPFDTTKVRLQTS-TTPTTA------------VEVVKKLVKN 71

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IXXXXXXXX 130
           EG    Y+G  +P++      + +F  N+  ++ F+        T  +            
Sbjct: 72  EGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGV 131

Query: 131 XXXXVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNAL 185
               +  P E ++IR+Q   +S     + GP+DC+ K   N  +M   +G+  T+ R A 
Sbjct: 132 ANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALM---RGLSPTILREAQ 188

Query: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKSRI 239
               YF + Y+   +  + K      R+D+ A      GA+ G    +   P DV+KS +
Sbjct: 189 GCATYF-LTYEALVANQIGK---GIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLM 244

Query: 240 QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
           Q+ D + + V+  N    + LV   + G+++ +KGF P + R AP        F   M F
Sbjct: 245 QT-DNLKNPVRGKNIIQVARLV-NAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRF 302

Query: 300 F 300
            
Sbjct: 303 L 303

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           DL+AG  GG    ++  PFD  K R+Q+    ++AV+           + + EG R  YK
Sbjct: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAVEVVK-------KLVKNEGLRGFYK 79

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           G +  +  +    S    V   M  FFR
Sbjct: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFR 107

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 85.5 bits (210), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 125/303 (41%), Gaps = 39/303 (12%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I   +SG   GI+++ V  P D+ K R Q    + TA             +D +  ++K 
Sbjct: 24  IKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA-------------VDVVTSLIKN 70

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXX----XXX 128
           EG    Y+G  +P++      + +F  N+  ++ F+ +    + ++ +S+          
Sbjct: 71  EGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRM--NGDPSKPLSLKQYYVCGVAS 128

Query: 129 XXXXXXVIVPFELIKIRMQ-DVKS----SYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                 +  P E ++IR+Q   KS     Y G +DC++K +K   +M   +G  +T+ R 
Sbjct: 129 GCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALM---RGFTATLMRT 185

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKS 237
              +G  FG+ +    ++   + K    R D+      I GA  G     +  P DVVKS
Sbjct: 186 C--HG--FGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKS 241

Query: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297
            +QS   VS       W +     IY   G RA  KGF+P + R  P        F   M
Sbjct: 242 IMQSDRLVSPVHGTNVWQVAK--SIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTM 299

Query: 298 NFF 300
              
Sbjct: 300 RLL 302

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 7   AKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCL 66
           +KPL     ++ G  +G +   +  P++ V+ R QL+  +   A        Y G +DC+
Sbjct: 113 SKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANA-------EYQGSLDCM 165

Query: 67  KKIVKKEGFSRLYRGISSPML 87
           +K++K+     L RG ++ ++
Sbjct: 166 RKLLKQ---GALMRGFTATLM 183

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 85.1 bits (209), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 131/301 (43%), Gaps = 35/301 (11%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +   ++G   GI+++ +  P D  K R Q     PT+AA            + +K ++K 
Sbjct: 26  VKDLLAGTAGGIAQVLIGQPFDTTKVRLQTS-KVPTSAA------------EVVKNLLKN 72

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IXXXXXXXX 130
           EG    Y+G  +P++      + +F  N+  ++ F      +  T  +S           
Sbjct: 73  EGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGM 132

Query: 131 XXXXVIVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNAL 185
               +  P E ++IR+Q       ++ + GP+DC+KK    +G+M   +G+  TM R   
Sbjct: 133 TNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLM---RGLIPTMLREGH 189

Query: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSRI 239
             G YF ++Y+   S  +   +G K R ++      + GA+ GT   ++  P DVVKS +
Sbjct: 190 GCGTYF-LVYEALVSKQI--NQGLK-RTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVM 245

Query: 240 QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
           Q+ D ++      N  +     +Y  EG +A +KGF P + R AP        F   M  
Sbjct: 246 QT-DNLNKPQNGKNM-IQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRL 303

Query: 300 F 300
            
Sbjct: 304 L 304

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 126/288 (43%), Gaps = 25/288 (8%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P +YQ  +GA AGI E ++M+P+D +KTR Q   TT ++AA        + ++  + KI 
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAA----TRLPSNMLAQIAKIS 71

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE--TTQKISIXXXXXX 128
             EG   L++G+ S +L   P  A  FA    Y+     L +  +  T Q +        
Sbjct: 72  TTEGSLALWKGVQSVVLGAGPAHAVYFA---TYEMCKSRLIDPEDRQTHQPLKTALSGTL 128

Query: 129 XXXXXXVIV-PFELIKIRMQDVKSSYLGPMD----CLKKTIKNEGIMGLYKGIESTMWRN 183
                  ++ PF+ IK R+Q      L P D    C  +  + EGI   +    +T+  N
Sbjct: 129 ATVAADALMNPFDTIKQRLQ------LHPSDSMTKCAVRMYQREGIAAFFYSYPTTIAMN 182

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKS--RIQS 241
             +    F VIY+    +    +         + G I G     + TP D VK+  +I+ 
Sbjct: 183 IPFAALNF-VIYESSTKI-FNPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRG 240

Query: 242 VDAVSSAV-KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
            D+V S + K+ +    +   I++  G+   ++G  P++    P  ++
Sbjct: 241 ADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAI 288

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 132/304 (43%), Gaps = 53/304 (17%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +   ++G   GI+++ V  P D  K R Q   +TPT A            ++ ++K++  
Sbjct: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPTTA------------MEVVRKLLAN 72

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
           EG    Y+G  +P++      + +F  N+  ++ F +     + +  +S+          
Sbjct: 73  EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH--RNADMSSTLSLPQYYACGVTG 130

Query: 133 XXV----IVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
             V      P E ++IR+Q        + + GP++C+KK   N+ ++   +G+  T+ R 
Sbjct: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILRE 187

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKS 237
               G YF ++Y+   +  + K +G + R D+      I GA+ GT   ++  P DV+KS
Sbjct: 188 GHGCGTYF-LVYEALIANQMNKRRGLE-RKDIPAWKLCIFGALSGTALWLMVYPLDVIKS 245

Query: 238 RIQSV--------DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
            +Q+         +++SS  K           +Y   G  A +KGF P + R AP     
Sbjct: 246 VMQTDNLQKPKFGNSISSVAK----------TLYANGGIGAFFKGFGPTMLRAAPANGAT 295

Query: 290 LVVF 293
              F
Sbjct: 296 FATF 299

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           DL+AG  GG    ++  PFD  K R+Q+    ++A++     L +       EG R  YK
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLAN-------EGPRGFYK 80

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           G +  +  +    SL   V   M  FF  
Sbjct: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHH 109

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 10/92 (10%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY-NGVIDCL 66
           K +P     I GA++G +   ++YPLDV+K+  Q +           Q  ++ N +    
Sbjct: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD---------NLQKPKFGNSISSVA 265

Query: 67  KKIVKKEGFSRLYRGISSPMLMEAPKRATKFA 98
           K +    G    ++G    ML  AP     FA
Sbjct: 266 KTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297

>Kwal_56.23011
          Length = 303

 Score = 83.2 bits (204), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 118/286 (41%), Gaps = 49/286 (17%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           G V G++++ V  P D+ K R Q      TAA V             +K +VK EG    
Sbjct: 30  GTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQV-------------IKSLVKNEGLLAF 76

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXX----XXXXXXX 134
           Y+G  +P+       + +F  N+  +K F+         Q +++                
Sbjct: 77  YKGTLAPLAGVGACVSCQFGVNEALKKWFRK--KDGNFDQPLALRQYYACGFVSGTANAF 134

Query: 135 VIVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
           +  P E ++IR+Q        + Y G +DC +K +K   +M   +G  +T  R +   G 
Sbjct: 135 LATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALM---RGFTATTLRTSHGFGI 191

Query: 190 YFGVIYQ-----------VRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSR 238
           YF + Y+           +R ++P  K          + GA  G     +  PFDVVKS 
Sbjct: 192 YF-LTYETLIANQAHHGVLRENIPAWKV--------CVYGAFSGAFFWAMTYPFDVVKSV 242

Query: 239 IQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +Q+ D + + V   N  L     IYRE G RA  KGF P + R  P
Sbjct: 243 MQA-DKLKNPVYGRN-PLAVAKAIYRERGPRAFTKGFTPTMLRSLP 286

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 79/196 (40%), Gaps = 23/196 (11%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           +PL     +  G V+G +   +  P++ V+ R QL+  + +AA        Y+G +DC +
Sbjct: 114 QPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAA-------EYHGSLDCAR 166

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN-----LFNTNETTQKISI 122
           K++K+     L RG ++  L  +      F     Y+ +  N     +   N    K+ +
Sbjct: 167 KLLKQ---GALMRGFTATTLRTSHGFGIYFL---TYETLIANQAHHGVLRENIPAWKVCV 220

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQ--DVKSSYLG--PMDCLKKTIKNEGIMGLYKGIES 178
                       +  PF+++K  MQ   +K+   G  P+   K   +  G     KG   
Sbjct: 221 -YGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTP 279

Query: 179 TMWRNALWNGGYFGVI 194
           TM R+   NG  F   
Sbjct: 280 TMLRSLPVNGATFAAF 295

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           D+  G +GG    ++  PFD+ K R+Q+    ++A +     + SL+   + EG  A YK
Sbjct: 26  DVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQ----VIKSLV---KNEGLLAFYK 78

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           G +  +  +    S    V   +  +FR
Sbjct: 79  GTLAPLAGVGACVSCQFGVNEALKKWFR 106

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 83.2 bits (204), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 120/287 (41%), Gaps = 32/287 (11%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           F++G  +G+++ TV +P D VK R Q   T+   +  G Q   + G +DC+ K +K +G 
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ---TSQVGSGAGIQ---FKGPLDCVYKTLKNQGI 66

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IXXXXXXXXXXX 133
             LY G + P+       +        Y+ +             +S  I           
Sbjct: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126

Query: 134 XVIVPFELIKIRMQ---DVKSS-YLGPMDCLKKTIKN----EGIMG----LYKGIESTM- 180
            +  P EL K ++Q   D K++ Y GP+D ++K  K      GI+G    LYKG+ ST+ 
Sbjct: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186

Query: 181 WRN--ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT-PFDVVKS 237
           +R+    W G Y     ++        T       +  AG +  + G   +  P DVVK 
Sbjct: 187 FRSNFVFWWGSY-----ELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQ 241

Query: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
            +   D    + K +   +     IYR+ G    +KGF+P   R  P
Sbjct: 242 VVLCNDKYDGSFKSWRTAVSD---IYRQRGIHGFFKGFLPSFLRSFP 285

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 16/89 (17%)

Query: 10  LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKI 69
           LP     ISG +AG +   +  P+++ K + Q++    T         +Y G ID ++K+
Sbjct: 109 LPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTT--------KYTGPIDVVQKV 160

Query: 70  VKK--------EGFSRLYRGISSPMLMEA 90
            K+         G   LY+G+ S ++  +
Sbjct: 161 FKQGMATNGILGGVRSLYKGLISTLIFRS 189

>Kwal_33.12988
          Length = 303

 Score = 82.8 bits (203), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 126/293 (43%), Gaps = 35/293 (11%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           +G   GI+++ V  P D+ K R Q   +TPT A            +  ++ +VK EG   
Sbjct: 29  AGTTGGIAQVLVGQPFDITKVRLQTS-STPTTA------------LRVVQDLVKNEGLRG 75

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IXXXXXXXXXXXXV 135
            Y+G + P++      +++F  N+  ++ F    N   T+ ++                +
Sbjct: 76  FYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFL 135

Query: 136 IVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
             P E ++I +Q        + Y G MDC+KK +K   +M   +G   T+ R +  +G  
Sbjct: 136 ATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLM---RGFTPTILRTS--HG-- 188

Query: 191 FGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKSRIQSVDA 244
           FGV +    +M  ++ +    R D+ A      GA  G++   +  PFDV+KS +QS D 
Sbjct: 189 FGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQS-DK 247

Query: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297
           + + V   N        IY E G +A  KGF P + R  P        F   M
Sbjct: 248 LRTPVYGTN-VFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAM 299

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 205 KTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYR 264
           K+  ++T  D+ AG  GG    ++  PFD+ K R+Q+    ++A++        +  + +
Sbjct: 17  KSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTALR-------VVQDLVK 69

Query: 265 EEGFRALYKG 274
            EG R  YKG
Sbjct: 70  NEGLRGFYKG 79

>Kwal_26.7653
          Length = 325

 Score = 82.8 bits (203), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 85/181 (46%), Gaps = 21/181 (11%)

Query: 138 PFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNG-- 188
           P EL+K RMQ       D +  Y  PM  LK   KNEGI GL KG+          NG  
Sbjct: 44  PIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSR 103

Query: 189 -GYFGVIYQVRNSMPVAKTKGQKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
            G++  I  V N          K +N   ++++GA  G +G ++ +P  ++K+R+QS   
Sbjct: 104 LGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQS--- 160

Query: 245 VSSAVK-----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
            S+A++      Y      L  IYR EGF+ LY+G    + R   G S+ L ++    +F
Sbjct: 161 YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHF 220

Query: 300 F 300
            
Sbjct: 221 L 221

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 119/290 (41%), Gaps = 27/290 (9%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER-YNGVIDCLKKIVKKEG 74
           FI+G +A    +TV  P+++VKTR QL+        +    +R Y   +  LK I K EG
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQ------GEMSADAQRIYKNPMQALKVIFKNEG 81

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
              L +G+S   + +     ++    +  + +    F       K+              
Sbjct: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141

Query: 135 VI-----VPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMW 181
           +I      P  LIK RMQ          ++ Y    + L    + EG  GLY+G+++ + 
Sbjct: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201

Query: 182 RNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQ 240
           R    +     +    ++ +       + T   L+A  + G  VG ++N P+DV+ +R+ 
Sbjct: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTRVY 260

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
           +          Y   L   +   R EG  ALYKGF  ++ R+AP   L L
Sbjct: 261 NQKG-----NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCL 305

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 11/92 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
             ++  V+G     VM P DV+ TR              ++   Y G +DC  K V+ EG
Sbjct: 234 HLVASTVSGFGVGVVMNPWDVILTR-----------VYNQKGNLYKGPLDCFVKTVRIEG 282

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
              LY+G  + +   AP         +Q  K+
Sbjct: 283 IGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 119/292 (40%), Gaps = 26/292 (8%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ISGA++G     ++ P DV KTR Q +        +  Q + Y G       I K EG +
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQ----GLQNMTHQSQHYKGFFGTFATIFKDEGAA 98

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVI 136
            LY+G+   +L   P     F+  D  +K   ++F  +      S               
Sbjct: 99  GLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS--SAITAGAISTVAT 156

Query: 137 VPFELIKIRMQ------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIEST---MWRNALWN 187
            P  ++K R+          + Y G +D  +K I+ EG   LY G+      M   A+  
Sbjct: 157 NPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQF 216

Query: 188 GGY------FGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQS 241
             Y      FG       S  V  +  QK    ++A  +   V + +  P +++++R+Q 
Sbjct: 217 PLYENLKIRFGYSESTDVSTDVTSSNFQKL---ILASMLSKMVASTVTYPHEILRTRMQL 273

Query: 242 VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
              + + V+++   LP + + YR+EGF   Y GF   + R  P   + LV F
Sbjct: 274 KSDLPNTVQRH--LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 76/184 (41%), Gaps = 21/184 (11%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           PF+    S   AG        P+ VVKTR  L+        +GK    Y G ID  +KI+
Sbjct: 137 PFLSNASSAITAGAISTVATNPIWVVKTRLMLQT------GIGKYSTHYKGTIDTFRKII 190

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS------IXX 124
           ++EG   LY G+  P L+     A +F   +  +  F    +T+ +T   S      I  
Sbjct: 191 QQEGAKALYAGL-VPALLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILA 249

Query: 125 XXXXXXXXXXVIVPFELIKIRMQ------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIES 178
                     V  P E+++ RMQ      +    +L P+  +K T + EG  G Y G  +
Sbjct: 250 SMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPL--IKITYRQEGFAGFYSGFAT 307

Query: 179 TMWR 182
            + R
Sbjct: 308 NLVR 311

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 207 KGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQS--VDAVSSAVKKYNWCLPSLLVIYR 264
           K    R   I+GA+ G +  ML  PFDV K+R+Q+  +  ++   + Y     +   I++
Sbjct: 34  KNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFK 93

Query: 265 EEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           +EG   LYKG  P V    P     L+++  + +F R
Sbjct: 94  DEGAAGLYKGLQPTVLGYIP----TLMIYFSVYDFCR 126

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 28  TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPML 87
           TV YP ++++TR QL+   P        V+R+  ++  +K   ++EGF+  Y G ++ ++
Sbjct: 259 TVTYPHEILRTRMQLKSDLPNT------VQRH--LLPLIKITYRQEGFAGFYSGFATNLV 310

Query: 88  MEAPKRATKFACNDQYQKIFKNLF 111
              P         +  +K     F
Sbjct: 311 RTVPAAVVTLVSFEYSKKYLTTFF 334

>Scas_709.9
          Length = 365

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 130/301 (43%), Gaps = 31/301 (10%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQ-VER--YNGVIDCLKKIVKKE 73
           +SGA+AG     ++ PLDV KTR Q         A G Q +E   Y GV+  +  IV  E
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQ---------AQGIQSIENPYYRGVLGTMSTIVVDE 119

Query: 74  GFSRLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNTNETTQKISIXXXXXXX 129
           G   LY+G+   +L   P     F+      D Y ++  N    + +   I+        
Sbjct: 120 GVRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAASTVL 179

Query: 130 XXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
                V+    +++  + + ++ Y G +D  KK I  EG+  LY G+  +M+   L    
Sbjct: 180 TNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF-GLLHVAI 238

Query: 190 YFGVIYQVRNSMPVAKTKGQKTRND--------LIAGAIGGTVGTMLNTPFDVVKSRIQS 241
           +F V  +++N +      G     +        +IA +    + ++L  P +++++R+Q 
Sbjct: 239 HFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQ- 297

Query: 242 VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           + +    + K+   L  +   YR EG    Y GF   + R  P  ++ LV F     +FR
Sbjct: 298 LKSDKLLISKHK-LLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSF----EYFR 352

Query: 302 D 302
           +
Sbjct: 353 N 353

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 26/186 (13%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           FI    S   AG +   +  P+ VVKTR  L+  TP    +G+    Y G ID  KKI+ 
Sbjct: 162 FISHSCSAITAGAASTVLTNPIWVVKTRLMLQ--TP----LGESRTHYRGTIDAFKKIIT 215

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL--------FNTNETTQKIS-- 121
           +EG   LY G+  P +      A  F     Y+K+   L         N+ E +  ++  
Sbjct: 216 QEGVRTLYTGL-VPSMFGLLHVAIHFPV---YEKLKNRLHCDTITGGHNSQEHSLHLTRL 271

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYL-----GPMDCLKKTIKNEGIMGLYKGI 176
           I            +  P E+++ RMQ +KS  L       +D +K+T + EG++G Y G 
Sbjct: 272 IIASSASKMLASILTYPHEILRTRMQ-LKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGF 330

Query: 177 ESTMWR 182
            + + R
Sbjct: 331 ATNLLR 336

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 134/313 (42%), Gaps = 43/313 (13%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P  + F++G V GI   + M+ LD VKTR Q              V +Y  ++   + + 
Sbjct: 52  PIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ----------GAPNVHKYKHMLQAYRTMF 101

Query: 71  KKEGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXX 129
            +EGF R LY G  + ML   P  A  F+  +  ++   N ++ N+T   ++        
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLT--AGFLGD 159

Query: 130 XXXXXVIVPFELIKIRMQDVKSSYLGPM-----------DCLKKTIKNEGIMGLYKGIES 178
                V VP E++K R+Q ++  Y  P            + +    + EG+  L+ G ++
Sbjct: 160 FFSSFVYVPSEVLKTRLQ-LQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKA 218

Query: 179 TMWRNALWNGGYFGVIYQVRNSMPVAKTKG-----QKTRNDLIAGAIGGTVGTMLNTPFD 233
           T+ R+  ++   F    + R    + + K          N+++ GA  G +  +L TP D
Sbjct: 219 TLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLD 278

Query: 234 VVKSRIQS-------------VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVC 280
           VVK+R+Q+             +  VS  V   N    SL  +Y  EGF   + G  P+  
Sbjct: 279 VVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFFSGVGPRFV 338

Query: 281 RLAPGGSLMLVVF 293
             +   S+ML+++
Sbjct: 339 WTSVQSSIMLLLY 351

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 127/295 (43%), Gaps = 20/295 (6%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLE-VTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           ISGA+AG+    V+ PLDV KTR Q + + T T   +      Y G I  +  IV+ EG 
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENL-----YYRGSIGTMTTIVRDEGV 127

Query: 76  SRLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNTNETTQKISIXXXXXXXXX 131
             LY+G+   ++   P     F+    C D  +    N    + +   I+          
Sbjct: 128 RGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTN 187

Query: 132 XXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
              V+    +++  +    + Y G  D  KK I  EG+  LY G+  ++    L    +F
Sbjct: 188 PIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL-GLLHVAIHF 246

Query: 192 GVIYQVRNSMPVAKTKGQKTRND------LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAV 245
            V  +++ S    +       +       ++A ++   V ++L+ P +++++R+Q    +
Sbjct: 247 PVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDL 306

Query: 246 SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            S  ++    +P + + Y +EG    Y GF   + R  P  ++ LV F  + NF 
Sbjct: 307 PSHQRR---LIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFL 358

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 78/187 (41%), Gaps = 17/187 (9%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           +N+    F+    S   AG     V  P+ VVKTR  L+        +G     Y G  D
Sbjct: 161 TNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQ------THIGSNTTHYQGTYD 214

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX 124
             KKI+ +EG   LY G+  P L+     A  F   ++ +  FK  +  +E++ +  I  
Sbjct: 215 AFKKIINQEGVKALYAGL-VPSLLGLLHVAIHFPVYERLKVSFK-CYQRDESSNESKINL 272

Query: 125 XXXXXXXXXXVIV------PFELIKIRMQ---DVKSSYLGPMDCLKKTIKNEGIMGLYKG 175
                      +V      P E+++ R+Q   D+ S     +  +K T   EGI G Y G
Sbjct: 273 KRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSG 332

Query: 176 IESTMWR 182
             + ++R
Sbjct: 333 FGTNLFR 339

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 119/292 (40%), Gaps = 39/292 (13%)

Query: 32  PLDVVKTRFQLEV--------TTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGIS 83
           P DVVKTR Q +V         T     V + +  +   +  ++ +  +EGF  L++G+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 84  SPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIK 143
             ++   P R+  F      +     L N  +    I                 P  L+K
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVK 188

Query: 144 IRMQDVKSS------YLGPMDCLKKTIKNEGIMGLYKGIEST-------MWRNALWNG-- 188
            R+Q  K++      Y    DCLK  ++NEGI+GLYKG+ ++       + +  L+    
Sbjct: 189 TRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVLYEQMK 248

Query: 189 --------GYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGT--VGTMLNTPFDVVKSR 238
                     FG I +  N     K K    R    +G+ G      ++L  P +VV++R
Sbjct: 249 HIIRQRSIEEFGDISE-ENKTTYMKVKEWCQR----SGSAGAAKLFASILTYPHEVVRTR 303

Query: 239 IQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
           ++     +  +K Y     S  +I +EEGF ++Y G  P + R  P   +M 
Sbjct: 304 LRQAPKENGKLK-YTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMF 354

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 14/77 (18%)

Query: 231 PFDVVKSRIQS--------------VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFV 276
           PFDVVK+R+QS               + V   +  +   +  +  +Y +EGFR+L+KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 277 PKVCRLAPGGSLMLVVF 293
           P +  + P  S+    +
Sbjct: 129 PNLVGVIPARSINFFTY 145

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 7/82 (8%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           S   A +    + YP +VV+TR +           GK   +Y G+      I+K+EGF+ 
Sbjct: 282 SAGAAKLFASILTYPHEVVRTRLR-----QAPKENGKL--KYTGLFQSFSLIIKEEGFAS 334

Query: 78  LYRGISSPMLMEAPKRATKFAC 99
           +Y G++  ++   P     F  
Sbjct: 335 MYSGLTPHLMRTVPNSIIMFGT 356

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 133/302 (44%), Gaps = 34/302 (11%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P  +Q I+GA AGI E +VM+P+D +KTR Q        +A  K +   N ++  +  I 
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTRIQ--------SANAKSLSAKN-MLSQISHIS 82

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXX--- 127
             EG   L++G+ S +L   P  A  F     Y+   KNL ++++T              
Sbjct: 83  TSEGTLALWKGVQSVILGAGPAHAVYFG---TYEFCKKNLIDSSDTQTHHPFKTAISGAC 139

Query: 128 XXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
                  ++ PF+ IK R+Q   S+ +      K+  ++EG+   Y    +T+  N  + 
Sbjct: 140 ATTASDALMNPFDTIKQRIQLNTSASV--WQTTKQIYQSEGLAAFYYSYPTTLVMNIPFA 197

Query: 188 GGYFGVIYQVRNSMPVAKTKGQKTRND------LIAGAIGGTVGTMLNTPFDVVKS--RI 239
              F VIY+       + TK     N+       + G+I G+    + TP D +K+  +I
Sbjct: 198 AFNF-VIYE-------SSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQI 249

Query: 240 QSVDAVSSAV-KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
           +    VS  + +K +    +   IY+  G++  ++G+ P++    P  ++    +    +
Sbjct: 250 RGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKH 309

Query: 299 FF 300
           F 
Sbjct: 310 FL 311

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 146/349 (41%), Gaps = 82/349 (23%)

Query: 19  GAVAGISELTVMY--PLDVVKTRFQLEVTTPTAA---------AVGKQV----------- 56
            A AG S LT  +  P+DVV+ R Q +V  P  +         +VG +V           
Sbjct: 17  SACAG-SFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVGTEVIYDHVVANKNS 75

Query: 57  -------------------ERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
                               R+N   +   KI + EG + L+RG+S  +LM  P     F
Sbjct: 76  PKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYF 135

Query: 98  ACNDQYQKIFKNLFNTNETTQKIS-IXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGP 156
           +  +    +F++     ++   ++ +             + P ELIK R+Q +  S    
Sbjct: 136 SGYE----MFRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDT 191

Query: 157 M------DCLKKT---IKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTK 207
                  D LK+T   I++ G   L+KG+E T+WR+  ++  Y+G     + +  +  ++
Sbjct: 192 TTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSE 251

Query: 208 GQKTR-----------NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCL 256
            Q  R           N  I G++ G+   +L  PFDV K+R+Q    + +  K+ N  +
Sbjct: 252 -QCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIEN--KQRNTLV 308

Query: 257 PS------------LLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                         L  I + EG+ ALY G +P+V ++AP  ++M+  +
Sbjct: 309 SPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTY 357

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 6/101 (5%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTP-----TAAAVGKQVERYNGVIDCL 66
           FI  FI G+V+G S   + +P DV KTR Q+ +        T  +  K+V    G+   L
Sbjct: 265 FINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSA-RGMFKFL 323

Query: 67  KKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF 107
             I + EG+  LY G+   ++  AP  A   +  +  +++F
Sbjct: 324 YNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 73/190 (38%), Gaps = 15/190 (7%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P +     GA A +   T + PL+++KTR Q   + P +         +  ++   +  +
Sbjct: 152 PSLNPLFCGATARMVAATTVAPLELIKTRLQ---SIPRSRKDTTTQMMFKDLLKETRNEI 208

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI---------S 121
           +  G+  L++G+   +  + P  A  +   + Y+K F   F+       +         S
Sbjct: 209 RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINS 268

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQ---DVKSSYLGPMDCLKKTIKNEGIMGLYKGIES 178
                        +  PF++ K RMQ   D+++     +   KK +   G+      I+ 
Sbjct: 269 FIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQ 328

Query: 179 TMWRNALWNG 188
           T    AL+ G
Sbjct: 329 TEGYGALYTG 338

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 132/324 (40%), Gaps = 53/324 (16%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQ----LEVTTPTAAAVGKQVER-------- 58
           P+++ F++G + G++   V  P D+VKTR Q    L+     A  + K   R        
Sbjct: 52  PWVH-FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVI 110

Query: 59  -----YNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT 113
                +   +  +  + K+EGF  L++G+   ++   P R+  F      + ++   FN 
Sbjct: 111 QAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNN 170

Query: 114 NETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKS------SYLGPMDCLKKTIKNE 167
            + T  I +               P  LIK R+Q  K+       Y    DCLK  I+NE
Sbjct: 171 GQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNE 230

Query: 168 GIMGLYKGIESTMWRNALWNGGYFGVI---------------------YQVRNSMPVAKT 206
           G  GLYKG+      +A + G   G++                     YQ   +   ++ 
Sbjct: 231 GFTGLYKGL------SASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEK 284

Query: 207 KGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREE 266
             +  +    AG +   V ++   P +VV++R++      +  +KY   + S  VI +EE
Sbjct: 285 VKEWCQRSGSAG-LAKFVASIATYPHEVVRTRLRQTPK-ENGKRKYTGLVQSFKVIIKEE 342

Query: 267 GFRALYKGFVPKVCRLAPGGSLML 290
           G  ++Y G  P + R  P   +M 
Sbjct: 343 GLFSMYSGLTPHLMRTVPNSIIMF 366

>Scas_379.2
          Length = 301

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 130/302 (43%), Gaps = 36/302 (11%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P  +Q ++GA AGI E +VM+P+D +KTR Q               +  + ++  + KI 
Sbjct: 22  PLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ-----------STSAKSTSNMLSQMAKIS 70

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN--ETTQKISIXXXXXX 128
             EG   L++G+ S +L   P  A  FA    Y+   K L +    +T Q +        
Sbjct: 71  TAEGSLALWKGVQSVILGAGPAHAVYFAT---YEYTKKYLIDEKDMQTHQPLKTALSGTV 127

Query: 129 XXXXXXVIV-PFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
                  ++ PF+ +K RMQ   ++ +   +  K+  KNEG    Y    +T+  N  + 
Sbjct: 128 ATIAADALMNPFDTLKQRMQLNTNTTV--WNVTKQIYKNEGFSAFYYSYPTTLAMNIPFA 185

Query: 188 GGYFGVIYQVRNSMPVAKTKGQKTRND------LIAGAIGGTVGTMLNTPFDVVKS--RI 239
              F +IY+       + TK     ND       ++G + G     + TP D +K+  ++
Sbjct: 186 AFNF-MIYE-------SATKFFNPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQV 237

Query: 240 QSVDAVSSAV-KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
           +  ++VS  V K+ N    +   IY+  G +  ++G  P+V    P  ++    +    +
Sbjct: 238 RGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKH 297

Query: 299 FF 300
           F 
Sbjct: 298 FL 299

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 114/259 (44%), Gaps = 28/259 (10%)

Query: 57  ERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET 116
           +++NG ++  +KI K EG + L+RGIS  +LM  P     F    +Y +    L     T
Sbjct: 108 QKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT-GYEYVRDRSPLNGLYPT 166

Query: 117 TQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS---------YLGPMDCLKKTIKNE 167
              +               + P ELIK ++Q + SS         Y    + +K  I   
Sbjct: 167 INPLICGAFARTLAATS--VAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMR 224

Query: 168 GI-MGLYKGIESTMWRNALWNGGYFG--------VIYQVRNSMPVAKTKGQKTRNDLIAG 218
           G+   ++KG+E T+WR+  ++  Y+         V Y   ++     +      N  + G
Sbjct: 225 GVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGG 284

Query: 219 AIGGTVGTMLNTPFDVVKSRIQ----SVDAVSSAVKKY---NWCLPSLLVIYREEGFRAL 271
            I G++  +   PFDV K+R Q    +   ++++  KY   N     L  I + EG  AL
Sbjct: 285 FISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGAL 344

Query: 272 YKGFVPKVCRLAPGGSLML 290
           Y G  P+V ++AP  ++M+
Sbjct: 345 YTGLAPRVAKIAPSCAIMI 363

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 5/97 (5%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLE-VTTPTAAAVGKQVERYNGVIDCLKKIV 70
           F+  FISG++A I      +P DV KTR Q+  VT    A    +    N +   L  I 
Sbjct: 281 FLGGFISGSLAAI----CTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIR 336

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF 107
           K EG   LY G++  +   AP  A   +  +  +++F
Sbjct: 337 KTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P I   I GA A     T + PL+++KT+ Q   + P+++     V  Y  + + +K  +
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQ---SIPSSSMKNGSVIMYRDLFNEIKSEI 221

Query: 71  KKEGFSR-LYRGISSPMLMEAPKRATKFACNDQYQ 104
              G ++ +++G+   +  + P  A  +A  + Y+
Sbjct: 222 AMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYK 256

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 139/333 (41%), Gaps = 49/333 (14%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEV----------------TTPTAAAVGK 54
           P+++ F++G + G++   V  P D+VKTR Q ++                T P    +  
Sbjct: 56  PWVH-FLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTL 114

Query: 55  QVE-RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT 113
           Q    +   +  +  + ++EGF  L++G+   ++   P R+  F      + I+   FN 
Sbjct: 115 QAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNN 174

Query: 114 NETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKS----SYLGPMDCLKKTIKNEGI 169
            +    I +               P  ++K R+Q  K+    +Y    DCLK  ++NEGI
Sbjct: 175 GQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGI 234

Query: 170 MGLYKGIESTMWRNALWNGGYFGVIY-----QVRNSMPV-------AKTKGQKTRNDLI- 216
            GLY+G+      +A + G   G++      Q+++ +         A  +   T  D I 
Sbjct: 235 YGLYRGL------SASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIK 288

Query: 217 -------AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFR 269
                     +   + +++  P +VV++R++     +  V KY   + S  VI +EEG  
Sbjct: 289 QWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKV-KYTGLVQSFRVIIKEEGLA 347

Query: 270 ALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           ++Y G  P + R  P   +M   +  ++    D
Sbjct: 348 SMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSD 380

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 29  VMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLM 88
           V YP +VV+TR +      +    GK   +Y G++   + I+K+EG + +Y G++  ++ 
Sbjct: 307 VTYPHEVVRTRLR-----QSPLENGKV--KYTGLVQSFRVIIKEEGLASMYSGLTPHLMR 359

Query: 89  EAPKRATKFACNDQYQKIFKNL 110
             P     F   +   K+  ++
Sbjct: 360 TVPNSIIMFGTWEVVIKLLSDI 381

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 137/353 (38%), Gaps = 66/353 (18%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLE-----------VTTPTA 49
           MS  + +  L    + +S     +    ++ P+DVV+ R Q +              P A
Sbjct: 1   MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNA 60

Query: 50  AAVGKQVE--------------------------------RYNGVIDCLKKIVKKEGFSR 77
            + G +++                                ++NG ++   KI   EG + 
Sbjct: 61  VSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITS 120

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIV 137
           L+RGIS  +LM  P     F+   +Y +    + +T  T   +               I 
Sbjct: 121 LWRGISLTLLMAIPANMVYFS-GYEYIRDVSPIASTYPTLNPLFCGAIARVFAATS--IA 177

Query: 138 PFELIKIRMQDVKSS------YLGPMDCLKKTIKNEGIMG----LYKGIESTMWRNALWN 187
           P EL+K ++Q +  S      ++   D L +T +   ++G    L+KG+E T+WR+  ++
Sbjct: 178 PLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFS 237

Query: 188 GGYFGVIYQVRNSMPVAKTKGQKTR-------NDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
             Y+      +  + +  T+            N   +G I G +  +   PFDV K+R Q
Sbjct: 238 AIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQ 297

Query: 241 SVDAVSSAVKKYNWC---LPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
                +S  K  N        L  I+R EG  ALY G   +V ++ P  ++M+
Sbjct: 298 ISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMI 350

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           +A  + FI  F SG ++G+      +P DV KTR+Q+ +   +    G    R   +   
Sbjct: 262 DANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGG---NRSRNMFKF 318

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109
           L+ I + EG + LY G+++ ++   P  A   +  +  +K+F N
Sbjct: 319 LETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFGN 362

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 37/303 (12%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P  +Q ++GA AGI E +V++P+D +KTR Q   ++ + AA         G+I  + KI 
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ---SSSSGAAT-------QGLIKQISKIT 64

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE--TTQKISIXXXXXX 128
             EG   L++G+ S +L   P  A  FA    Y+     L +  +  T Q I        
Sbjct: 65  TAEGSLALWKGVQSVILGAGPAHAVYFAT---YEFSKSKLIDPQDMHTHQPIKTAISGMA 121

Query: 129 XXXXXXVIV-PFELIKIRMQ-DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
                  ++ PF++IK RMQ + + S        K     EG    Y    +T+  N  +
Sbjct: 122 ATTVADALMNPFDVIKQRMQLNTRESVW---HVTKNIYHKEGFAAFYYSYPTTLVMNIPF 178

Query: 187 NGGYFGVIYQVRNSMPVAKTKGQKTRND------LIAGAIGGTVGTMLNTPFDVVKS--R 238
               F  IY+       + TK     N+       I+G + G     + TP D +K+  +
Sbjct: 179 AAFNFA-IYE-------SATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQ 230

Query: 239 IQSVDAVSSAV-KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297
           ++  + VS+ + K+ N    +   IY+  G++   +G  P+V    P  ++    +    
Sbjct: 231 VRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAK 290

Query: 298 NFF 300
           +F 
Sbjct: 291 HFL 293

>Scas_582.7
          Length = 329

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 128/304 (42%), Gaps = 34/304 (11%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P  +Q ++GA AGI E + M+P+D +KTR Q   T  T        +    +I  + KI 
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTE-------QTSTSIIKQISKIS 87

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXX 130
             EG   L++G+ S +L   P  A  FA   ++ K      +  ET Q I +        
Sbjct: 88  TMEGSLALWKGVQSVILGAGPAHAVYFATY-EFTKAHLIPDSQRETHQPIKVAVSGATAT 146

Query: 131 XXXXVIV-PFELIKIRMQ--DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
                 + PF+ IK RMQ  D+K   +   +  KK    EG+   Y    +T+  N  + 
Sbjct: 147 VASDFFMNPFDTIKQRMQISDLKKEKV--YNVAKKIYNLEGLSAFYYSYPTTIAMNIPFA 204

Query: 188 GGYFGVIYQVRNSM--PVAKTKGQKTRNDLI---AGAIGGTVGTMLNTPFDVVKSRIQ-- 240
              F +IY+  +    P+         N LI    G I G +   + TP D +K+ IQ  
Sbjct: 205 AFNF-MIYESASKFFNPLHH------YNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIR 257

Query: 241 SVDAVSSAVKK----YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGM 296
               VS  V K    +     ++L++Y   G++  ++G  P++    P  ++    +   
Sbjct: 258 GSSVVSLEVMKKANTFKKATSAILMVY---GWKGFWRGLQPRILANMPATAISWTAYECA 314

Query: 297 MNFF 300
            +F 
Sbjct: 315 KHFL 318

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 121/284 (42%), Gaps = 39/284 (13%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I   ++G   GI+++ V  P D  K R Q   T+  A  V             +K ++K 
Sbjct: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV-------------IKDLIKN 70

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX----XXXX 128
           EG    Y+G  +P++      + +F  N+  ++ F         +Q +S+          
Sbjct: 71  EGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF--DEAASQHLSLLQYYICGVAG 128

Query: 129 XXXXXXVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                 +  P E I+IR+Q    S     + GP+DC+KK   N  +M   +G+  TM R 
Sbjct: 129 GFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRE 185

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKS 237
           +   G YF + Y+   ++   + K    R D+ A      GA  GT+   +  P DV+KS
Sbjct: 186 SHGCGVYF-LTYE---ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKS 241

Query: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
            +Q+ D + +     N       +I R +G   L+KGF P + R
Sbjct: 242 VMQT-DNLKTPKNGNNILTVGRTIIAR-QGVSGLFKGFAPTMLR 283

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
           DL+AG  GG    ++  PFD  K R+Q+ +  ++AVK        +  + + EG    YK
Sbjct: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-------VIKDLIKNEGPMGFYK 78

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           G +  +  +    SL   V   M  FF 
Sbjct: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFH 106

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLE-VTTPTAAAVGKQVERYNGVIDCL 66
           K +P     + GA +G    T++YPLDV+K+  Q + + TP         +  N ++   
Sbjct: 211 KDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTP---------KNGNNILTVG 261

Query: 67  KKIVKKEGFSRLYRGISSPML 87
           + I+ ++G S L++G +  ML
Sbjct: 262 RTIIARQGVSGLFKGFAPTML 282

>Kwal_14.2210
          Length = 315

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 131/307 (42%), Gaps = 35/307 (11%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74
           F +G +AG    TV+ P + VK   Q++ +T            YN G+   +K++  +EG
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSST----------HAYNHGLFRAVKQVYLEEG 70

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
              L RG     +   P  A +F     Y+   K  F  N  T  ++             
Sbjct: 71  VPGLLRGNGLNCIRIFPYSAVQFLV---YEFCKKQWFQQNPDTVVLNWHRLVSGALCGGC 127

Query: 135 VIV---PFELIKIRMQDVKSSYL---------------GPMDCLKKTIKNEG-IMGLYKG 175
            ++   P +L++ R+  ++++ L               G  + L+KT   EG I GLY+G
Sbjct: 128 SVLATYPLDLVRTRL-SIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRG 186

Query: 176 IESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVV 235
           +  T      +    F V  Q+R  +P +      +   L  GAI G V   +  PFD++
Sbjct: 187 VWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLL 246

Query: 236 KSRIQSVDAVSSAVKKYNWCLP-SLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFT 294
           + R Q +    S +  +   +P +L+ I R EGF+  YKG    + ++ P  ++  VV+ 
Sbjct: 247 RRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

Query: 295 GMMNFFR 301
            + ++ +
Sbjct: 307 TVRDYMQ 313

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 14  YQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN----GVIDCLKKI 69
           ++ +SGA+ G   +   YPLD+V+TR  L + T   A + K          GV + L+K 
Sbjct: 116 HRLVSGALCGGCSVLATYPLDLVRTR--LSIQTANLARLHKAKAASAAKPPGVWELLRKT 173

Query: 70  VKKE-GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN-TNETTQKISIXXXXX 127
             +E G   LYRG+    +   P  A  FA  +Q ++     F+  + +  K+SI     
Sbjct: 174 YTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSI--GAI 231

Query: 128 XXXXXXXVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180
                  +  PF+L++ R Q       ++   Y    D L    + EG  G YKG+ + +
Sbjct: 232 SGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANL 291

Query: 181 WR 182
           ++
Sbjct: 292 FK 293

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +Y+   GA++G    T+ YP D+++ RFQ+      A    +    Y  V D L  I + 
Sbjct: 223 LYKLSIGAISGGVAQTITYPFDLLRRRFQV-----LAMGQSELGFHYKSVPDALITIGRT 277

Query: 73  EGFSRLYRGISSPMLMEAPKRATKF 97
           EGF   Y+G+++ +    P  A  +
Sbjct: 278 EGFKGYYKGLTANLFKVVPSTAVSW 302

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 118/294 (40%), Gaps = 45/294 (15%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +Y  I+GAV  + E    YP D VK R Q   T P           +     C+K     
Sbjct: 11  LYGSIAGAVGKVIE----YPFDTVKVRLQ---TQP--------AHMFPTTWSCIKFTYDN 55

Query: 73  EGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IXXXXXXX 129
           EG  R  Y+GI SP+   A + A  F   +Q     K L +       +S  +       
Sbjct: 56  EGLWRGFYQGIGSPLAGAALENAVLFVSFNQA----KRLLDVESLLSPLSKTVWAGAFAG 111

Query: 130 XXXXXVIVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                V+ P ELIK ++Q       K+S+   +  +K  +   G +GL++G   T  R +
Sbjct: 112 ACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRES 171

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT---PFDVVKSRIQS 241
                +F     V+N +   +   Q T  +L+A   G + G   N    P D +KS +Q+
Sbjct: 172 GGGAAWFTTYEVVKNYLASRRQAEQNTTWELLAS--GASAGLAFNASIFPADTIKSTMQT 229

Query: 242 --VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
             +D +SSA +K          IY  +G    Y+G    + R  P  + +   +
Sbjct: 230 DHID-LSSATRK----------IYARQGIAGFYRGLGITLIRAVPANAAIFYTY 272

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 81/166 (48%), Gaps = 6/166 (3%)

Query: 138 PFELIKIRMQDVKSSYLGPM--DCLKKTIKNEGIM-GLYKGIESTMWRNALWNGGYFGVI 194
           PF+ +K+R+Q  + +++ P    C+K T  NEG+  G Y+GI S +   AL N   F   
Sbjct: 26  PFDTVKVRLQ-TQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAVLFVSF 84

Query: 195 YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNW 254
            Q +  + V       ++  + AGA  G   + + TP +++K ++Q V  +S+    +  
Sbjct: 85  NQAKRLLDVESLLSPLSKT-VWAGAFAGACASFVLTPVELIKCKLQ-VSNLSTTKTSHTK 142

Query: 255 CLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            LP++  +  E GF  L++G      R + GG+     +  + N+ 
Sbjct: 143 ILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYL 188

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 209 QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEG- 267
           ++   D++ G+I G VG ++  PFD VK R+Q+  A       +      +   Y  EG 
Sbjct: 4   EEAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPA-----HMFPTTWSCIKFTYDNEGL 58

Query: 268 FRALYKGFVPKVCRLAPGGSLMLVVF 293
           +R  Y+G    +   A   +++ V F
Sbjct: 59  WRGFYQGIGSPLAGAALENAVLFVSF 84

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 129/288 (44%), Gaps = 34/288 (11%)

Query: 28  TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR-LYRGISSPM 86
           +VM+ LD VKTR Q         A G+   +Y  +I   + +  +EG  R LY G  + M
Sbjct: 69  SVMHSLDTVKTRQQ--------GAPGEV--KYRHMISAYRTLALEEGVRRGLYGGYGAAM 118

Query: 87  LMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRM 146
           L   P  A  F   +  ++   N +  +ET   ++             V VP E++K R+
Sbjct: 119 LGSFPSAAVFFGTYEWVKRQMINEWQIHETYSHLA--AGFLGDLFSSVVYVPSEVLKTRL 176

Query: 147 Q----------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQ 196
           Q              +Y G  D ++  ++ EG+  L+ G ++T+ R+  ++   F    +
Sbjct: 177 QLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYER 236

Query: 197 VRNSMPVAKTK---GQKT-RNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVS------ 246
            R    + + K   G  +   +++ GA  G +  ++ TP DVVK+RIQ+    S      
Sbjct: 237 FRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDA 296

Query: 247 SAVKKYNWCL-PSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           SA  + N  +  SLLV+ R EG    + G  P+    +   S+ML+++
Sbjct: 297 SAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLY 344

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 10  LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLE----VTTPTAAAVGKQVERYNGVI-D 64
           L F  + ++GA AG     +  PLDVVKTR Q +      TP A+A      R NG I  
Sbjct: 253 LSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPA----RLNGSIFR 308

Query: 65  CLKKIVKKEGFSRLYRGI 82
            L  +++ EG    + G+
Sbjct: 309 SLLVVLRYEGLGGAFSGV 326

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 129/308 (41%), Gaps = 26/308 (8%)

Query: 4   DSNAKP--LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG 61
           D  A P   P  +Q ++GA AGI+E +V++PLD +KTR Q      T    G+ +   + 
Sbjct: 8   DYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTG--GQPIP--ST 63

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS 121
           ++  L  I  +EG   L++G+ S +L   P  A  FA    Y+ +   L +   +T K  
Sbjct: 64  MLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFAT---YEMVKSFLIDEATSTSKYH 120

Query: 122 IXXX----XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIE 177
                            ++ PF++IK R+Q   ++ +   D  K+    EG    Y    
Sbjct: 121 FFKTAFSGATATIAADALMNPFDVIKQRIQ--LNTNISVWDTAKRIYSKEGFQAFYSSYP 178

Query: 178 STMWRN---ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDV 234
           +T+  N   A +N G +    +  N   V            + G I G     L TP D 
Sbjct: 179 TTLAINIPFAAFNFGIYDTATRYFNPSGV-----YNPFIHCLCGGISGAACAGLTTPLDC 233

Query: 235 VKSRIQ--SVDAVSSAV-KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLV 291
           +K+ +Q    + VS  V K+ +    +   IY+  G+R  + G  P++    P  ++   
Sbjct: 234 IKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWT 293

Query: 292 VFTGMMNF 299
            +    +F
Sbjct: 294 AYEFAKHF 301

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 120/289 (41%), Gaps = 20/289 (6%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F   F+ G V+     T   P++ VK   Q           G    RY G++DC ++  +
Sbjct: 11  FAIDFLMGGVSAAVAKTAASPIERVKLLIQ---NQDEMIKQGSLDHRYKGIVDCFQRTAR 67

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI---SIXXXXXX 128
           +EG    +RG ++ ++   P +A  FA  DQ + +F   F   E   K    ++      
Sbjct: 68  QEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFG--FKKEEGYAKWFAGNLASGGIA 125

Query: 129 XXXXXXVIVPFELIKIRM-QDVKSS-------YLGPMDCLKKTIKNEGIMGLYKGIESTM 180
                  +   +  + R+  D KSS       + G +D  KKTI ++G+ GLY+G   ++
Sbjct: 126 GGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSV 185

Query: 181 WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
               ++ G YFG+    +  +     +G    + L+ G +  T  +  + P D V+ R+ 
Sbjct: 186 IGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLL-GWVVTTGASTASYPLDTVRRRMM 244

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
                S    KY   +  L  I   EG  +L+KG    + R   G  ++
Sbjct: 245 ---MTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVI 290

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 121/292 (41%), Gaps = 18/292 (6%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQ--------LEVTTPTAAAVGKQVERYNGV 62
           P  YQ I+GA AGI E ++M+P+D +KTR Q           +    A           +
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACND--QYQKIFKNLFNTNETTQKI 120
           +  + +I   EG   L+RG+ S ++   P  A  FA  +  + Q I    FNT++  +  
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLK-- 136

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTI-KNEGIMGLYKGIEST 179
           +             ++ PF+ IK R+Q    S    M  +   I KNEG M  +    +T
Sbjct: 137 TAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTT 196

Query: 180 MWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKS-- 237
           +  N  +    F VIY+         T         + G I G     + TP D +K+  
Sbjct: 197 LAMNIPFAALNF-VIYESSTKF-FNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIKTVL 254

Query: 238 RIQSVDAVS-SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
           +I+  D V   + K  N    +   I++  G++  ++G  P+V    P  ++
Sbjct: 255 QIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAI 306

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 54/142 (38%), Gaps = 6/142 (4%)

Query: 160 LKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKT-KGQKTRNDLIAG 218
           + +    EG + L++G++S +      +  YF      +  +  AK     +     ++G
Sbjct: 82  ISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSG 141

Query: 219 AIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPK 278
                    L  PFD +K R+Q     S +     W +     IY+ EG  A +  +   
Sbjct: 142 VAATVAADALMNPFDTIKQRLQ---LQSKSSDSSMWRM--AFNIYKNEGPMAFFYSYPTT 196

Query: 279 VCRLAPGGSLMLVVFTGMMNFF 300
           +    P  +L  V++     FF
Sbjct: 197 LAMNIPFAALNFVIYESSTKFF 218

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 121/291 (41%), Gaps = 24/291 (8%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           F++G +A    +TV  P++++K R QL+     +AA     + Y   I  +  I K EG 
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA-----KVYKNPIQGMAVIFKNEGI 80

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
             L +G+++  + +     ++    +  +     LF  ++   K+              +
Sbjct: 81  KGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGI 140

Query: 136 I-----VPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
           I      P  L+K R+Q          ++ Y G  + L    K EG+ GL++GI++ + R
Sbjct: 141 IGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200

Query: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242
               +     +    +N +             L A  I G    ++  P+DV+ +RI + 
Sbjct: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQ 260

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                    Y   +  L+   R EG  ALYKGF  +V R+AP  ++M + F
Sbjct: 261 KG-----DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP-HTIMCLTF 305

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 82/178 (46%), Gaps = 15/178 (8%)

Query: 138 PFELIKIRMQ---DVKSS----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
           P ELIKIRMQ   ++ +S    Y  P+  +    KNEGI GL KG+ +        NG  
Sbjct: 42  PIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSR 101

Query: 191 FGVIYQVRNSM------PVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
            G    +R+S+           K Q    ++ +GA  G +G ++ +P  +VK+R+QS   
Sbjct: 102 LGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSE 161

Query: 245 VSSAVKK--YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
                ++  Y      L+ I++ EG + L++G    + R   G S+ L ++    N  
Sbjct: 162 FIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
              +  ++G+    VM P DV+ TR              ++ + Y G IDCL K V+ EG
Sbjct: 232 HLTASTISGLGVAVVMNPWDVILTRI-----------YNQKGDLYKGPIDCLVKTVRIEG 280

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
            + LY+G ++ +   AP         +Q  K+
Sbjct: 281 VTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 131/297 (44%), Gaps = 25/297 (8%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           I+G+V+G+       P+D VK R+QL+   P       Q ++Y G+   ++ I+K+EG  
Sbjct: 23  IAGSVSGVFARMATAPMDTVKIRYQLQ---PV------QEDKYKGIASTVRTIMKEEGLR 73

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVI 136
            L++G      M     A +F     +  ++   F    + Q  ++            V 
Sbjct: 74  ALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKF-PRFSQQGQTLTVGALAGMTSSVVS 132

Query: 137 VPFELIKIRMQDVKSSYLGPM--DCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
            P +L++ R+   ++S+   +  +C ++   NEG+ G + GI + M    L     F + 
Sbjct: 133 YPLDLLRTRLIANRTSHRTSVAEEC-RQMWLNEGVRGFFTGISTAMTTVTLSTAIMF-LT 190

Query: 195 YQVRNSMPVAKTKGQKTRN-DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA--------V 245
           Y+  N +     K   +R     +G I G V   +  P D ++ R+Q +++         
Sbjct: 191 YETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKF 250

Query: 246 SSAVKKYNWCLPSLLV--IYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            +   +Y +   + ++  I R+EG  ALY+G    +C+  P  ++ L V+   M+ F
Sbjct: 251 PAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDLF 307

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 213 NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALY 272
           N +IAG++ G    M   P D VK R Q +  V     KY     ++  I +EEG RAL+
Sbjct: 20  NSVIAGSVSGVFARMATAPMDTVKIRYQ-LQPVQE--DKYKGIASTVRTIMKEEGLRALW 76

Query: 273 KGFVP 277
           KG +P
Sbjct: 77  KGNIP 81

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 126/295 (42%), Gaps = 17/295 (5%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S+ K   F+  F+ G V+     T   P++ VK   Q +       ++ +   RYNG++D
Sbjct: 2   SDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDR---RYNGIVD 58

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX 124
           C K+    EG    +RG ++ ++   P +A  FA  D+ + +F      +   +  +   
Sbjct: 59  CFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNL 118

Query: 125 XXXXXXXXXXVIVPFELIKIRMQ---DVKSS-------YLGPMDCLKKTIKNEGIMGLYK 174
                     ++  + L   R +   D KS+       + G +D  KKT+ ++GI GLY+
Sbjct: 119 ASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYR 178

Query: 175 GIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDV 234
           G   ++    ++ G YFG+   ++  +     +     + L+  A+  T  +  + P D 
Sbjct: 179 GFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAV-TTGASTASYPLDT 237

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
           V+ R+      S    KY+    +   I   EG ++L+KG    + R   G  ++
Sbjct: 238 VRRRMM---MTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVI 289

>Scas_721.129
          Length = 323

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 85/178 (47%), Gaps = 15/178 (8%)

Query: 138 PFELIKIRMQDV-------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
           P EL+KIRMQ         +  Y  P+  +    +NEGI GL KG+ +        NG  
Sbjct: 41  PIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSR 100

Query: 191 FGVIYQVRNSM-----PVAKT-KGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV-D 243
            G    +RN++     P  ++ K QK   ++ AGA  G +G ++ +P  +VK+R+QS  D
Sbjct: 101 LGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSD 160

Query: 244 AVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           A+    +  Y      L  I R EGF+ L++G    + R   G S+ L ++    NF 
Sbjct: 161 AIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 118/282 (41%), Gaps = 23/282 (8%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           FI+G +A    +T   P+++VK R QL+      AAVG++V  Y   I  +  I + EG 
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQ---GELAAVGQKV--YRNPIQGMGVIFRNEGI 79

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT---QKISIXXXXXXXXXX 132
             L +G+ +  + +     ++    +  +    + F  NE +   QK+SI          
Sbjct: 80  RGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGI 139

Query: 133 XXVIV--PFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
              ++  P  L+K RMQ          ++ Y    + L    + EG  GL++GI++ + R
Sbjct: 140 IGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILR 199

Query: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242
               +     +    +N +             L A  I G    ++  P+DV+ +RI + 
Sbjct: 200 TGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIYNQ 259

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
                    Y   +   +   R EG  ALYKGF  ++ R+AP
Sbjct: 260 KG-----NLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAP 296

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
              +  ++G+    VM P DV+ TR              ++   Y G +DC  K V+ EG
Sbjct: 231 HLTASTISGLGVAVVMNPWDVILTRI-----------YNQKGNLYKGPVDCFVKTVRTEG 279

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
            S LY+G  + +L  AP         +Q  K+
Sbjct: 280 ISALYKGFQAQILRIAPHTIICLTFMEQTMKL 311

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 124/284 (43%), Gaps = 28/284 (9%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI--DCLKKIV 70
           + + +  A AGI E+ V +P+D +  R     T  T+ A      + N VI  D   +  
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGA------QLNSVIFRDHAAEAF 64

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNT---NETTQKISIX 123
            K  F+ L+ G+    + +  +R  K+      N+   K FK  F++   ++T + +   
Sbjct: 65  GKRVFT-LFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSA 123

Query: 124 XXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                      V++P +++KI+ Q    ++ G      K +K+EGI  LY+G   T  RN
Sbjct: 124 TAGSLIGIGEIVLLPLDVLKIKRQTNPEAFKG--RGFLKILKDEGIFNLYRGWGWTAARN 181

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKT-RNDLIAGAIGGTVGTMLNTPFDVVKSRIQ-- 240
           A  +   FG     +  +   +   Q T   + I+  +G +   +++ P DV+K+RIQ  
Sbjct: 182 APGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNR 241

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           + D   S  K     L       + EGF A +KG  PK+    P
Sbjct: 242 NFDNPESGFKIVKNTL-------KNEGFTAFFKGLTPKLLTTGP 278

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            FIS  V   + L V  PLDV+KTR Q            +  +        +K  +K EG
Sbjct: 213 NFISSIVGASASLIVSAPLDVIKTRIQ-----------NRNFDNPESGFKIVKNTLKNEG 261

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
           F+  ++G++  +L   PK    FA       +F N+
Sbjct: 262 FTAFFKGLTPKLLTTGPKLVFSFALAQSLIPMFDNM 297

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 126/302 (41%), Gaps = 50/302 (16%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTT--PTAAAVGKQVERYNGVIDCLKKIV 70
           I   I+G++AG     + +P D VK R Q + +   PT  +             C+K   
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWS-------------CIKFTY 60

Query: 71  KKEGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXX 129
           + EG +R  ++GI+SP++    + AT F   +Q  K  +   N     Q   +       
Sbjct: 61  QNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQ--ILISGGVAG 118

Query: 130 XXXXXVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                V+ P EL+K ++Q         K+ +   +  +K  I   G+ GL++G   T  R
Sbjct: 119 SCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIR 178

Query: 183 NALWNGGYFGVIYQV-------RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT---PF 232
            +     +F   Y++       R+S+   K    K    LI+   GG+ G   N    P 
Sbjct: 179 ESFGGVAWFAT-YEIVKKSLKDRHSLDDPKRDESKIWELLIS---GGSAGLAFNASIFPA 234

Query: 233 DVVKSRIQSVD-AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLV 291
           D VKS +Q+   ++++AVKK          I+ + G +  Y+G    + R  P  + +  
Sbjct: 235 DTVKSVMQTEHISLTNAVKK----------IFGKFGLKGFYRGLGITLFRAVPANAAVFY 284

Query: 292 VF 293
           +F
Sbjct: 285 IF 286

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 128/300 (42%), Gaps = 25/300 (8%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S A+ +  +  FI+G +A    +TV  P ++VKTR QL+      +A  +++  Y     
Sbjct: 16  SAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQ---GEMSATNQRI--YRNPFQ 70

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF---NTNETTQKIS 121
            L  I K EG   L RG+ S  + +     ++    +  + +    F   +     Q ++
Sbjct: 71  ALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVA 130

Query: 122 IXXXXXXXXXXXXVIV--PFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMG 171
           +             IV  P  L+K RMQ          ++ Y    + L    K EG++G
Sbjct: 131 VNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLG 190

Query: 172 LYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGT-VGTMLNT 230
           L++G+++ + R    +     +    +N +       + T   L++  + G  VG ++N 
Sbjct: 191 LFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMN- 249

Query: 231 PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
           P+DVV +R+ +          Y   +  +    + EG  ALYKGF  ++ R+AP   L L
Sbjct: 250 PWDVVLTRVYNQKG-----NTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCL 304

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 87/181 (48%), Gaps = 21/181 (11%)

Query: 138 PFELIKIRMQ---DVKSS----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNG-- 188
           PFEL+K RMQ   ++ ++    Y  P   L    KNEG+ GL +G+ S        NG  
Sbjct: 43  PFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSR 102

Query: 189 -GYFGVIYQVRNSMPVAKTKGQKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
            G++  I  V N     ++   K +N   ++ AGA  G +G ++ +P  +VK+R+QS   
Sbjct: 103 LGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSY-- 160

Query: 245 VSSAVK-----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
            S+A+K      Y      L  I+++EG   L++G    + R   G S+ L ++    NF
Sbjct: 161 -SNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNF 219

Query: 300 F 300
            
Sbjct: 220 L 220

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 11/92 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
             +S  V G+    VM P DVV TR              ++   Y G IDC+ K +K EG
Sbjct: 233 HLLSSTVTGLGVGIVMNPWDVVLTR-----------VYNQKGNTYKGPIDCMFKTIKIEG 281

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
              LY+G  + +   AP         +Q  K+
Sbjct: 282 IGALYKGFGAQLFRIAPHTILCLTFMEQTMKL 313

>Kwal_33.14050
          Length = 314

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 121/293 (41%), Gaps = 21/293 (7%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQ-LEVTTPTAAAVGKQVERYNGVIDCLKKI 69
           P  +Q  +GA AGI E ++M+P+D +KTR Q L  T  +A A  K     + ++  + +I
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLP---SNIVQQIARI 71

Query: 70  VKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN--ETTQKISIXXXXX 127
              EG   L++G+ S +L   P  A  FA    Y+     L +    +T Q +       
Sbjct: 72  STTEGSMALWKGVQSVILGAGPAHAVYFA---TYEMCKSYLIDPQDFQTHQPLKTAASGI 128

Query: 128 XXXXXXXVIV-PFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
                  +++ PF+ IK RMQ    S         +  +NEG+   +    +T+  N  +
Sbjct: 129 AATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPF 188

Query: 187 NGGYFGVIYQVRNSMPVAKTKGQKTRNDLI---AGAIGGTVGTMLNTPFDVVKSRIQ--- 240
               F  IY+            + T N LI    G I G     + TP D +K+ +Q   
Sbjct: 189 AAFNFA-IYESATKF----FNPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRG 243

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           S   V    ++ +    +   I +  G+   ++G  P++    P  ++    +
Sbjct: 244 SESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAY 296

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 74/180 (41%), Gaps = 23/180 (12%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKN-----------EGIMGLYKGIESTMWRN 183
           ++ P + IK RMQ + S+ +G  +   K   N           EG M L+KG++S +   
Sbjct: 33  IMFPIDAIKTRMQAL-SATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILGA 91

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDL--IAGAIGGTVGT-MLNTPFDVVKSRIQ 240
              +  YF   Y++  S  +     Q T   L   A  I  TV   +L  PFD +K R+Q
Sbjct: 92  GPAHAVYFAT-YEMCKSYLIDPQDFQ-THQPLKTAASGIAATVAADLLMNPFDTIKQRMQ 149

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
               + +  K   W + S   IYR EG  A +  +   +    P  +    ++     FF
Sbjct: 150 ----LRTFSKDRMWSVASR--IYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF 203

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 122/289 (42%), Gaps = 20/289 (6%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F+  F+ G V+     T   P++ VK   Q           G    +Y G++DC K+   
Sbjct: 23  FLIDFLMGGVSAAVAKTAASPIERVKLLIQ---NQDEMLKQGTLDRKYAGILDCFKRTAT 79

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI---SIXXXXXX 128
           +EG    +RG ++ ++   P +A  FA  D+ + +F   F   E   K    ++      
Sbjct: 80  QEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FKKEEGYAKWFAGNLASGGAA 137

Query: 129 XXXXXXVIVPFELIKIRM-QDVKSS-------YLGPMDCLKKTIKNEGIMGLYKGIESTM 180
                  +   +  + R+  D KSS       + G +D  KKT+K++G+ GLY+G   ++
Sbjct: 138 GALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSV 197

Query: 181 WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
               ++ G YFG+   ++  +     +G    + L+ G +  T  +  + P D V+ R+ 
Sbjct: 198 VGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLL-GWVVTTGASTCSYPLDTVRRRMM 256

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
                S    KY+     L  I   EG  +L+KG    + R   G  ++
Sbjct: 257 ---MTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI 302

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 133/314 (42%), Gaps = 39/314 (12%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           + +DSN         F++G +AG    TV+ P + VK   Q++ +T            YN
Sbjct: 18  LKNDSNVA-------FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTA----------YN 60

Query: 61  -GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
            G++  ++++ ++EG   L+RG     +   P  A +F   +  +K F ++  +    Q 
Sbjct: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120

Query: 120 IS---IXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYL---------------GPMDCLK 161
            +   +               P +L++ R+  ++++ L               G  D L 
Sbjct: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRL-SIQTANLTKLSKSRAHNISKPPGVWDLLC 179

Query: 162 KTIKNEG-IMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAI 220
           +T K EG I GLY+G+  T      +    F V  Q +  MP            L  GA+
Sbjct: 180 RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGAL 239

Query: 221 GGTVGTMLNTPFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKV 279
            G V   +  PFD+++ R Q +    + +  +Y   + +L+ I + EGFR  YKG    +
Sbjct: 240 SGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANL 299

Query: 280 CRLAPGGSLMLVVF 293
            ++ P  ++  +V+
Sbjct: 300 FKVIPSTAVSWLVY 313

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 9/94 (9%)

Query: 212 RND----LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNW-CLPSLLVIYREE 266
           +ND     +AG + G V   + +PF+ VK  +Q    V ++   YN   + ++  +YREE
Sbjct: 19  KNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQ----VQNSTTAYNQGIVGAVRQVYREE 74

Query: 267 GFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           G   L++G      R+ P  ++  VV+      F
Sbjct: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHF 108

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 124/293 (42%), Gaps = 44/293 (15%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F+   +SGA AG S   V +P+D +KTR Q +                           +
Sbjct: 5   FLISLLSGAAAGTSTDLVFFPIDTLKTRLQAK-----------------------GGFFR 41

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKF----ACNDQYQKIFKNLFNTNETTQKIS-IXXXX 126
             G+  +YRG+ S ++  AP  +  F     C  + +  F+ L  ++     ++ +    
Sbjct: 42  NGGYRGVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSS 101

Query: 127 XXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMG----LYKGIESTMWR 182
                   V VP E++K R Q   S      + L++ +KNE   G    LY+G  +T+ R
Sbjct: 102 MGEIAACMVRVPAEVVKQRSQTHASH--SSWETLREILKNENGEGVRRNLYRGWSTTIMR 159

Query: 183 NALWNGGYFGVI-YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQS 241
              +    F +  Y  +    + ++   +     + G+I G +     TP D +K+R+  
Sbjct: 160 EIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLM- 218

Query: 242 VDAVSSAVKKYNWCLPSLL-VIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                  + K +  L +L+  IY+EEGF+  + G  P+   ++ GG++ L ++
Sbjct: 219 -------LCKKSIPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIY 264

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 125/297 (42%), Gaps = 26/297 (8%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER--YNGVIDCLKKIVKKEG 74
           +SGA AG      + PLDV KTR Q       A  +  + E   Y G++  L  IV+ EG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQ-------AQGLQTRFENPYYRGIMGTLSTIVRDEG 134

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN----TNETTQKISIXXXXXXXX 130
              LY+G+   +L   P     F+  +  +K F  +F       ++   I+         
Sbjct: 135 PRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLT 194

Query: 131 XXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
               V+    +++  + +  + Y G  D  +K    EG   LY G+  ++    L++   
Sbjct: 195 NPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL--GLFHVAI 252

Query: 191 FGVIYQ---VRNSMPVAK--TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAV 245
              IY+   VR      +  T     +  ++A ++   + + +  P +++++R+Q    +
Sbjct: 253 HFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDI 312

Query: 246 SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
             ++++     P +   Y +EG +  Y GF   + R  P  ++ LV F     +FR+
Sbjct: 313 PDSIQRR--LFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSF----EYFRN 363

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 211 TRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKK--YNWCLPSLLVIYREEGF 268
           T+   ++GA  G +  +   P DV K+R+Q+   + +  +   Y   + +L  I R+EG 
Sbjct: 77  TQITALSGAFAGFLSGVAVCPLDVAKTRLQA-QGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 269 RALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           R LYKG VP V    P   +   V+     FF 
Sbjct: 136 RGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFH 168

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/109 (18%), Positives = 48/109 (44%), Gaps = 8/109 (7%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG 61
           S ++N   +      ++ +V+ +    V YP ++++TR QL+   P +      ++R   
Sbjct: 268 SRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDS------IQR--R 319

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
           +   +K    +EG    Y G ++ ++   P  A      + ++   +N+
Sbjct: 320 LFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENI 368

>Kwal_55.21335
          Length = 317

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 122/293 (41%), Gaps = 39/293 (13%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR- 77
           G++AG +   + YPLD +K R Q   T P           +     C+K   +KEGF + 
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQ---TQP--------AHVFPTSWSCIKYTYQKEGFVKG 100

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIV 137
            Y+G++SP++  A + A  F   ++ Q   +   + +  +Q  ++            V+ 
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQ--TVLSGAFAGACTSYVLT 158

Query: 138 PFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
           P ELIK  +Q         + S + P   +K  ++++GI GL++G  ST  R       +
Sbjct: 159 PVELIKCTLQVSNLEGATTRHSKIWP--TVKHIVQHKGIGGLWQGQSSTFIRECAGGAVW 216

Query: 191 FGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT---PFDVVKSRIQSVD-AVS 246
           F     +++ +   +   +    +L+A   G + G   N    P D +KS  Q+    + 
Sbjct: 217 FTTYESLKSYLARRRNDTENHTWELLAS--GASAGVAFNASIFPADTIKSTAQTQHLGIV 274

Query: 247 SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
            A K+          I    G   LY+G    + R AP  +++   +  + N 
Sbjct: 275 DATKR----------ILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 71/174 (40%), Gaps = 10/174 (5%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P     +SGA AG     V+ P++++K   Q+       + +     R++ +   +K IV
Sbjct: 138 PLSQTVLSGAFAGACTSYVLTPVELIKCTLQV-------SNLEGATTRHSKIWPTVKHIV 190

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXX 130
           + +G   L++G SS  + E    A  F   +  +       N  E      +        
Sbjct: 191 QHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGASAGV 250

Query: 131 XXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                I P + IK   Q   + +LG +D  K+ +   G  GLY+G+  T+ R A
Sbjct: 251 AFNASIFPADTIKSTAQ---TQHLGIVDATKRILARSGPAGLYRGLGITLIRAA 301

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 15/80 (18%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           SGA AG++    ++P D +K+  Q +               + G++D  K+I+ + G + 
Sbjct: 244 SGASAGVAFNASIFPADTIKSTAQTQ---------------HLGIVDATKRILARSGPAG 288

Query: 78  LYRGISSPMLMEAPKRATKF 97
           LYRG+   ++  AP  A  F
Sbjct: 289 LYRGLGITLIRAAPANAIVF 308

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNW-CLPSLLVIYREEGF-RAL 271
           D++ G+I G  G ++  P D +K R+Q+  A    V   +W C+      Y++EGF +  
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQTQPA---HVFPTSWSCIK---YTYQKEGFVKGF 101

Query: 272 YKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           Y+G    +   A   +++ V F    NF + 
Sbjct: 102 YQGVASPLVGAALENAVLFVTFNRAQNFLQQ 132

>Kwal_0.232
          Length = 274

 Score = 73.6 bits (179), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 121/296 (40%), Gaps = 49/296 (16%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           FI   ++GA AG S     +P+D +KTR Q        AA G                  
Sbjct: 6   FITSLLAGAAAGTSTDLFFFPIDTLKTRLQ--------AAGG---------------FFA 42

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACND---QYQK-IFKNLFNTNETTQKIS--IXXX 125
             G+  +YRG+ S ++  AP  +  F   D    Y + IF NL  +++   + +  +   
Sbjct: 43  NGGYLGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSS 102

Query: 126 XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMG----LYKGIESTMW 181
                    V VP E+IK R Q  KS     +  LKK ++NE   G    LY+G  +T+ 
Sbjct: 103 SAGEIAACMVRVPAEVIKQRTQTHKSD--SSLQTLKKLLQNENGEGIRRNLYRGWSTTVM 160

Query: 182 RNALWNGGYFGVIYQVRNSMPVAKTKGQ-KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
           R   +    F +   ++    ++  + Q         G + G +     TP DV+K+R+ 
Sbjct: 161 REIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLM 220

Query: 241 SVDAVSSAVKKYNWCLPSLLV---IYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                          +P L +   IY  EG++  + G  P+   ++ GG++ L V+
Sbjct: 221 LSHT----------SVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVY 266

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 17/89 (19%)

Query: 213 NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALY 272
             L+AGA  GT   +   P D +K+R+Q+                     +   G+  +Y
Sbjct: 8   TSLLAGAAAGTSTDLFFFPIDTLKTRLQAAGG-----------------FFANGGYLGVY 50

Query: 273 KGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           +G    V   AP  SL  V + GM ++ R
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDGMKSYSR 79

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 73.9 bits (180), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 118/300 (39%), Gaps = 27/300 (9%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P   + ISG  AG     +++PLD+ K R QL +T+ T            G  +   +IV
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTK----------KGYRNLWSEIV 56

Query: 71  KKE-GFSR-LYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNTNETTQKISIXX 124
             +   +R LYRG++  ++         FA      D        + N  + +  + +  
Sbjct: 57  GSDLSLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSA 116

Query: 125 XXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                     +  P  +IK RM    +S L  M  L+  IKN+G+ GL+KG+   +    
Sbjct: 117 SASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPAL--VG 174

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT----PFDVVKSRIQ 240
           +  G      Y       V K +      +L   A+  +V  ML+T    PF ++KS +Q
Sbjct: 175 VSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAV-TSVSKMLSTSAVYPFQLLKSNLQ 233

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           S  A  +  K     LP   +IY   G    YKG    + R  P   +   ++    +F 
Sbjct: 234 SFQASENDFK----LLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 128/312 (41%), Gaps = 39/312 (12%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74
           F++G +AG    TV+ P + VK   Q++ +T            YN G+ D + ++ K+E 
Sbjct: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTA----------YNKGLFDAIGQVYKEEN 76

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN------ETTQKISIXXXXXX 128
              L+RG     +   P  A +F     ++   K++F+ +      +      +      
Sbjct: 77  IKGLFRGNGLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133

Query: 129 XXXXXXVIVPFELIKIRM--QDVKSSYL------------GPMDCLKKTIKNE-GIMGLY 173
                    P +L++ R+  Q    S L            G    L K    E GIMGLY
Sbjct: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA---GAIGGTVGTMLNT 230
           +G+  T      +    F V  Q++  MP  +      R+ L     GAI G V   +  
Sbjct: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY 253

Query: 231 PFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
           PFD+++ R Q +    + +   YN    +L+ I + EGF+  YKG    + ++ P  ++ 
Sbjct: 254 PFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVS 313

Query: 290 LVVFTGMMNFFR 301
            +V+    ++ +
Sbjct: 314 WLVYELTWDYMK 325

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 12/180 (6%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVT--TPTAAAVGKQVERYNGVIDCLKKIVKK 72
           +  SGA+ G   +   YPLD+V+TR  ++    +  + +    + +  GV   L K   +
Sbjct: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185

Query: 73  E-GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK--ISIXXXXXXX 129
           E G   LYRG+    L   P  A  FA  +Q ++   +  N N + +     +       
Sbjct: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245

Query: 130 XXXXXVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                +  PF+L++ R Q       ++   Y    D L    K EG  G YKG+ + +++
Sbjct: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 1   MSSDSNAKP--LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE- 57
           M SD N        +Y+   GA++G    T+ YP D+++ RFQ+       A  G ++  
Sbjct: 221 MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQV------LAMGGNELGF 274

Query: 58  RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
            YN V D L  I K EGF   Y+G+++ +    P  A  +
Sbjct: 275 HYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 209 QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCL-PSLLVIYREEG 267
           Q T    +AG I G +   + +PF+ VK  +Q    V S+   YN  L  ++  +Y+EE 
Sbjct: 21  QDTNVAFLAGGIAGAISRTVVSPFERVKILLQ----VQSSTTAYNKGLFDAIGQVYKEEN 76

Query: 268 FRALYKGFVPKVCRLAPGGSLMLVVFTG 295
            + L++G      R+ P  ++  VVF G
Sbjct: 77  IKGLFRGNGLNCIRVFPYSAVQFVVFEG 104

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 73.9 bits (180), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 124/285 (43%), Gaps = 30/285 (10%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI--DCLKKIV 70
           + + +  A AGI E+ V +P+D +  R    ++  T    G+++ R   VI  D   + +
Sbjct: 11  LARLLGSASAGIMEIAVFHPVDTISKRL---MSNHTKITSGQELNR---VIFRDHFSEPL 64

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFA--------CNDQYQKIFKNLFNTNETTQKISI 122
            K  F+ L+ G+      +  +R  K+          N  Y+K F NLF   +T + +  
Sbjct: 65  GKRLFT-LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFG-EKTGKAMRS 122

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                       V++P +++KI+ Q    S+ G      K +++EG+  LY+G   T  R
Sbjct: 123 AAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKG--RGFIKILRDEGLFNLYRGWGWTAAR 180

Query: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKT-RNDLIAGAIGGTVGTMLNTPFDVVKSRIQ- 240
           NA  +   FG     +  +   K   Q T   + I+  +G     +++ P DV+K+RIQ 
Sbjct: 181 NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN 240

Query: 241 -SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
            + D   S ++     L       + EG  A +KG  PK+    P
Sbjct: 241 RNFDNPESGLRIVKNTL-------KNEGVTAFFKGLTPKLLTTGP 278

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 41/98 (41%), Gaps = 11/98 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            FIS  V   S L V  PLDV+KTR Q            +  +     +  +K  +K EG
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTRIQ-----------NRNFDNPESGLRIVKNTLKNEG 261

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN 112
            +  ++G++  +L   PK    FA        F NL +
Sbjct: 262 VTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLS 299

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 74.7 bits (182), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 130/311 (41%), Gaps = 53/311 (17%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           +SGA+AG     ++ PLDV KTR Q       A   G     Y G++  L  I++ EG +
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQ-------AQGAGSGERYYRGIVGTLSAILRDEGVA 141

Query: 77  RLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
            LY+G++  +L   P     F+    C  +Y       F ++  +               
Sbjct: 142 GLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAAS-------ALTAGAIS 194

Query: 133 XXVIVPFELIKIRM---QDV---KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALW 186
             +  P  ++K R+    DV    ++Y   +D  +K  ++EG+   Y G+  +++   L+
Sbjct: 195 TALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF--GLF 252

Query: 187 NGGYFGVIYQ-----VRNSMPVAKTKGQKTRND-------LIAGAIGGTVGTMLNTPFDV 234
           +      +Y+     +  + P A   GQ+  ++       ++A  +   V +++  P ++
Sbjct: 253 HVAIHFPVYEKLKIWLHRNTPAA--DGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEI 310

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLL----VIYREEGFRALYKGFVPKVCRLAPGGSLML 290
           +++R+Q          +++   PSLL     I   EG+   Y GF   + R  P   + L
Sbjct: 311 LRTRMQV---------RHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITL 361

Query: 291 VVFTGMMNFFR 301
           V F     + R
Sbjct: 362 VSFEYFRKYLR 372

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 209 QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGF 268
             T+   ++GA+ G V  ++  P DV K+R+Q+  A  S  + Y   + +L  I R+EG 
Sbjct: 82  DDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGA-GSGERYYRGIVGTLSAILRDEGV 140

Query: 269 RALYKGFVPKVCRLAPGGSLMLVVF 293
             LYKG  P V    P   L   V+
Sbjct: 141 AGLYKGLAPIVLGYFPTWMLYFSVY 165

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 82/167 (49%), Gaps = 8/167 (4%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           +GA +GI    +  PL +VKTR Q   +   A  +G+Q   Y GV + LK I   EG   
Sbjct: 130 AGAASGIIGAVMGSPLFLVKTRLQ---SYSNAIKIGEQTH-YTGVWNGLKTIYMTEGVKG 185

Query: 78  LYRGISSPMLMEAPKRATKFAC-NDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVI 136
           L+RGI + +L      + +    N     + +N  +  E    + +            V+
Sbjct: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN--DIMEDGPSLHLTASTISGLGVAVVM 243

Query: 137 VPFELIKIRMQDVKSS-YLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
            P+++I  R+ + K   Y GP+DCL KT+K EGI  LYKG E+ ++R
Sbjct: 244 NPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFR 290

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 82/181 (45%), Gaps = 21/181 (11%)

Query: 138 PFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNG-- 188
           P E++KIRMQ         +  Y  P   +    +NEGI GL KG+ +        NG  
Sbjct: 38  PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSR 97

Query: 189 -GYFGVIYQVRNSMPVAKTKGQKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
            G++  I  V N       +  K ++   ++ AGA  G +G ++ +P  +VK+R+QS   
Sbjct: 98  LGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQS--- 154

Query: 245 VSSAVK-----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
            S+A+K      Y      L  IY  EG + L++G    + R   G S+ L ++    NF
Sbjct: 155 YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNF 214

Query: 300 F 300
            
Sbjct: 215 L 215

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/310 (20%), Positives = 117/310 (37%), Gaps = 23/310 (7%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S A+ +     F +G +A    +TV  P++VVK R QL+        +      Y     
Sbjct: 11  SAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQ-----GELMAANQRIYTNPFQ 65

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXX 124
            +  + + EG   L +G+ +  + +     ++    +  + +    F  ++ + K+    
Sbjct: 66  AMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVG 125

Query: 125 XXXXXXXXXXVI-----VPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMG 171
                     +I      P  L+K R+Q          ++ Y G  + LK     EG+ G
Sbjct: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185

Query: 172 LYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTP 231
           L++GI++ + R    +     +    +N +             L A  I G    ++  P
Sbjct: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNP 245

Query: 232 FDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLV 291
           +DV+ +RI +          Y   +  L+   + EG  ALYKGF  +V R+ P   L L 
Sbjct: 246 WDVILTRIYNQKG-----DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLT 300

Query: 292 VFTGMMNFFR 301
                M    
Sbjct: 301 FLEQTMKLVH 310

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 123/299 (41%), Gaps = 28/299 (9%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P   Q ++GA AGI E ++M+P+D +KTR Q         A G       G+I  + KI 
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQ---------AAGLNKAASTGMISQISKIS 72

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN--ETTQKISIXXXXXX 128
             EG   L++G+ S +L   P  A  F     Y+     L +    +T Q +        
Sbjct: 73  TMEGSMALWKGVQSVILGAGPAHAVYFG---TYEFCKARLISPEDMQTHQPMKTALSGTI 129

Query: 129 XXXXXXVIV-PFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
                  ++ PF+ +K R+Q    + L   +  K+  +NEG    Y    +T+  N  + 
Sbjct: 130 ATIAADALMNPFDTVKQRLQ--LDTNLRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFA 187

Query: 188 GGYFGVIYQVRNSMPVAKTKGQKTRNDLI---AGAIGGTVGTMLNTPFDVVKS--RIQSV 242
              F +IY+  +         Q + N LI    G I G     L TP D +K+  +++  
Sbjct: 188 AFNF-MIYESASKF----FNPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGS 242

Query: 243 DAVSSAV-KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           + VS  + K  N    +   I    G++  ++G  P++    P  ++    +    +F 
Sbjct: 243 ETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 117/294 (39%), Gaps = 35/294 (11%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR- 77
           G+VAG     + YP D VK R Q   T P           Y     C++     EG  + 
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQ---TQP--------AHLYPTTWSCIRSTYTDEGIWKG 62

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIV 137
            Y+GI+SP+   A + A  F   +Q              T+  +I            ++ 
Sbjct: 63  FYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTK--TIYSGAFAGACASFILT 120

Query: 138 PFELIKIRMQ--DVKSS------YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
           P EL+K ++Q  ++ +S      +      +K  IK +G++GL++G  ST  R  L    
Sbjct: 121 PVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAV 180

Query: 190 YFGV--IYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD-AVS 246
           +F    I +++ +      K   T   L++GA  G +      P D VKS  Q+   ++ 
Sbjct: 181 WFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHVSIV 240

Query: 247 SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           +A+KK          + R  G    Y+G    + R AP  + +   +  +   F
Sbjct: 241 NALKK----------VLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 77/182 (42%), Gaps = 8/182 (4%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P      SGA AG     ++ P+++VK + Q+   + + +    Q  R+  V   +K ++
Sbjct: 100 PLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLS----QTTRHTSVWPTIKSVI 155

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXX 130
           K++G   L++G  S  + E    A  F   +  +  F +L    +      +        
Sbjct: 156 KEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAG 215

Query: 131 XXXXV-IVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGG 189
                 + P + +K   Q   + ++  ++ LKK ++  GI G Y+G+  T+ R A  N  
Sbjct: 216 VLFNASVFPADTVKSVCQ---TEHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANAT 272

Query: 190 YF 191
            F
Sbjct: 273 VF 274

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 15/92 (16%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            +SGA AG+     ++P D VK+  Q E               +  +++ LKK+++  G 
Sbjct: 208 LVSGASAGVLFNASVFPADTVKSVCQTE---------------HVSIVNALKKVLRTHGI 252

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIF 107
           +  YRG+   ++  AP  AT F   +  +K+F
Sbjct: 253 TGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNW-CLPSLLVIYREEG-FRAL 271
           D+  G++ G +G ++  PFD VK R+Q+  A    +    W C+ S    Y +EG ++  
Sbjct: 10  DIAYGSVAGAIGKVIEYPFDTVKVRLQTQPA---HLYPTTWSCIRS---TYTDEGIWKGF 63

Query: 272 YKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           Y+G    +   A   +++ V F    NF  +
Sbjct: 64  YQGIASPLFGAALENAVLFVSFNQCTNFLDE 94

>Kwal_55.20868
          Length = 380

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 120/301 (39%), Gaps = 28/301 (9%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           +SGA+AG      + PLDV KTR Q +               Y G++  L  I++ EG  
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQ------GLHSNPSNYYKGILGTLTTIIRDEGAR 133

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNT----NETTQKISIXXXXXXXXXX 132
            LY+G+   ++   P     F+  ++ +K++  +F +    + +   ++           
Sbjct: 134 GLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTVSTILTNP 193

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
             V+    +++  +    + Y    D   K    EG+   Y G+  ++    L++     
Sbjct: 194 VWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL--GLFHVAIHF 251

Query: 193 VIYQ-------VRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ----S 241
            IY+          SM   +         +IA +    V + L  P +++++R+Q     
Sbjct: 252 PIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYP 311

Query: 242 VDAVSSAVKKYNWCLPSLL-VIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            D +++  K     L  L+   Y+ EG R  Y GF   + R  P  ++ LV F     +F
Sbjct: 312 TDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSF----EYF 367

Query: 301 R 301
           R
Sbjct: 368 R 368

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%)

Query: 199 NSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPS 258
           N++P        T    ++GA+ G +  +   P DV K+R+Q+    S+    Y   L +
Sbjct: 63  NTIPFVNRSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGT 122

Query: 259 LLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           L  I R+EG R LYKG VP +    P   +   V+
Sbjct: 123 LTTIIRDEGARGLYKGLVPIIMGYFPTWMIYFSVY 157

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           I+ + + +   T+ YP ++++TR QL+   PT      Q    +G+I  +K   K EG  
Sbjct: 282 IASSASKMVASTLTYPHEILRTRMQLKAY-PTDPLAALQKTSRHGLIRLIKHTYKSEGLR 340

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET 116
             Y G ++ +    P  A      + ++K    L N N T
Sbjct: 341 GFYSGFTANLARTLPASAITLVSFEYFRKYLTKL-NDNFT 379

>Kwal_27.12481
          Length = 304

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 122/293 (41%), Gaps = 20/293 (6%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           K   F   F+ G V+     T   P++ VK   Q +       ++ +   RY G+ +C K
Sbjct: 6   KQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDR---RYTGIGECFK 62

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI---SIXX 124
           +    EG +  +RG ++ ++   P +A  FA  D+ + +F   F   E   K    ++  
Sbjct: 63  RTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FKKEEGYAKWFAGNLAS 120

Query: 125 XXXXXXXXXXVIVPFELIKIRMQ-DVKSS-------YLGPMDCLKKTIKNEGIMGLYKGI 176
                      +   +  + R+  D K +       + G +D  KKT+ ++GI GLY+G 
Sbjct: 121 GGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 177 ESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVK 236
             ++    ++ G YFG    ++  +     +G    + L+  A+  T  +  + P D V+
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAV-TTGASTASYPLDTVR 239

Query: 237 SRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
            R+      S    KYN    +   I   EG ++L+KG    + R   G  ++
Sbjct: 240 RRMM---MTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 128/300 (42%), Gaps = 22/300 (7%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MS+D   K   F   F+ G V+     T   P++ VK   Q +       ++ +   RY 
Sbjct: 1   MSTDK--KQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDR---RYT 55

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120
           G+++C K+    EG +  +RG ++ ++   P +A  FA  D+ + +F   F   E   K 
Sbjct: 56  GIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FKKEEGYAKW 113

Query: 121 ---SIXXXXXXXXXXXXVIVPFELIKIRMQ-DVKSS-------YLGPMDCLKKTIKNEGI 169
              ++             +   +  + R+  D KS+       + G +D  KKT+ ++G+
Sbjct: 114 FAGNLASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGV 173

Query: 170 MGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLN 229
            GLY+G   ++    ++ G YFG+   ++  +     +     + L+  A+  T  +  +
Sbjct: 174 AGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAV-TTGASTAS 232

Query: 230 TPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
            P D V+ R+      S    KY+    +   I   EG ++L+KG    + R   G  ++
Sbjct: 233 YPLDTVRRRMM---MTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

>Scas_669.6
          Length = 373

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 122/299 (40%), Gaps = 47/299 (15%)

Query: 30  MYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR-LYRGISSPMLM 88
           M+ LD VKTR Q    TP          +Y  +    + I  +EG +R LY G  + ML 
Sbjct: 69  MHSLDTVKTRQQGAPMTP----------KYKNMTTAYRTIFLEEGIARGLYGGYFAAMLG 118

Query: 89  EAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQ- 147
             P  A  F   +  ++        N+T   +S             V VP E++K R+Q 
Sbjct: 119 SFPSAAIFFGTYEWCKRKMIGDLGFNDTVSHLS--AGLLGDFVSSFVYVPSEVLKTRLQL 176

Query: 148 ---------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVR 198
                        +Y      ++  +  EG+  L+ G ++T+ R+  ++   FG   + R
Sbjct: 177 QGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFR 236

Query: 199 NSMPVAKTKGQKTRN-----DLIAGAIGGTVGTMLNTPFDVVKSRIQ------------S 241
            +    + K     N     ++  GAI G +  ++ TP DV+K+R+Q            +
Sbjct: 237 QTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATT 296

Query: 242 VDAVSSAVKK-------YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           V A+S+   K        N    SL ++Y+ EG    + G  P+    +   S+ML+++
Sbjct: 297 VGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLY 355

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQL---EVTTPTAAAVG----------KQVERYNG 61
           +  +GA+AG     +  P+DV+KTR Q    ++   +A  VG          + +   N 
Sbjct: 257 EIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNS 316

Query: 62  VIDCLKKIVKKEGFSRLYRGI 82
           +   LK + + EG    + G+
Sbjct: 317 IFRSLKLVYQSEGVIGFFSGV 337

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 121/291 (41%), Gaps = 19/291 (6%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG 61
            +++  +   F   F+ G V+     T   P++ VK   Q           G    RY G
Sbjct: 3   HTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQ---NQEEMLKQGSLDTRYKG 59

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS 121
           ++DC K+    EG    +RG ++ +L   P +A  FA  D+ + +       +   +  +
Sbjct: 60  ILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFA 119

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQ---DVKSS-------YLGPMDCLKKTIKNEGIMG 171
                        ++  + L   R +   D + S       + G +D  KKT+K +G++G
Sbjct: 120 GNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLG 179

Query: 172 LYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVG-TMLNT 230
           LY+G   ++    ++ G YFG+    +  +     +G    + L+   I  T+G +  + 
Sbjct: 180 LYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVI--TMGASTASY 237

Query: 231 PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
           P D V+ R+      S    KY+  L  L  I ++EG  +L+KG    + R
Sbjct: 238 PLDTVRRRMM---MTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 74/177 (41%), Gaps = 13/177 (7%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F     SG  AG   L  +Y LD  +TR   +     + +      ++NG++D  KK +K
Sbjct: 118 FAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQ----RQFNGLLDVYKKTLK 173

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXX 131
            +G   LYRG    +L     R   F   D ++ +   L    E +   S          
Sbjct: 174 TDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVL--LTGALEGSFVASFLLGWVITMG 231

Query: 132 XXXVIVPFELIKIRM-----QDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                 P + ++ RM     Q +K  Y G +DCL+K ++ EG   L+KG  + ++R 
Sbjct: 232 ASTASYPLDTVRRRMMMTSGQTIK--YDGALDCLRKIVQKEGAYSLFKGCGANIFRG 286

>Kwal_23.3529
          Length = 395

 Score = 71.6 bits (174), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 124/288 (43%), Gaps = 35/288 (12%)

Query: 28  TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR-LYRGISSPM 86
           +VM+ LD VKTR Q     P          +Y  +I   +KI  +EG  R LY G ++ M
Sbjct: 101 SVMHSLDTVKTRQQGAPNAP----------KYRNMISAYQKIFMEEGIRRGLYGGYTAAM 150

Query: 87  LMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRM 146
           L   P  A  F   +  ++   + +  NET   ++             V VP E++K R+
Sbjct: 151 LGSFPSAAIFFGTYELTKRKLIDDWGVNETLSHLT--AGLSGDLVSSVVYVPSEVLKTRL 208

Query: 147 QDVKSSYLGPM-----------DCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIY 195
           Q ++  Y  P            D +   ++ EG   L+ G ++T+ R+  ++   F    
Sbjct: 209 Q-LQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

Query: 196 QVRNSMPV--AKTKGQKTR--NDLIAGAIGGTVGTMLNTPFDVVKSRIQS------VDAV 245
           + R        KT  Q     N+L+ GA  G +  ++ TP DV+K+RIQ+          
Sbjct: 268 KFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDS 327

Query: 246 SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           +  V+  N  +  L  +YR EG    + G  P+    +   S+ML+++
Sbjct: 328 TRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 122/300 (40%), Gaps = 49/300 (16%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR- 77
           G++AG     + YP D VK R Q +         G+ V  +     C+    K EG  + 
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ---------GRHV--FPDTWSCITYTYKNEGIIKG 68

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIV 137
            ++GI+SP+   A + A  F   +Q  K  ++  N ++ T    +            V+ 
Sbjct: 69  FFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTN--ILISGAFAGSCASFVLT 126

Query: 138 PFELIKIRMQ--DVKSSYLGP-------------MDCLKKTIKNEGIMGLYKGIESTMWR 182
           P ELIK ++Q  +++S  LG              +  ++  IKN G +GL++G   T  R
Sbjct: 127 PVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIR 186

Query: 183 NALWNGGYFGVIYQV--------RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDV 234
            +     +F   Y++         N    +     KT   L +GA  G        P D 
Sbjct: 187 ESFGGVAWFAT-YELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADT 245

Query: 235 VKSRIQSVD-AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           VKS +Q+    + +A+KK          I+ E+G R  Y+G    + R  P  + +  V+
Sbjct: 246 VKSMMQTEHLGLKTAIKK----------IFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 82/177 (46%), Gaps = 14/177 (7%)

Query: 138 PFELIKIRMQDVKSSYLGP--MDCLKKTIKNEGIM-GLYKGIESTMWRNALWNGGYFGVI 194
           PF+ +K+R+Q  +  ++ P    C+  T KNEGI+ G ++GI S +   A+ N   F + 
Sbjct: 33  PFDTVKVRLQ-TQGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALF-LS 90

Query: 195 YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ---------SVDAV 245
           Y   +      T      N LI+GA  G+  + + TP +++K ++Q          V   
Sbjct: 91  YNQCSKFLQHYTNVSDLTNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGG 150

Query: 246 SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           ++  +++   +P++  + +  GF  L++G      R + GG      +  M  + + 
Sbjct: 151 NTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKS 207

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 16/178 (8%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLE--VTTPTAAAVGKQV-ERYNGVIDCLKKIVKK 72
            ISGA AG     V+ P++++K + Q+    + P   A G  V ER+  +I  ++ ++K 
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFK--------NLFNTNETTQKISIXX 124
            GF  L++G S   + E+      FA  +  +K  K        +L N N+T + ++   
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLA--S 228

Query: 125 XXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                      I P + +K  MQ   + +LG    +KK    +G+ G Y+G+  T+ R
Sbjct: 229 GASAGLAFNASIFPADTVKSMMQ---TEHLGLKTAIKKIFVEKGLRGFYRGLGITLIR 283

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 15/89 (16%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           SGA AG++    ++P D VK+  Q E               + G+   +KKI  ++G   
Sbjct: 228 SGASAGLAFNASIFPADTVKSMMQTE---------------HLGLKTAIKKIFVEKGLRG 272

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKI 106
            YRG+   ++   P  AT F   +   K+
Sbjct: 273 FYRGLGITLIRAIPANATVFYVYETLSKL 301

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQS 241
           D++ G+I G +G ++  PFD VK R+Q+
Sbjct: 16  DILYGSIAGALGKVIEYPFDTVKVRLQT 43

>Scas_667.4
          Length = 308

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 123/301 (40%), Gaps = 21/301 (6%)

Query: 1   MSSDSNAKPLP-FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY 59
           MSS    K    F   F+ G V+     T   P++ VK   Q           G    +Y
Sbjct: 1   MSSKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQ---NQDEMIKQGSLDSKY 57

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
            G+I+C ++  K EG    +RG ++ ++   P +A  FA  D+ + +F   F   E   K
Sbjct: 58  KGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FKKEEGYGK 115

Query: 120 I---SIXXXXXXXXXXXXVIVPFELIKIRM-QDVKSS-------YLGPMDCLKKTIKNEG 168
               ++             +   +  + R+  D KSS       Y G +D  K+T+  +G
Sbjct: 116 WFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDG 175

Query: 169 IMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTML 228
           + GLY+G   ++    ++ G YFG+   ++ ++     +G    + L+ G I  T  +  
Sbjct: 176 MAGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLL-GWIVTTGASTA 234

Query: 229 NTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
           + P D V+ R+      S    KY+        +   EG  +L+KG    + R   G  +
Sbjct: 235 SYPLDTVRRRMM---MTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

Query: 289 M 289
           +
Sbjct: 292 I 292

>Scas_558.2
          Length = 289

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 123/304 (40%), Gaps = 54/304 (17%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F+   +SGA AG S   V +P+D +KTR Q +                           +
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAK-----------------------GGFFQ 42

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACND----QYQKIFKNLFNTNETTQKISIXXXXX 127
             G+  +YRG+ S ++  AP  +  F   D    + +   + + N++ T    S+     
Sbjct: 43  NGGYHGIYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVH 102

Query: 128 XXXXXX------XVIVPFELIKIRMQ--DVKSSYLGPMDCLKKTIKNEG----IMGLYKG 175
                        V VP E+IK R Q     SS+       +  +KNE     I  LY+G
Sbjct: 103 MIASSMGELAACLVRVPAEVIKQRTQVHSTNSSW----QTFRTILKNENQEGIIRNLYRG 158

Query: 176 IESTMWRNALWNGGYFGVIYQVRNSMPVAKTK--GQKTRNDLIAGAIGGTVGTMLNTPFD 233
             +T+ R   +    F +   ++    +   +    K     I G+I G +     TP D
Sbjct: 159 WSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLD 218

Query: 234 VVKSRIQSVDAVSSAVKKYNWCLPSLLV-IYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292
            +K+R+         + K +  + SL+  IY+EEGF+  + G  P+   ++ GG++ L V
Sbjct: 219 FLKTRLM--------LNKDSIPIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGV 270

Query: 293 FTGM 296
           +  M
Sbjct: 271 YETM 274

>Scas_632.9
          Length = 292

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 87/171 (50%), Gaps = 9/171 (5%)

Query: 138 PFELIKIRMQDVKSSYLGPM--DCLKKTIKNEGIM-GLYKGIESTMWRNALWNGGYFGVI 194
           PF+ +K+R+Q  + S++ P    C+K T  NEG+  G ++GI S ++  AL N   F   
Sbjct: 37  PFDTVKVRLQ-TQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSY 95

Query: 195 YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVK---K 251
            Q  N +    T      N L++GA  G+  + + TP +++K ++Q V  + +AV+   K
Sbjct: 96  NQCSNVLE-KFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKLQ-VSNLQTAVEGQIK 153

Query: 252 YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           +   +P+L+ + RE+G   L++G      R + GG      +  M    +D
Sbjct: 154 HTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKD 204

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 122/288 (42%), Gaps = 34/288 (11%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G++AG     + YP D VK R Q +         G  +  +     C+K     EG  
Sbjct: 22  VNGSIAGAFGKIIEYPFDTVKVRLQTQ---------GSHI--FPTTWSCIKYTYHNEGVW 70

Query: 77  R-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
           R  ++GI SP+   A + AT F   +Q   + +   N +  +    +            V
Sbjct: 71  RGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNI--LLSGAFAGSCASFV 128

Query: 136 IVPFELIKIRMQ--DVKSSYLGPMD------CLKKTIKNEGIMGLYKGIESTMWRNALWN 187
           + P ELIK ++Q  +++++  G +        L   ++ +GI+GL++G  ST  R +L  
Sbjct: 129 LTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

Query: 188 GGYFGVIYQVRNSM-PVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD-AV 245
             +F     ++  +    K    KT   L++GA  G        P D VKS +Q+    +
Sbjct: 189 VAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHITL 248

Query: 246 SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
            +AVKK       +L  Y   GF   Y+G    + R  P  + +  ++
Sbjct: 249 INAVKK-------VLTTYGITGF---YRGLGITLIRAVPANATVFYMY 286

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 202 PVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNW-CLPSLL 260
           P+ K+  Q   +D++ G+I G  G ++  PFD VK R+Q+     S +    W C+    
Sbjct: 8   PIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQT---QGSHIFPTTWSCIK--- 61

Query: 261 VIYREEG-FRALYKG 274
             Y  EG +R  ++G
Sbjct: 62  YTYHNEGVWRGFFQG 76

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            +SGA AG++    ++P D VK+  Q E  T               +I+ +KK++   G 
Sbjct: 217 LVSGASAGLAFNASIFPADTVKSMMQTEHIT---------------LINAVKKVLTTYGI 261

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKI 106
           +  YRG+   ++   P  AT F   +   K+
Sbjct: 262 TGFYRGLGITLIRAVPANATVFYMYETLSKM 292

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 128/301 (42%), Gaps = 37/301 (12%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG-VIDCLKKIVKKEG 74
           F++G V G    TV+ P++ VK   Q++ +T            YNG ++  +K++ K+EG
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTA----------YNGGLVHAVKQVYKEEG 69

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI-----SIXXXXXXX 129
              L+RG     L   P  A ++A    Y+     +F+  ++  +       +       
Sbjct: 70  VKGLFRGNGINCLRIFPYSAVQYAV---YEFCKTRVFHVGQSGHEQLRSWERLVGGALGG 126

Query: 130 XXXXXVIVPFELIKIRMQDVKSSYL---------------GPMDCLKKTIKNEG-IMGLY 173
                V  P +L++ R+  ++++ L               G ++ L++  + EG + G Y
Sbjct: 127 GASVLVTYPLDLVRTRL-SIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWY 185

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFD 233
           +G+  T      +    F +  +++  +P     G      L  GA+ G +   +  PFD
Sbjct: 186 RGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFD 245

Query: 234 VVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292
           +++ R Q +    S +  +Y     +L  I R+EG R  YKG    + ++ P  ++   V
Sbjct: 246 LLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFV 305

Query: 293 F 293
           +
Sbjct: 306 Y 306

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           GAV+G    TV+YP D+++ RFQ  V T   + +G    RY  V D L  I ++EG    
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQ--VLTMGQSELGF---RYASVADALWTIGRQEGLRGY 284

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
           Y+G+++ ++   P  A ++     Y+ I +N+
Sbjct: 285 YKGLTANLVKVVPAMAVQWFV---YELISENM 313

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 126/290 (43%), Gaps = 37/290 (12%)

Query: 28  TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR-LYRGISSPM 86
           + M+ LD VKTR Q   +T           +Y  +I   + I+ +EG  + LY G S  M
Sbjct: 71  SAMHSLDTVKTRQQGAPST----------VKYKNMIGAYRTIILEEGLRKGLYGGYSGAM 120

Query: 87  LMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRM 146
           L   P  A  FA  +  ++     +  NET   ++             V VP E++K R+
Sbjct: 121 LGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLT--AGFLGDFISSFVYVPSEVLKTRL 178

Query: 147 QDVKSSYLGPM-----------DCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIY 195
           Q ++  Y  P            D +   ++ EG   L+ G ++T+ R+  ++G  F    
Sbjct: 179 Q-LQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYE 237

Query: 196 QVRNSMPVAKTK----GQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV-----DAVS 246
           + R      + K         N++I GA  G +  ++ TP DVVK+RIQ+      +  S
Sbjct: 238 KFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSS 297

Query: 247 SAVKKY---NWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
             +K+    N     ++ +Y+ EG   L+ G  P+    +   S+ML+++
Sbjct: 298 QNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 128/313 (40%), Gaps = 39/313 (12%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74
           F++G VAG    TV+ P + VK   Q++ +T +          YN G+   ++++  +EG
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS----------YNRGIFSSIRQVYHEEG 75

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN------ETTQKISIXXXXXX 128
              L+RG     +   P  A +F     Y+   K LF+ N      + T    +      
Sbjct: 76  TKGLFRGNGLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132

Query: 129 XXXXXXVIVPFELIKIRM--QDVKSSYL------------GPMDCLKKTIKNEG-IMGLY 173
                    P +LIK R+  Q    S L            G    L +T + EG + GLY
Sbjct: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLY 192

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRN---SMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT 230
           +G+  T      +    F V  Q+R    +   A+   +     L  GAI G V   +  
Sbjct: 193 RGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITY 252

Query: 231 PFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
           PFD+++ R Q +    + +  +Y     +L+ I R EG    YKG    + ++ P  ++ 
Sbjct: 253 PFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVS 312

Query: 290 LVVFTGMMNFFRD 302
            +V+  + +  R+
Sbjct: 313 WLVYEVVCDSVRN 325

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 78/180 (43%), Gaps = 12/180 (6%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAA--AVGKQVERYNGVIDCLKKIVKK 72
           +  SGA+ G   +   YPLD++KTR  ++    ++   +  K + +  G+   L +  + 
Sbjct: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRL 184

Query: 73  EGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET--TQKISIXXXXXXX 129
           EG  R LYRG+    L   P  A  FA  +Q ++   N  +   +  +    +       
Sbjct: 185 EGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISG 244

Query: 130 XXXXXVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                +  PF+L++ R Q       ++   Y    D L    + EG+ G YKG+ + +++
Sbjct: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE-RYN 60
           SSD+       +Y+   GA++G    T+ YP D+++ RFQ+       A  G ++  RY 
Sbjct: 223 SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQV------LAMGGNELGFRYT 276

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
            V D L  I + EG S  Y+G+++ +    P  A  +
Sbjct: 277 SVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313

>Scas_562.12
          Length = 300

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 125/300 (41%), Gaps = 44/300 (14%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           SN +    + + +  A AGI E+ V +P+D +  R     T      +G   E       
Sbjct: 3   SNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTK-----IGNSHE------- 50

Query: 65  CLKKIVKKEGFSR--------LYRGISSPMLMEAPKRATKFA--------CNDQYQKIFK 108
            L +++ +E FS         L+ G+      +  +R  K+          N  Y+K F 
Sbjct: 51  -LNRVIFREHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFD 109

Query: 109 NLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEG 168
           + F   +T + +              V++P +++KI+ Q    ++ G      K +K+EG
Sbjct: 110 SAFG-EKTGKAMRSATAGSLIGIGEIVLLPLDVLKIKRQTNPEAFKG--RGFVKILKDEG 166

Query: 169 IMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKT-RNDLIAGAIGGTVGTM 227
           I  LY+G   T  RNA  +   FG     +  +   +   Q +   + I+  +G +   +
Sbjct: 167 IFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLI 226

Query: 228 LNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVI---YREEGFRALYKGFVPKVCRLAP 284
           ++ P DV+K+RIQ+        + ++     L ++   ++ EG  A +KG  PK+    P
Sbjct: 227 VSAPLDVIKTRIQN--------RSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGP 278

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 11/98 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            FIS  V     L V  PLDV+KTR Q            +  +     +  +K   K EG
Sbjct: 213 NFISSIVGASCSLIVSAPLDVIKTRIQ-----------NRSFDNPETGLTIVKNTFKNEG 261

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN 112
            +  ++G++  +L   PK    FA        F +L +
Sbjct: 262 ITAFFKGLTPKLLTTGPKLVFSFALAQSLIPKFDSLLS 299

>Scas_718.24
          Length = 337

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 123/297 (41%), Gaps = 21/297 (7%)

Query: 5   SNAKPLP-FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI 63
           S  KP   F   F+ G V+     T   P++ VK   Q           G    +Y G++
Sbjct: 34  STEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQ---NQNEMLKQGTLDTKYKGIV 90

Query: 64  DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI--- 120
           DC ++  ++EG    +RG ++ ++   P +A  FA  D+ + +F   F   +   K    
Sbjct: 91  DCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG--FKKEDGYGKWFAG 148

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQ-DVKSS-------YLGPMDCLKKTIKNEGIMGL 172
           ++             +   +  + R+  D KSS       + G +D  KKT+K++G+ GL
Sbjct: 149 NLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGL 208

Query: 173 YKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPF 232
           Y+G   ++    ++ G YFG+   ++  +     +G    + L+ G +  T  +  + P 
Sbjct: 209 YRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLL-GWVVTTGASTCSYPL 267

Query: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLM 289
           D V+ ++      S    KY         I   EG  +L+KG    + R   G  ++
Sbjct: 268 DTVRRKMM---MTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVI 321

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 126/292 (43%), Gaps = 29/292 (9%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI- 63
           +N K    + + +  A AGI E+ V +P+D +  R    ++  T  A   Q+   N VI 
Sbjct: 3   TNDKKQSGLARVLGSASAGILEIGVFHPVDTISKRL---MSNHTKIASTSQL---NSVIF 56

Query: 64  -DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNT---NE 115
            D   + + +   S L+ G+      +  +R  K+      N+   K FK  F+     +
Sbjct: 57  RDFASEPLGRRLLS-LFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEK 115

Query: 116 TTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKG 175
           T + +              V++P +++KI+ Q    S+ G      K IK+EG  GLY+G
Sbjct: 116 TGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFKG--RGFLKIIKDEG-FGLYRG 172

Query: 176 IESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKT-RNDLIAGAIGGTVGTMLNTPFDV 234
              T  RNA  +   FG     +  +   K  GQ T   + ++  +G +   +++ P DV
Sbjct: 173 WGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDV 232

Query: 235 VKSRIQ--SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +K+RIQ  + D   S  K     L       + EGF A +KG  PK+    P
Sbjct: 233 IKTRIQNRNFDNPESGFKIIKNTL-------KNEGFTAFFKGLTPKLLTTGP 277

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            F+S  V   + L V  PLDV+KTR Q            +  +        +K  +K EG
Sbjct: 212 NFVSSIVGASASLIVSAPLDVIKTRIQ-----------NRNFDNPESGFKIIKNTLKNEG 260

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
           F+  ++G++  +L   PK    FA       IF NL
Sbjct: 261 FTAFFKGLTPKLLTTGPKLVFSFALAQTLIPIFDNL 296

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 123/291 (42%), Gaps = 31/291 (10%)

Query: 14  YQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKE 73
           Y +  G  AGI  +   +PLD+ K R Q       AA + K       ++  L+ I+K E
Sbjct: 8   YPWWYGGAAGIFAVMNTHPLDLTKVRLQ-------AAPIPKPT-----IVQMLRSILKNE 55

Query: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXX 133
           G   LY G+S+ +L +      +F     Y  + +++   ++ T    +           
Sbjct: 56  GIVGLYAGLSASLLRQCTYTTARFG---MYDALKEHVIPRDKLTNMWYLLGASMVSGALG 112

Query: 134 XVIVPF-ELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLY-KGIESTMWRNA 184
            +   F +LI IRMQ       D + +Y   +D + K  K EG   L+  G +  M R  
Sbjct: 113 GLAGNFADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGV 172

Query: 185 LWNGGYFGVIYQVRNSMPVAK--TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242
           L       V Y +  +  V K     +K    L +  + G V T + +P DV+K+ +  +
Sbjct: 173 LMTASQV-VTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIV--M 229

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           +A       ++     L+    +EG   +++G+VP   RLAP    ML+ F
Sbjct: 230 NAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAP--FTMLIFF 278

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 67.8 bits (164), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 128/300 (42%), Gaps = 44/300 (14%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F+   +SGA AG S   V +P+D +KTR Q            K    +NG          
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTRLQ-----------AKGGFFHNG---------- 43

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS-----IXXXX 126
             G+  +YRG+ S ++  AP  +  F   D  ++  + +      +++++     +    
Sbjct: 44  --GYRGIYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSS 101

Query: 127 XXXXXXXXVIVPFELIKIRMQDVKS-SYLGPMDCLKKTIKNEGIM-GLYKGIESTMWRNA 184
                   V VP E+IK R Q   + S L  +  + +    EG++ GLY+G  +T+ R  
Sbjct: 102 LGEMSACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREI 161

Query: 185 LWNGGYFGVI-YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243
            +    F +  Y  +     A+ +        + G++ G +     TP DV+K+R+    
Sbjct: 162 PFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMM--- 218

Query: 244 AVSSAVKKYNWCLPSLLV---IYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
                   +   +P L +   ++REEG R  ++G  P+   ++ GG++ L V+  + + F
Sbjct: 219 -------LHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 17/88 (19%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
            L++GA  GT   ++  P D +K+R+Q+                     +   G+R +Y+
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG-----------------FFHNGGYRGIYR 50

Query: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           G    V   APG SL  V +  M    R
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSMKQQLR 78

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 130/322 (40%), Gaps = 47/322 (14%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQ---LEVTTPTAAAVGKQV-----ERYNGVIDCLKK 68
           +SGA+AG     ++ PLDV KTR Q   L++  P    VG        + Y+G+   L  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 69  IVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE-TTQKISIXXXXX 127
           IV+ E    LY+GI   +L   P     F+  ++ +  +   FN +E  +  +S      
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMS---ALT 224

Query: 128 XXXXXXXVIVPFELIKIRM-----QDVK--SSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180
                  +  P  ++K R+     +++K  + Y   +D   K  K EGI   Y G+  ++
Sbjct: 225 AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSL 284

Query: 181 WRNALWNGGYFGVIYQVR--------------------NSMPVAKTKGQKTRNDLIAGAI 220
           +   L    +F V  +++                    NS P            LI  + 
Sbjct: 285 F-GLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASC 343

Query: 221 GG-TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKV 279
           G   + + L  P +++++R+Q    +  ++K        +   Y +EG R  Y GF+  +
Sbjct: 344 GSKMIASTLTYPHEILRTRLQLKSDMKPSIKSI------IRTTYAKEGIRGFYSGFLTNM 397

Query: 280 CRLAPGGSLMLVVFTGMMNFFR 301
            R  P  ++ LV F      F+
Sbjct: 398 FRTVPASAITLVSFEYFRKHFK 419

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 121/315 (38%), Gaps = 36/315 (11%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P   + ISG  AG       +PLD+VK R QL  T           ++  G  D +K+IV
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATN----------KKPQGYYDVVKRIV 56

Query: 71  KKEG----FSRLYRGISSPMLMEAPKRATKFA------------CNDQYQKIFKNLFNTN 114
           K       F   YRG+   +L  +      F             CN   ++    + N  
Sbjct: 57  KDSKQHSFFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDK 116

Query: 115 ETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDV----KSSYLGPMDCLKKTIKNEGIM 170
           E T  + +            +  P  +IK R+         SY   +D +KK  + EG+ 
Sbjct: 117 EMTSLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLA 176

Query: 171 GLYKGIESTMW---RNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTM 227
           G ++G+  +++   + A++   Y  + Y    +  V K K       +   ++   V   
Sbjct: 177 GFWRGLVPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVT 236

Query: 228 LNTPFDVVKSRIQSVDAVSSAV--KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPG 285
              P  ++KS +QS + VS+ +  K  +     +  IY  +G   LYKG +  + R  P 
Sbjct: 237 AVYPLQLLKSNLQSFE-VSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPS 295

Query: 286 GSLMLVVFTGMMNFF 300
             +   V+    ++ 
Sbjct: 296 TCITFCVYENFRHWL 310

>Scas_662.12
          Length = 308

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 128/301 (42%), Gaps = 23/301 (7%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P   + ISG  AG     +++PLD++K R QL  TT T           N +I+  KK+ 
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 71  KKEGFSRL----YRGISSPMLMEAPKRATKFAC-NDQYQKIFKN--LFNTNETTQKISIX 123
            +     L    YRG+   +L  A   +  F   N     +F+N  L N N T   I + 
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTT---IFLT 122

Query: 124 XXXXXXXXXXXVIVPFELIKIRMQDV----KSSYLGPMDCLKKTIKNEGIMGLYKGIEST 179
                      +  P  +IK R+       K SY       K  +  EG   ++ G+  +
Sbjct: 123 SGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPS 182

Query: 180 MWRNALWNGGYFGVIY---QVRNSMPVAKTKGQKTRNDL---IAGAIGGTVGTMLNTPFD 233
           +    +  G  + +IY   ++  ++ + K+K      +L   +  ++   +  M   PF 
Sbjct: 183 LL--GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQ 240

Query: 234 VVKSRIQSVDAVSSAVKKYNWCLPSLL-VIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292
           ++KS +Q+  +V++ + + ++   +L+  IYR+ G + LYKG    + R  P   +   +
Sbjct: 241 LLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCI 300

Query: 293 F 293
           +
Sbjct: 301 Y 301

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 27  LTVM--YPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGFSRLYRGIS 83
           L+VM  YP  ++K+  Q      T  +V   + + +   I  ++KI +  G   LY+G+S
Sbjct: 231 LSVMSVYPFQLLKSNLQ------TFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLS 284

Query: 84  SPMLMEAPKRATKFACNDQYQ 104
           + +L   P     F   + ++
Sbjct: 285 ANLLRAIPSTCITFCIYENFK 305

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 121/302 (40%), Gaps = 60/302 (19%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F    +SGA AG S   V +P+D +KTR Q +                            
Sbjct: 4   FFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAK-----------------------GGFFA 40

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQ------------YQKIFKNLFNTNETTQK 119
             G+  +YRG+ S ++  AP  +  F   D             Y +  + L +T  TT  
Sbjct: 41  NGGYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDT--TTHM 98

Query: 120 ISIXXXXXXXXXXXXVIVPFELIKIRMQ--DVKSSYLGPMDCLKKTIKNEGIMGL----Y 173
           +S             V VP E++K R Q     SS+      L+  ++N+   GL    Y
Sbjct: 99  LS---SSIGEICACLVRVPAEVVKQRTQVHSTNSSW----QTLQSILRNDNKEGLRKNLY 151

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQ-KTRNDLIAGAIGGTVGTMLNTPF 232
           +G  +T+ R   +    F +   ++ +   A  + Q +     I G+I G +     TP 
Sbjct: 152 RGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPL 211

Query: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLV-IYREEGFRALYKGFVPKVCRLAPGGSLMLV 291
           D +K+R+         + K    L S+++ IYREEG    + G  P+   ++ GG++ L 
Sbjct: 212 DFLKTRLM--------LNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLG 263

Query: 292 VF 293
           ++
Sbjct: 264 MY 265

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 17/83 (20%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
            L++GA  GT   ++  P D +K+R+Q+                     +   G++ +Y+
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKGG-----------------FFANGGYKGIYR 49

Query: 274 GFVPKVCRLAPGGSLMLVVFTGM 296
           G    V   APG SL  + +  M
Sbjct: 50  GLGSAVVASAPGASLFFISYDYM 72

>Kwal_23.3965
          Length = 307

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 125/313 (39%), Gaps = 34/313 (10%)

Query: 1   MSSDS--NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER 58
           M+ D     + +P     ++G ++GIS   V  PLD +K R QL++             +
Sbjct: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEA---------Q 51

Query: 59  YNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ 118
           Y G++   K++V++EG   L++G    M M     +T+F        I   L + ++   
Sbjct: 52  YGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPA 107

Query: 119 KISIXXXXXXXXXXXXVI-VPFELIKIRMQDVKSSYLGPMDCLKKTI-KNEGIMGLYKGI 176
           +I              +   P ++++ R     S  L  M    + I ++EG  G +KG+
Sbjct: 108 QIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGV 167

Query: 177 ESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGA--IGGTVGTMLNTPFDV 234
            S++   A+           V+        +       L + A  I G V   +  P D 
Sbjct: 168 SSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDT 227

Query: 235 VKSRIQSVD--------AVSSAVKKY------NWCLPSLLVIYREEGFRALYKGFVPKVC 280
           V+ R Q +D          + A K Y      N+   +L+++  +EG  ALY G+   + 
Sbjct: 228 VRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIV-EKEGLLALYHGYTLGIA 286

Query: 281 RLAPGGSLMLVVF 293
           +  P   + L V+
Sbjct: 287 KSVPSTVVSLGVY 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 81/168 (48%), Gaps = 10/168 (5%)

Query: 135 VIVPFELIKIRMQ---DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           V  P + +KIR+Q     ++ Y G +   K+ ++ EG+  L+KG    M    L+    F
Sbjct: 31  VTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQF 90

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKK 251
              Y + N + ++K++     +  + GA+ GT   + + P DV+++R      +++  ++
Sbjct: 91  -TSYAILNKL-LSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF-----IANHSRE 143

Query: 252 YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
            +  L +   I+R EGFR  +KG    +  +A   S +L  +  +  F
Sbjct: 144 LSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIF 191

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 119/299 (39%), Gaps = 37/299 (12%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           ++ P P  Y +  G   GI      +PLD+ K R Q   T P              ++  
Sbjct: 2   SSAPEPVKYPWWYGGFGGIVACVATHPLDLAKVRLQ---TAPAPKPT---------LVRM 49

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACND--QYQKIFKNLFNTNETTQKISIX 123
             +I++ EG   LY G+++ +L +      +F   D  + + I K   N+       S+ 
Sbjct: 50  ASQILRNEGVPGLYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMF 109

Query: 124 XXXXXXXXXXXVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGI 176
                         P +++ IRMQ       +++ +Y    D L K    EG+  L+ G 
Sbjct: 110 SGAVGGLIGN----PADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGW 165

Query: 177 ESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTR--NDLIAGAIGGTVGTMLNTPFDV 234
           +  + R  L       V Y +  +  V      K        +  + G V T + +P DV
Sbjct: 166 QPNLVRGILMTSSQV-VTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADV 224

Query: 235 VKSRIQSVDAVS--SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLV 291
           +K+R+ +    S  SAV+        LL   ++EG   +++G++P   RL P   L+ +
Sbjct: 225 IKTRVMNAHKHSHDSAVR-------ILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFL 276

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 11/91 (12%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            F S  +AG+   TV  P DV+KTR            +      ++  +  L   VK+EG
Sbjct: 204 HFASSLLAGLVATTVCSPADVIKTR-----------VMNAHKHSHDSAVRILLDAVKQEG 252

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQK 105
            S ++RG     +   P     F   +Q +K
Sbjct: 253 PSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 64.3 bits (155), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 123/300 (41%), Gaps = 57/300 (19%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F+    SGA AG S     +P+D +KTR Q +                            
Sbjct: 6   FLVSLASGAAAGTSTDLAFFPIDTLKTRLQAK-----------------------GGFFA 42

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQ---YQK--IFKNLFNTNETTQKIS-IXXX 125
             G+  +YRG+ S ++  AP  +  F   D    Y K  I K + + N+    +S +   
Sbjct: 43  NGGYKGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSS 102

Query: 126 XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMG----LYKGIESTMW 181
                    V VP E+IK R Q  K++         K ++NE   G    LY+G  +T+ 
Sbjct: 103 SIGEVSACLVRVPAEVIKQRTQTHKTN--SSWQTFTKILQNENGEGVLRNLYRGWNTTIM 160

Query: 182 RNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA---GAIGGTVGTMLNT----PFDV 234
           R   +    F  +Y+      + KT  ++   D +A   G++ G+V   +      P DV
Sbjct: 161 REIPFTCIQF-PLYEF-----LKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDV 214

Query: 235 VKSRIQ-SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           +K+R+  S  ++  A    N        IY EEGF+  + G  P+   ++ GG++ L V+
Sbjct: 215 LKTRLMLSHKSIPVAQLAKN--------IYAEEGFKVFFSGVGPRTMWISAGGAIFLGVY 266

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 17/83 (20%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273
            L +GA  GT   +   P D +K+R+Q+                     +   G++ +Y+
Sbjct: 9   SLASGAAAGTSTDLAFFPIDTLKTRLQAKGG-----------------FFANGGYKGVYR 51

Query: 274 GFVPKVCRLAPGGSLMLVVFTGM 296
           G    V   AP  SL  V +  M
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSM 74

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 116/309 (37%), Gaps = 22/309 (7%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGV 62
           S S   P+  +  F +   A    +T   P++ VKTR QL+        V      Y+G 
Sbjct: 2   SPSTDTPVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQ-----GELVAGVSRLYSGP 56

Query: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI 122
              +  I + EG   L +G++     +     ++    D  +        ++  T   + 
Sbjct: 57  AQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAA 116

Query: 123 XXXXXXXXXXXXVIV-----PFELIKIRMQDVKSSYLGPMDC-----LKKTIKNEGIMGL 172
                       +I      P +L+K RMQ +    + P+       L    K+ G+ GL
Sbjct: 117 LAVNATAGAAAGMIGAALGSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGL 176

Query: 173 YKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPF 232
           Y+G+++ + R  + +     V    + ++      G       +A A+      +   PF
Sbjct: 177 YQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYT--LASALSSVAVCIAMNPF 234

Query: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292
           DV  +R+            Y   L  L    R+EGF ALYKG + ++ R+AP   L L +
Sbjct: 235 DVAMTRMYHHRG-----GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTL 289

Query: 293 FTGMMNFFR 301
               +   R
Sbjct: 290 MEQALRVVR 298

>Scas_697.47
          Length = 328

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 120/288 (41%), Gaps = 37/288 (12%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAV------GKQVERYNGVIDCLKK 68
             ++G V G+  +   +P D++K R Q    + T  A+       + +   N +++ +K 
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVK- 97

Query: 69  IVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF-KNLFNTNETTQKISIXXXXX 127
                GF   Y+G+  P+L   P  A  F   D  +KI  ++  ++ + T          
Sbjct: 98  -----GF---YKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFI 149

Query: 128 XXXXXXXVIVPFELIKIRMQ----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                  V  P E IK+ +Q    + K+S++G     K  +K+ G+  L+KG  +T+ R+
Sbjct: 150 SAIPTTLVTAPTERIKVVLQTAGANSKTSFIG---AAKNIVKDGGVKSLFKGSLATLARD 206

Query: 184 ALWNGGYFGVIYQV-------RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVK 236
              +  YF   Y++       RN+   +KT      N  +AG I G    ++  P D +K
Sbjct: 207 GPGSALYFAS-YEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIK 265

Query: 237 SRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +++QS     S V           +  +  G +  + G  P + R  P
Sbjct: 266 TKLQSSSGSQSMVAATRE------IYVKRGGIKGFFPGLGPALLRSFP 307

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 41/92 (44%), Gaps = 12/92 (13%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G +AG+S   V++P+D +KT+ Q    + +  A  +++             VK+ G  
Sbjct: 245 LAGGIAGMSMWLVVFPIDTIKTKLQSSSGSQSMVAATREI------------YVKRGGIK 292

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFK 108
             + G+   +L   P  A  F   +    +FK
Sbjct: 293 GFFPGLGPALLRSFPANAATFLGVELTHSLFK 324

 Score = 34.3 bits (77), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 75/182 (41%), Gaps = 28/182 (15%)

Query: 138 PFELIKIRMQDVKSSYLGPMDCLKKTIKN-----------EGIMGLYKGI------ESTM 180
           PF+LIK+R Q  ++S    +  +K  +K+             + G YKG+       + +
Sbjct: 56  PFDLIKVRCQSGQASST--IHAIKIILKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPI 113

Query: 181 WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ 240
           +  + W       I    +S     T GQ       AG I     T++  P + +K  +Q
Sbjct: 114 FAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAA----AGFISAIPTTLVTAPTERIKVVLQ 169

Query: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           +  A S    K ++ + +   I ++ G ++L+KG +  + R  PG +L    +     F 
Sbjct: 170 TAGANS----KTSF-IGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFL 224

Query: 301 RD 302
            D
Sbjct: 225 ND 226

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 125/294 (42%), Gaps = 33/294 (11%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI- 63
           SN K    + + +  A AGI E+ V +P+D +  R     T   +++      + N VI 
Sbjct: 2   SNDKKQSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSS------QLNSVIF 55

Query: 64  -DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFA--------CNDQYQKIFKNLFNTN 114
            +   + + K  F+ L+ G+      +  +R  K+          N  ++  F N F   
Sbjct: 56  REHAAEPLSKRVFT-LFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFG-E 113

Query: 115 ETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYK 174
           +T + +              V++P +++KI+ Q    ++ G      K +K+EG +GLY+
Sbjct: 114 KTGKALRSATAGSMIGIGEIVLLPLDVLKIKRQTNPEAFKG--RGFVKILKDEG-LGLYR 170

Query: 175 GIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKT-RNDLIAGAIGGTVGTMLNTPFD 233
           G   T  RNA  +   FG     +  +   K   Q T   + ++  +G +   +++ P D
Sbjct: 171 GWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLD 230

Query: 234 VVKSRIQSVDAVSSAVKKYNWCLPSLLVI---YREEGFRALYKGFVPKVCRLAP 284
           V+K+RIQ+        K +        ++    + EGF A +KG  PK+    P
Sbjct: 231 VIKTRIQN--------KNFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            F+S  V   + L +  PLDV+KTR Q            K  E        +K  +K EG
Sbjct: 211 NFVSSIVGASASLIISAPLDVIKTRIQ-----------NKNFENPESGFTIVKNTLKNEG 259

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
           FS  ++G++  +L   PK    FA       +F NL
Sbjct: 260 FSAFFKGLTPKLLTTGPKLVFSFALAQTLIPVFDNL 295

>Kwal_27.11626
          Length = 299

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 123/293 (41%), Gaps = 31/293 (10%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI- 63
           SN K    I + +  A AGI E+ V +P+D V  R     T  +++A      + N VI 
Sbjct: 2   SNDKKQSGIARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSA------QLNSVIF 55

Query: 64  -DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFA--------CNDQYQKIFKNLFNTN 114
            +   + + K  F+ L+ G+      +  +R  K+          N  ++  F N F   
Sbjct: 56  REHAGEALGKRLFT-LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFG-E 113

Query: 115 ETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYK 174
           +T + +              V++P +++KI+ Q    S+ G      K +K+EG  GLY+
Sbjct: 114 KTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFKG--RGFIKILKDEG-FGLYR 170

Query: 175 GIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKT-RNDLIAGAIGGTVGTMLNTPFD 233
           G   T  RNA  +   FG     +  +   K     T   + ++  +G +   +++ P D
Sbjct: 171 GWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLD 230

Query: 234 VVKSRIQS--VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           V+K+RIQ+   D   S  +     L       + EG  A +KG  PK+    P
Sbjct: 231 VIKTRIQNRHFDNPESGFRIVQNTL-------KNEGITAFFKGLTPKLLTTGP 276

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 11/85 (12%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
            F+S  V   + L V  PLDV+KTR Q            +  +        ++  +K EG
Sbjct: 211 NFVSSIVGASASLIVSAPLDVIKTRIQ-----------NRHFDNPESGFRIVQNTLKNEG 259

Query: 75  FSRLYRGISSPMLMEAPKRATKFAC 99
            +  ++G++  +L   PK    FA 
Sbjct: 260 ITAFFKGLTPKLLTTGPKLVFSFAL 284

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 127/298 (42%), Gaps = 36/298 (12%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MS+D     L  +   +  A AGI E+ V +P+D +  R     T  T A      ++ N
Sbjct: 1   MSNDQKQSGLARV---VGSASAGILEIGVFHPVDTISKRLMSNHTKITNA------QQLN 51

Query: 61  GVI--DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFA----CNDQYQKIFKNLFNT- 113
            V+  +   K   +  F+ L+ G+      +  +R  K+      N+   K FK  F+  
Sbjct: 52  DVVFREHASKPFGQRLFT-LFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGA 110

Query: 114 --NETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMG 171
              +T + +              V++P +++KI+ Q    S+ G      + +++EG MG
Sbjct: 111 FGEKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFRG--RGFLRILRDEG-MG 167

Query: 172 LYKGIESTMWRNA-----LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGT 226
           LY+G   T  RNA     L+ G  F   Y +        T GQ    + ++   G +   
Sbjct: 168 LYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQ----NFVSSIFGASASL 223

Query: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +++ P DV+K+RIQS +   SA   +     +L    + EG  A +KG  PK+    P
Sbjct: 224 IVSAPLDVIKTRIQSRN-FESAESGFTIVKNTL----KNEGATAFFKGLTPKLLTTGP 276

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 11/95 (11%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           F+S      + L V  PLDV+KTR Q            +  E        +K  +K EG 
Sbjct: 212 FVSSIFGASASLIVSAPLDVIKTRIQ-----------SRNFESAESGFTIVKNTLKNEGA 260

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
           +  ++G++  +L   PK    FA       +F N+
Sbjct: 261 TAFFKGLTPKLLTTGPKLVFSFAIAQTLIPMFDNM 295

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 119/289 (41%), Gaps = 44/289 (15%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQV----ERYNGVIDCLKKIV 70
             +SG   G++ +  + PLD++KTR Q +    +  +V ++V    E + G    L   +
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQ-QAQASSLRSVLREVRTTRELWRGT---LPSAL 66

Query: 71  KKEGFSRLYRGI---SSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXX 127
           +    S LY  +   S   L    +  T+ +   + Q  ++NL     +   + +     
Sbjct: 67  RTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQS-YQNLLTGALSRAAVGL----- 120

Query: 128 XXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
                  V +P  +IK+R +    +Y G  +  +   ++EG  G +KG  +T  R+A + 
Sbjct: 121 -------VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYA 173

Query: 188 GGYFGVIYQVRNSMPV---AKTKGQKTRNDLIAGA----------IGGTVGTMLNTPFDV 234
           G Y  +  Q +  +P    A   G      L A A          +  ++ T L  PFD 
Sbjct: 174 GLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDT 233

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLA 283
           +K+R+Q        V+       +L  I  EE  R L+ G   ++CR A
Sbjct: 234 IKTRMQLQSHPVGFVQ-------TLRHIVCEERARTLFDGLSLRLCRKA 275

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 75/169 (44%), Gaps = 23/169 (13%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
            + P +L+K R+Q  ++S L  +    +T +      L++G   +  R ++ +  Y  ++
Sbjct: 25  ALQPLDLLKTRLQQAQASSLRSVLREVRTTRE-----LWRGTLPSALRTSIGSALYLSLL 79

Query: 195 YQVRNSMPVAKTKGQKTRN----------DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
              R+++  A+    +TR+          +L+ GA+      ++  P  V+K R +S   
Sbjct: 80  NYSRSAL--ARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKVRYEST-- 135

Query: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
               +  YN    +   I+R EG R  +KG      R AP   L ++++
Sbjct: 136 ----LYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY 180

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 17/90 (18%)

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYRE-EGFRALY 272
            L++G  GG        P D++K+R+Q   A             SL  + RE    R L+
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQQAQA------------SSLRSVLREVRTTRELW 58

Query: 273 KGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           +G +P   R + G +L L     ++N+ R 
Sbjct: 59  RGTLPSALRTSIGSALYL----SLLNYSRS 84

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 98/237 (41%), Gaps = 30/237 (12%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGF 75
           ++GA+   +  + M P+DVVKTR QLE T             YN G+I   K+I+  EG 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTV------------YNKGMISSFKQIISSEGA 65

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT---QKISIXXXXXXXXXX 132
             L  G    +L  + + + KF   + ++K+F ++   ++       I I          
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFA 125

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
              + P E  +IR+    +   G +    + +K EG    Y G    +++   +N   F 
Sbjct: 126 DIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFL 185

Query: 193 VIYQV----------RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           V  +           + S+  A T G     +L++G   G    +++ P D + S++
Sbjct: 186 VFERAAEVYFGMAGPKESLSTASTTGI----NLLSGLTAGLAAAIVSQPADTLLSKV 238

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 63/156 (40%), Gaps = 13/156 (8%)

Query: 135 VIVPFELIKIRMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
            +VP +++K R+Q   + Y  G +   K+ I +EG   L  G   T+   +L     FG 
Sbjct: 30  AMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGG 89

Query: 194 IYQVRNSMPV---AKTKGQKTRNDLIAG--AIGGTVGTMLNTPFDVVKSRIQSVDAVSSA 248
            Y+V   + +      +    +N +  G  AI      +   P +  + R+ S    +  
Sbjct: 90  -YEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFA-- 146

Query: 249 VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
               N  +     I +EEG  + Y GF P + +  P
Sbjct: 147 ----NGLVGGFSRILKEEGAGSFYNGFTPILFKQIP 178

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 216 IAGAIG-GTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN-WCLPSLLVIYREEGFRALYK 273
           +AGAIG GT  + +  P DVVK+RIQ    V      YN   + S   I   EG  AL  
Sbjct: 18  LAGAIGCGTTHSAM-VPIDVVKTRIQLEPTV------YNKGMISSFKQIISSEGAGALLT 70

Query: 274 GFVPKVCRLAPGGSL 288
           GF P +   +  GS 
Sbjct: 71  GFGPTLLGYSLQGSF 85

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 100/234 (42%), Gaps = 24/234 (10%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGF 75
           ++GA+   S  + M P+DVVKTR QLE T             YN G++   +KI+ +EG 
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTV------------YNKGMVGSFRKIIAEEGA 65

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ---KISIXXXXXXXXXX 132
             L  G    +L  + + A KF   + ++K F +    +   +    + I          
Sbjct: 66  GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLA 125

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
              + P E  +IR+    +   G +    + +K EG+   Y G    +++   +N   F 
Sbjct: 126 DIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF- 184

Query: 193 VIYQVRNSM-----PVAKTKGQK--TRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           ++++  + +     P   T  Q   T  +L++G   G    +++ P D + S++
Sbjct: 185 LVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKV 238

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 7/88 (7%)

Query: 216 IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN-WCLPSLLVIYREEGFRALYKG 274
           +AGAIG         P DVVK+RIQ    V      YN   + S   I  EEG  AL  G
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTV------YNKGMVGSFRKIIAEEGAGALLTG 71

Query: 275 FVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           F P +   +  G+     +     FF D
Sbjct: 72  FGPTLLGYSIQGAFKFGGYEVFKKFFID 99

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 63/156 (40%), Gaps = 15/156 (9%)

Query: 136 IVPFELIKIRMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
           +VP +++K R+Q   + Y  G +   +K I  EG   L  G   T+   ++     FG  
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGG- 89

Query: 195 YQVRNSMPVAKTKGQKT----RNDLIAGAIGGT--VGTMLNTPFDVVKSRIQSVDAVSSA 248
           Y+V     +  T G  T    +N +  G+      +  +   P +  + R+ S    +  
Sbjct: 90  YEVFKKFFI-DTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFA-- 146

Query: 249 VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
               N  +     I +EEG  + Y GF P + +  P
Sbjct: 147 ----NGLVGGFSRILKEEGVGSFYSGFTPILFKQIP 178

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 120/291 (41%), Gaps = 35/291 (12%)

Query: 14  YQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKE 73
           Y +  G  AGI    V +PLD+ K R Q       AA + K       +   L+ I+  E
Sbjct: 15  YPWWYGGAAGIFATMVTHPLDLAKVRLQ-------AAPMPKPT-----LFRMLESILANE 62

Query: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXX 133
           G   LY G+S+ +L +      +F     Y  + +N+    + T    +           
Sbjct: 63  GVVGLYSGLSAAVLRQCTYTTVRFGA---YDLLKENVIPREQLTNMAYLLPCSMFSGAIG 119

Query: 134 XVIVPF-ELIKIRMQD-------VKSSYLGPMDCLKKTIKNE-GIMGLYKGIESTMWRNA 184
            +   F +++ IRMQ+        + +Y   +D + K  + E G+  L+ G +  M R  
Sbjct: 120 GLAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGI 179

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRN--DLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242
           L       V Y V  +  V K     ++N   L A  + G V T + +P DV+K+RI + 
Sbjct: 180 LMTASQV-VTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNG 238

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                    +   L  L    R+EG   +++G++P   RL P    ML+ F
Sbjct: 239 SG------DHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP--FTMLIFF 281

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 114/298 (38%), Gaps = 55/298 (18%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           +GAVA     T +YPLD+ KT  Q +     +    K+ E+Y  VIDC+ KI KK GF  
Sbjct: 9   TGAVASSLAATTVYPLDLAKTLIQTQHKNADSGD-SKEEEKYKNVIDCIIKIFKKRGFLG 67

Query: 78  LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF-------NTNETTQKISIXXXXXXX- 129
           LY+G+++ +   A      F     Y  I  N F          + ++ I +        
Sbjct: 68  LYQGLATNV---AANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELAL 124

Query: 130 -----XXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                     V  P  +I  R Q  K    G    LK  IK      +Y+  ES     A
Sbjct: 125 GMSAGAMTQVVTNPISVISTRQQLTKD---GEDASLKAVIKQ-----IYE--ESNGDLTA 174

Query: 185 LWNGGYFGVI-----------YQVRNSMPVAKTKG----QKTRNDLIAGA------IGGT 223
            W G    ++           YQ   SM +   KG    QK    L AG           
Sbjct: 175 FWKGFKVALVLSTNPAITYGSYQKLKSM-ILTAKGLSGSQKISTQLSAGENFLLGMFSKM 233

Query: 224 VGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
           + T +  P  V K  +Q      S  K +   L     IY+ EGF +L+KG +P+V +
Sbjct: 234 ISTFVTQPLIVAKITLQ---GKGSKFKTFQEVLQH---IYQNEGFLSLWKGVIPQVSK 285

>Scas_716.29
          Length = 316

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 123/304 (40%), Gaps = 32/304 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ++G+V+G+   TV+ PLD +K R QL  +    A         +G++  +K ++  EG 
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--------SGLLKMMKGMILNEGG 77

Query: 76  SR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
            R  ++G     +M       +F+    Y  +F    + N   Q  S+            
Sbjct: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQ--SLVVGALAGMTSSF 135

Query: 135 VIVPFELIKIRM---QDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           V  P ++++ R    QDV  S L    C K+    EGI G ++G  ++M+   L     F
Sbjct: 136 VSYPTDVLRTRFIANQDVALSSL-SHGC-KEIWNMEGIPGFFRGCTASMFTITLSASILF 193

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDL--IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249
           G  Y+         +K     N L   A +I G    M+  P D ++ RIQ  ++V    
Sbjct: 194 GT-YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQH 252

Query: 250 KKYNWCLPSL-------------LVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGM 296
              N  +  +             L I R+EG  +LY+G    +C+  P   + L  +  +
Sbjct: 253 NVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312

Query: 297 MNFF 300
           M  +
Sbjct: 313 MRLY 316

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 78/210 (37%), Gaps = 40/210 (19%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG 61
           +SD N +    +   + GA+AG++   V YP DV++TRF           +  Q    + 
Sbjct: 113 TSDMNGQ----LQSLVVGALAGMTSSFVSYPTDVLRTRF-----------IANQDVALSS 157

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS 121
           +    K+I   EG    +RG ++ M       +  F   +  +         ++ T  + 
Sbjct: 158 LSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLR 217

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQ-----------------DVKSSYLGP--MDCLKK 162
                        V  P + I+ R+Q                 ++  SY G   +     
Sbjct: 218 YSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLN 277

Query: 163 TIKNEGIMGLYKGIESTMWRN------ALW 186
            ++ EG++ LY+G+  ++ +       +LW
Sbjct: 278 ILRQEGLLSLYQGVSMSLCKTVPSTVVSLW 307

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 21/104 (20%)

Query: 198 RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLP 257
            N+  + K +  K    L+AG++ G +   +  P D +K R+Q           Y    P
Sbjct: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQ-------LRPSYTGQAP 61

Query: 258 SLLV------IYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTG 295
           S L+      I  E G R+ +KG VP        G++M V++ G
Sbjct: 62  SGLLKMMKGMILNEGGLRSFWKGNVP--------GTMMYVLYGG 97

>Scas_714.18
          Length = 305

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 119/306 (38%), Gaps = 49/306 (16%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
           + ++G++AG     + YP D VK R Q +           +   +     C+K   + EG
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQTQ-----------EAYMFPSTWSCIKYTYENEG 63

Query: 75  -FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXX 133
                Y+GI SP++  A + A  F   +Q    F N F T  +   I +           
Sbjct: 64  ILEGFYQGIESPLIGAALENAILFLAYNQCSS-FLNAF-TEFSAFLIILISAGFAGSCAS 121

Query: 134 XVIVPFELIKIRMQDVKSSY--------------------LGP------MDCLKKTIKNE 167
            V+ P ELIK ++Q     Y                    +G       +  +K  IK +
Sbjct: 122 FVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEK 181

Query: 168 GIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTM 227
           G+ GL++G  ST  R ++ +  +F     ++ ++   K++   T   LI+GA  G     
Sbjct: 182 GLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNG 241

Query: 228 LNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGS 287
              P D VKS +Q+         ++   + ++  I   +G    Y+G    + R  P  +
Sbjct: 242 SVFPADTVKSIMQT---------EHLALMETVRSILERDGVAGFYRGLGITLLRAVPSNA 292

Query: 288 LMLVVF 293
            +   +
Sbjct: 293 AVFYTY 298

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 25/188 (13%)

Query: 138 PFELIKIRMQDVKSSYLGP--MDCLKKTIKNEGIM-GLYKGIESTMWRNALWNGGYFGVI 194
           PF+ +K+R+Q  + +Y+ P    C+K T +NEGI+ G Y+GIES +   AL N   F + 
Sbjct: 32  PFDTVKVRLQ-TQEAYMFPSTWSCIKYTYENEGILEGFYQGIESPLIGAALENAILF-LA 89

Query: 195 YQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSS------- 247
           Y   +S   A T+       LI+    G+  + + TP +++K ++Q  +   S       
Sbjct: 90  YNQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGE 149

Query: 248 -------------AVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFT 294
                           ++   +P++  I +E+G   L++G      R + G  +    + 
Sbjct: 150 QQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYE 209

Query: 295 GMMNFFRD 302
            M    RD
Sbjct: 210 LMKQTLRD 217

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 83/196 (42%), Gaps = 22/196 (11%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLE----------------VTTPTAAAVGKQ 55
           F+   IS   AG     V+ P++++K + Q+                         +G+ 
Sbjct: 106 FLIILISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEG 165

Query: 56  VERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE 115
             R+  +I  +K I+K++G   L++G SS  + E+      FA  +  ++  ++  +   
Sbjct: 166 --RHTRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVN 223

Query: 116 TTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKG 175
           TT ++ I            V  P + +K  MQ   + +L  M+ ++  ++ +G+ G Y+G
Sbjct: 224 TTWQLLISGATAGLAFNGSVF-PADTVKSIMQ---TEHLALMETVRSILERDGVAGFYRG 279

Query: 176 IESTMWRNALWNGGYF 191
           +  T+ R    N   F
Sbjct: 280 LGITLLRAVPSNAAVF 295

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 121/296 (40%), Gaps = 35/296 (11%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           ++  ++G+V+G+   +V  P+D VK R QL++ +           +Y+G++   + + ++
Sbjct: 25  LHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASE---------HKYHGILHTFRTVARE 75

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
           EG   L++G      M     + +F     Y  +     +     Q  S+          
Sbjct: 76  EGVRALWKGNVPASAMYVLYGSLQFGT---YAWLNTAAASAGLPPQAHSLAVGALAGLVS 132

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKTI-KNEGIMGLYKGIESTMWRNALWNGGYF 191
             +  P +L++ R+   +S++   +    + I   EG  G ++G    +    L  G  F
Sbjct: 133 SLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIF 192

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT---PFDVVKSRIQSVDA---- 244
           G IY+       A T G       +A A   T G +      P D V+ R+Q VDA    
Sbjct: 193 G-IYE--TCTIAADTYGLP----WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIP 245

Query: 245 -------VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                    SA++   + L   + + R EG  +LYKG    +C+  P   + L V+
Sbjct: 246 FFTRDPGAYSALRGTRF-LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300

>Scas_715.45
          Length = 305

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/290 (20%), Positives = 121/290 (41%), Gaps = 31/290 (10%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           + G VA     + + PLD++K R Q++ T             Y      + +I+KKEG  
Sbjct: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL------------YRSNTSGIIQILKKEGLG 68

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ-----KISIXXXXXXXXX 131
           +L+ G+ +  +  + + A K+   + +++++      +E T       I +         
Sbjct: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128

Query: 132 XXXVIVPFELIKIRMQDVKSSYLGP-MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
              ++ PFE IK++ Q     +    ++  KK    EG+ G YKGI     R   +    
Sbjct: 129 ADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188

Query: 191 FG----VIYQVRNSMPVAKTKG---QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243
           F     ++  +   +P  K++    Q+     + G + G +  +++ P DV+ S+I +  
Sbjct: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248

Query: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
            V+ ++        +L  IY   GF  L+ G   ++  +    S   +++
Sbjct: 249 KVNESMNV------ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIY 292

>Scas_702.10
          Length = 302

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 124/302 (41%), Gaps = 36/302 (11%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGV 62
           +DS  K + + + +  G  AGI    + +PLD+ K R Q       AA + K       +
Sbjct: 2   TDSPTKQIKYPWWY--GGAAGIFACVMTHPLDLAKVRLQ-------AAPLPKPT-----L 47

Query: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI 122
              L  I++ E    LY G+S+ +L +      +F   D  ++   NL         + +
Sbjct: 48  GRMLTTILRNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKE---NLIPQGHINDMVYL 104

Query: 123 XXXXXXXXXXXXVIVPF-ELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEG-IMGLY 173
                       ++  F +++ IRMQ       +++ +Y   +D + K   +EG I  L 
Sbjct: 105 LPCSMFSGAIGGLVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLL 164

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRN--DLIAGAIGGTVGTMLNTP 231
            G +  M R  L       V Y V  +  V K      +N   L A  + G V T + +P
Sbjct: 165 TGWKPNMVRGVLMTASQV-VTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSP 223

Query: 232 FDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLV 291
            DV+K+RI +     S        +  L    ++EG   +++G++P   RL P    ML+
Sbjct: 224 ADVIKTRIMNAHKTESES-----AIKILTSAIKKEGPSFMFRGWLPIFTRLGP--FTMLI 276

Query: 292 VF 293
            F
Sbjct: 277 FF 278

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 78/187 (41%), Gaps = 14/187 (7%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++GA+   +  + M P+DVVKTR QLE            ++  +G++   +KIV +EG +
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLE-----------PLKYSSGMVGSFRKIVGEEGAA 68

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ---KISIXXXXXXXXXXX 133
            L  G    +L  + + A KF   + ++K F +        Q    I I           
Sbjct: 69  ALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFAD 128

Query: 134 XVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
             + P E  +IR+    +   G +    + +K EGI   Y G    +++   +N   F V
Sbjct: 129 IALCPLEATRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVV 188

Query: 194 IYQVRNS 200
                N+
Sbjct: 189 FEHAANA 195

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 216 IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGF 275
           +AGAIG         P DVVK+RIQ        +K  +  + S   I  EEG  AL  GF
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQ-----LEPLKYSSGMVGSFRKIVGEEGAAALLTGF 74

Query: 276 VPKV 279
            P +
Sbjct: 75  GPTL 78

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 63/169 (37%), Gaps = 11/169 (6%)

Query: 135 VIVPFELIKIRMQDVKSSYL-GPMDCLKKTIKNEGIMGLYKGIESTMW----RNALWNGG 189
            +VP +++K R+Q     Y  G +   +K +  EG   L  G   T+     + A   GG
Sbjct: 32  AMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGG 91

Query: 190 YFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249
           Y        +++        +T   + + AI      +   P +  + R+ S    +   
Sbjct: 92  YEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFA--- 148

Query: 250 KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
              N  +     I +EEG  + Y GF P + +  P      VVF    N
Sbjct: 149 ---NGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHAAN 194

>Kwal_33.15597
          Length = 305

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 97/233 (41%), Gaps = 22/233 (9%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGF 75
           ++GA+   +  + M P+DVVKTR QLE T             YN G+I   K+I+  EG 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTV------------YNKGMISSFKQIISSEGA 65

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT---QKISIXXXXXXXXXX 132
             L  G    +L  + + + KF   + ++K+F +    ++       I I          
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFA 125

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
              + P E  +IR+    +   G +    + +K EG+   Y G    +++   +N   F 
Sbjct: 126 DIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFL 185

Query: 193 VI---YQVRNSMPVAK---TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           V     +V   M   K   +    T  +L++G   G    +++ P D + S++
Sbjct: 186 VFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKV 238

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 63/156 (40%), Gaps = 13/156 (8%)

Query: 135 VIVPFELIKIRMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
            +VP +++K R+Q   + Y  G +   K+ I +EG   L  G   T+   +L     FG 
Sbjct: 30  AMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGG 89

Query: 194 IYQVRNSM---PVAKTKGQKTRNDLIAG--AIGGTVGTMLNTPFDVVKSRIQSVDAVSSA 248
            Y+V   +    +   +    +N +  G  AI      +   P +  + R+ S    +  
Sbjct: 90  -YEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFA-- 146

Query: 249 VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
               N  +     I +EEG  + Y GF P + +  P
Sbjct: 147 ----NGLVGGFSRILKEEGLSSFYNGFTPILFKQIP 178

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 216 IAGAIG-GTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN-WCLPSLLVIYREEGFRALYK 273
           +AGAIG GT  + +  P DVVK+RIQ    V      YN   + S   I   EG  AL  
Sbjct: 18  LAGAIGCGTTHSAM-VPIDVVKTRIQLEPTV------YNKGMISSFKQIISSEGAGALLT 70

Query: 274 GFVPKVCRLAPGGSL 288
           GF P +   +  GS 
Sbjct: 71  GFGPTLLGYSLQGSF 85

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 123/314 (39%), Gaps = 42/314 (13%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P   + ISG  AG     V++PLD++K R QL  T+   A        + G    +K+I+
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKA--------HYGPFMVIKEII 59

Query: 71  KKEGFS------RLYRGISSPMLMEAPKRATKFACNDQYQK-IFKNLFNTNETTQK---- 119
           +    S       LYRG+S  +   A      F      ++ I+K++    ET  K    
Sbjct: 60  RSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGN 119

Query: 120 -------ISIXXXXXXXXXXXXVIVPFELIKIRM----QDVKSSYLGPMDCLKKTIKNEG 168
                  I +            +  P  +IK R+    +  + +Y    + +++ ++ +G
Sbjct: 120 DHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDG 179

Query: 169 IMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLI------AGAIGG 222
             GL+KG+   ++   +  G  +  +Y       + + +       L         ++G 
Sbjct: 180 FQGLWKGLVPALF--GVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGK 237

Query: 223 TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282
            V   L  PF ++KS +QS  A     + +    P + +I   +GF  LYKG    + R 
Sbjct: 238 MVSVTLVYPFQLLKSNLQSFRANEQKFRLF----PLIKLIIANDGFVGLYKGLSANLVRA 293

Query: 283 APGGSLMLVVFTGM 296
            P   +   V+  +
Sbjct: 294 IPSTCITFCVYENL 307

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 124/304 (40%), Gaps = 34/304 (11%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           MS D++      +Y    G VAG     V YP D VK R Q    T +AA        + 
Sbjct: 1   MSEDADKAYKDLLY----GGVAGSLGKLVEYPFDTVKVRLQ----TQSAAL-------FP 45

Query: 61  GVIDCLKKIVKKEGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
               C+    K+EG  R  Y+G++SP+     + A  F   ++ Q + +N ++     +K
Sbjct: 46  TTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGP-LEK 104

Query: 120 ISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS------YLGPMDCLKKTIKNEGIMGLY 173
           + +            V+ P EL+K ++Q    +      Y   +  L+  +K  G+ GL+
Sbjct: 105 V-VFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLW 163

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT-PF 232
           +G   T  R +     +F     ++  +   +   + T  +L+A   G       +  P 
Sbjct: 164 QGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPA 223

Query: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292
           D VKS +Q+         ++    P++  + ++ G    Y+G    + R  P  +++  V
Sbjct: 224 DTVKSTMQT---------EHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYV 274

Query: 293 FTGM 296
           +  +
Sbjct: 275 YESL 278

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 96/233 (41%), Gaps = 22/233 (9%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGF 75
           ++GA+   S  + M P+DVVKTR QLE T             YN G++   K+I+  EG 
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTV------------YNKGMVGSFKQIIAGEGA 69

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIF-KNLFNTNETTQKISIXXXXXXXXXXXX 134
             L  G    +L  + + A KF   + ++K F  NL     +  K S+            
Sbjct: 70  GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLA 129

Query: 135 --VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
              + P E  +IR+        G +    + +K EGI   Y G    +++   +N   F 
Sbjct: 130 DIALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFL 189

Query: 193 VIYQVRN-----SMPVAK-TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           V  +        + P  K +    T  +L++G   G    +++ P D + S++
Sbjct: 190 VFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKV 242

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 67/171 (39%), Gaps = 13/171 (7%)

Query: 136 IVPFELIKIRMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
           +VP +++K R+Q   + Y  G +   K+ I  EG   L  G   T+   ++     FG  
Sbjct: 35  MVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGG- 93

Query: 195 YQVRNSMPV---AKTKGQKTRNDLIAG--AIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249
           Y+V     +         + +N +  G  A+   +  +   P +  + R+ S    +   
Sbjct: 94  YEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFA--- 150

Query: 250 KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
              N  +     I +EEG  + Y GF P + +  P      +VF     F+
Sbjct: 151 ---NGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFY 198

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 113/288 (39%), Gaps = 33/288 (11%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           I  F++G V G+  +   +P D++K R Q      T  A+         +I   K  VK 
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAI-------TNIIKEAKTQVKG 88

Query: 73  EGFSR----LYRGISSPMLMEAPKRATKFACNDQYQKI--FKN-LFNTNETTQKISIXXX 125
             F+      Y+G+  P+L   P  A  F   D  +K+  F N    +NE T        
Sbjct: 89  TLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAG 148

Query: 126 XXXXXXXXXVIVPFELIKIRMQ-DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                    V  P E +K+ +Q   K S++      K  +K  GI  L+KG  +T+ R+ 
Sbjct: 149 FISAIPTTLVTAPTERVKVVLQTSSKGSFI---QAAKTIVKEGGIASLFKGSLATLARDG 205

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRND--------LIAGAIGGTVGTMLNTPFDVVK 236
             +  YF   Y++  +   ++   Q    D         +AG I G    +   P D +K
Sbjct: 206 PGSALYFAS-YEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIK 264

Query: 237 SRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +++Q      ++  + N    +  +  +  G +  + G  P + R  P
Sbjct: 265 TKLQ------ASSTRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFP 306

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 9/89 (10%)

Query: 202 PVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ------SVDAVSSAVKKYNWC 255
           P+     ++     +AG +GG        PFD++K R Q      +V A+++ +K+    
Sbjct: 26  PIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQ 85

Query: 256 LPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +   L     +GF   YKG +P +  + P
Sbjct: 86  VKGTLFTNSVKGF---YKGVIPPLLGVTP 111

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 46/102 (45%), Gaps = 14/102 (13%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           +P+  +   ++G +AG+S    ++P+D +KT+ Q   T            R N ++   K
Sbjct: 235 EPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASST------------RQN-MLSATK 281

Query: 68  KI-VKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFK 108
           +I +++ G    + G+   +L   P  A  F   +    +FK
Sbjct: 282 EIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLFK 323

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 73/175 (41%), Gaps = 15/175 (8%)

Query: 138 PFELIKIRMQD--VKSSYLGPMDCLKK-------TIKNEGIMGLYKG-IESTMWRNALWN 187
           PF+LIK+R Q+    S+     + +K+       T+    + G YKG I   +    ++ 
Sbjct: 55  PFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFA 114

Query: 188 GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSS 247
             ++G  Y V   +     K Q   N+L  G +    G +   P  +V +  + V  V  
Sbjct: 115 VSFWG--YDVGKKLVTFNNK-QGGSNELTMGQMA-AAGFISAIPTTLVTAPTERVKVVLQ 170

Query: 248 AVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
              K ++ + +   I +E G  +L+KG +  + R  PG +L    +    N+   
Sbjct: 171 TSSKGSF-IQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNS 224

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 59/160 (36%), Gaps = 17/160 (10%)

Query: 44  VTTPTA-AAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQ 102
           VT PT    V  Q       I   K IVK+ G + L++G  + +  + P  A  FA  + 
Sbjct: 158 VTAPTERVKVVLQTSSKGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYE- 216

Query: 103 YQKIFKNLFNTNETTQKIS----------IXXXXXXXXXXXXVIVPFELIKIRMQDVKSS 152
              I KN  N+ +  Q                           + P + IK ++Q   S+
Sbjct: 217 ---ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQ-ASST 272

Query: 153 YLGPMDCLKKT-IKNEGIMGLYKGIESTMWRNALWNGGYF 191
               +   K+  ++  GI G + G+   + R+   N   F
Sbjct: 273 RQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATF 312

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 121/302 (40%), Gaps = 46/302 (15%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           FI   +SGA AG S     +P+D +KTR Q +                            
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKTRLQAK-----------------------GGFFA 42

Query: 72  KEGFSRLYRGISSPMLMEAPKRATKFACNDQYQ----KIFKNLF--NTNETTQKIS-IXX 124
             G+  +YRG+ S ++  AP  +  F   D  +     +   L     ++T   +S +  
Sbjct: 43  NGGYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVS 102

Query: 125 XXXXXXXXXXVIVPFELIKIRMQDVKS-SYLGPMDCLKKTIKNEGIM-GLYKGIESTMWR 182
                     V VP E+IK R Q  ++ S L  +  L +    EG+   LY+G  +T+ R
Sbjct: 103 SSFGEISACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMR 162

Query: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTML----NTPFDVVKSR 238
              +    F +   ++     A+ +G K R     G++ G +   +     TP DV+K+R
Sbjct: 163 EIPFTCIQFPLYEYMKKRW--AEVQG-KERAAPWQGSVCGCIAGGIAAAATTPLDVLKTR 219

Query: 239 IQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
           I       SA+            + +EEG +  + G  P+   ++ GG++ L V+  + +
Sbjct: 220 IMLHHKSVSALHLAK-------TMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVHS 272

Query: 299 FF 300
            F
Sbjct: 273 LF 274

>Scas_673.17
          Length = 314

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 24/235 (10%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGF 75
           ++GA+   +  + + P+DVVKTR QLE T             YN G++   KKI+  EG 
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTV------------YNKGMVGSFKKIIADEGA 72

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF---NTNETTQKISIXXXXXXXXXX 132
             L  G    +L  + + A KF   + ++K+  +     N       + +          
Sbjct: 73  GALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLA 132

Query: 133 XXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
              + P E  +IR+    +   G +    + +K EG+   Y G    +++   +N   F 
Sbjct: 133 DIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF- 191

Query: 193 VIYQVRNSMPVAKTKGQKTRND-------LIAGAIGGTVGTMLNTPFDVVKSRIQ 240
           ++++  + +       ++T +D       L++G   G     ++ P D + S++ 
Sbjct: 192 LVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVN 246

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 64/156 (41%), Gaps = 15/156 (9%)

Query: 136 IVPFELIKIRMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMW----RNALWNGGY 190
           +VP +++K R+Q   + Y  G +   KK I +EG   L  G   T+     + A   GGY
Sbjct: 38  LVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 191 FGVIYQVRNSMPVAKTKGQKTRNDLIAG--AIGGTVGTMLNTPFDVVKSRIQSVDAVSSA 248
              +++  +   +        +N +  G  A+   +  +   P +  + R+ S    +  
Sbjct: 98  --EVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPTFA-- 153

Query: 249 VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
               N  +     I +EEG  + Y GF P + +  P
Sbjct: 154 ----NGLVGGFSRILKEEGVGSFYSGFTPILFKQIP 185

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 34/66 (51%), Gaps = 9/66 (13%)

Query: 216 IAGAIG-GTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN-WCLPSLLVIYREEGFRALYK 273
           +AGAIG GT  + L  P DVVK+RIQ    V      YN   + S   I  +EG  AL  
Sbjct: 25  LAGAIGCGTTHSSL-VPVDVVKTRIQLEPTV------YNKGMVGSFKKIIADEGAGALLT 77

Query: 274 GFVPKV 279
           GF P +
Sbjct: 78  GFGPTL 83

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 121/291 (41%), Gaps = 37/291 (12%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAA--AVGKQVERYNGVIDCLKKIVKKE 73
            ++GAV+G+   ++  P+D +K R QL   TP       G Q      V++  + ++K E
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQ------VMEVARSMIKNE 70

Query: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXX 133
           G    ++G     L+     + +F+    + + +   F         S+           
Sbjct: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLH--SLVVGAFAGITSS 127

Query: 134 XVIVPFELIKIRMQDVKSSYLGPMDCLKKT---IKNEGIMGLYKGIESTMWRNALWNGGY 190
            V  PF++++ R+  V ++ +  M   ++     K EG+ G +KG  ++M    L     
Sbjct: 128 IVSYPFDVLRTRL--VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIM 185

Query: 191 FGVIYQVR------NSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD- 243
           FG    +R           A  K +    +  AG IGG +  ++  P + ++ R+Q ++ 
Sbjct: 186 FGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNS 245

Query: 244 ----------AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
                     +V  + K Y +    L ++ ++EG  +LY+G +  + +  P
Sbjct: 246 KHLEKFSRHSSVYGSYKGYGFARIGLQIL-KQEGVSSLYRGILVALSKTIP 295

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 73/163 (44%), Gaps = 16/163 (9%)

Query: 135 VIVPFELIKIRMQDVKSSYLGP-----MDCLKKTIKNEGIMGLYKG-IESTMWRNALWNG 188
           +  P + IKIR+Q   ++ L P     M+  +  IKNEGI   +KG I  ++      + 
Sbjct: 33  ITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSA 92

Query: 189 GYFGVIYQVRNSMPVAKTKGQKTR-NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSS 247
            +       R   P     G + R + L+ GA  G   ++++ PFDV+++R+ + + + S
Sbjct: 93  QFSSYSLFNRYLTPF----GLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS 148

Query: 248 AVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
                      +  I++ EG    +KG +  +  +    S+M 
Sbjct: 149 MS-----ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 64/185 (34%), Gaps = 32/185 (17%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           ++  + GA AGI+   V YP DV++TR            V         +   ++ I K 
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRL-----------VANNQMHSMSITREVRDIWKL 161

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXX 132
           EG    ++G  + M       +  F   +  +        T    +K  +          
Sbjct: 162 EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTI 221

Query: 133 XXVIV-----PFELIKIRMQDVKSSYL----------------GPMDCLKKTIKNEGIMG 171
             VI      P E I+ RMQ + S +L                G      + +K EG+  
Sbjct: 222 GGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281

Query: 172 LYKGI 176
           LY+GI
Sbjct: 282 LYRGI 286

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 13/90 (14%)

Query: 207 KGQKTR--NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKY-NWCLPSLLVIY 263
           KGQ       L+AGA+ G +   +  P D +K R+Q   A  + +K + +  +     + 
Sbjct: 10  KGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA--NGLKPFGSQVMEVARSMI 67

Query: 264 REEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           + EG R+ +KG +P        GSL+ V +
Sbjct: 68  KNEGIRSFWKGNIP--------GSLLYVTY 89

>Scas_705.9
          Length = 323

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 115/297 (38%), Gaps = 50/297 (16%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEV---TTPTAAAVGKQVERYNGVIDCLKKIVKKE 73
           I+GA+A      ++YPLDV KT  Q E     T   +   K++ R   VI CL +I +K 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 74  GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF---KNLFNT-----NETTQKISIXXX 125
           G   LY+G+S+ +  +  +    F      ++ +   K L NT     N  +    +   
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 126 XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGI--ESTMWRN 183
                    V  P E+I  + Q                  N     + K I  ES    +
Sbjct: 128 VGAAALTQVVNNPIEVILTKQQTTDDK------------DNVDFYSVLKQIYVESNGKLS 175

Query: 184 ALWNGGYFGVIYQVRNSMPVAKTK------------------GQKTRN-DLIAGAIGGTV 224
           + W G    +I  V  S+  A  +                  GQ T N + I GA+   +
Sbjct: 176 SYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKII 235

Query: 225 GTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
            T++  P  V K  +Q  ++      K+      L  +Y+EEG  AL+KG  P++ +
Sbjct: 236 STIITQPLIVAKVSLQRSNS------KFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 26/55 (47%)

Query: 138 PFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
           P  + K+ +Q   S +    + L+   K EG++ L+KG+   + +  L  G  F 
Sbjct: 242 PLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVFA 296

>Kwal_23.4731
          Length = 314

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 83/180 (46%), Gaps = 19/180 (10%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P +Y   S A++G+    +  P+ V+KTR    ++T + A+     ERY    D ++K+ 
Sbjct: 127 PSLY-LASAALSGLGTAILTNPIWVIKTRI---MSTSSQAS-----ERYKTTWDGIRKVY 177

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACND--QYQKIFKNLFNTNETTQKI-SIXXXXX 127
             EGFS  +RG+  P L    + A  F   D  ++Q   +     +E    + +I     
Sbjct: 178 AHEGFSGFWRGL-VPSLFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSV 236

Query: 128 XXXXXXXVIVPFELIKIRMQ-----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                   + PF+L+K  +Q     + + SY    + +K   + EG+ GLYKG+ + + R
Sbjct: 237 SKMLSVTAVYPFQLLKSNLQSFAAVEKRDSYR-FWNLVKSIHQKEGLQGLYKGLSANLLR 295

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 121/314 (38%), Gaps = 35/314 (11%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P   + I+G  AG       +PLD+VK R QL V T  +         Y  VI  + +  
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHG-------YKEVIKTIIRDS 64

Query: 71  KKEG--FSRLYRGISSPMLMEAPKRATKFA----CNDQYQK--IFKNLFNTNETTQK--- 119
           K +   F   YRG+   ++  +      F       D   +  + +    T  + QK   
Sbjct: 65  KADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKA 124

Query: 120 ----ISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS----YLGPMDCLKKTIKNEGIMG 171
               + +            +  P  +IK R+    S     Y    D ++K   +EG  G
Sbjct: 125 MGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSG 184

Query: 172 LYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAK---TKGQKTRN--DLIAGAIGGTVGT 226
            ++G+  +++  A   G  +  IY        A+   T+ +K  N  ++   ++   +  
Sbjct: 185 FWRGLVPSLFGVA--QGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSV 242

Query: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGG 286
               PF ++KS +QS  AV        W L  +  I+++EG + LYKG    + R  P  
Sbjct: 243 TAVYPFQLLKSNLQSFAAVEKRDSYRFWNL--VKSIHQKEGLQGLYKGLSANLLRAIPST 300

Query: 287 SLMLVVFTGMMNFF 300
            +   ++  + ++ 
Sbjct: 301 CITFCIYENLRHWL 314

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 212 RNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEG--FR 269
           + ++IAG   GT+ T+   P D+VK R+Q +   + +   Y   + +++   + +   FR
Sbjct: 14  QREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHS-HGYKEVIKTIIRDSKADSNVFR 72

Query: 270 ALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
             Y+G    +     G S+   ++ G+  F +D
Sbjct: 73  EAYRGLGVNLI----GNSIAWGLYFGLYRFTKD 101

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 79/189 (41%), Gaps = 18/189 (9%)

Query: 17  ISGAVA-GISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74
           ++GA+  GI+  + M P+DVVKTR QLE T             YN G++   K+I+  EG
Sbjct: 18  LAGAIGCGITH-SSMVPIDVVKTRIQLEPTV------------YNKGMVSSFKQIISSEG 64

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI-FKNLFNTNETTQK--ISIXXXXXXXXX 131
              L  G    +L  + + + KF   + ++K+   N+   N    K  I I         
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFF 124

Query: 132 XXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
               + P E  +IR+    +   G      + +K EG+   Y G    +++   +N   F
Sbjct: 125 ADIALCPLEATRIRLVSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKF 184

Query: 192 GVIYQVRNS 200
            V     N+
Sbjct: 185 FVFEHAANA 193

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 61/155 (39%), Gaps = 13/155 (8%)

Query: 136 IVPFELIKIRMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
           +VP +++K R+Q   + Y  G +   K+ I +EG   L  G   T+   +L     FG  
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGG- 89

Query: 195 YQVRNSMPV---AKTKGQKTRNDLIAG--AIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249
           Y++   + +           +N +  G  AI      +   P +  + R+ S    +   
Sbjct: 90  YELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFA--- 146

Query: 250 KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
              N        I +EEG  + Y GF P + +  P
Sbjct: 147 ---NGLFGGFSRILKEEGVGSFYNGFTPILFKQIP 178

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 216 IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN-WCLPSLLVIYREEGFRALYKG 274
           +AGAIG  +      P DVVK+RIQ    V      YN   + S   I   EG  AL  G
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEPTV------YNKGMVSSFKQIISSEGAGALLTG 71

Query: 275 FVPKVCRLAPGGSL 288
           F P +   +  GS 
Sbjct: 72  FGPTLLGYSLQGSF 85

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 118/287 (41%), Gaps = 30/287 (10%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTA--AAVGKQV--ERYNGVIDCLKKIVKK 72
           ++GAVA       +YPLD+ KT  Q +V+  ++  +  GK +   RY  V+DC+  I K+
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 73  EGFSRLYRGISSPMLMEAPKRATKF----ACNDQYQKI----FKNLFN-----TNETTQK 119
           +G   LY+G++   +    +    F         Y K      ++L N     T  T ++
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 120 ISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEG---IMGLYKGI 176
           + +               P  ++  R Q V S+       + K I  E    I   +KG+
Sbjct: 128 LVL--GVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKGL 185

Query: 177 ES--TMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDV 234
            +   +  N       F  + +V                + I G +   + T++  P  V
Sbjct: 186 RTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIV 245

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
            K+ +Q      SA  K+     +LL +Y+ EG ++L+KG +P++ +
Sbjct: 246 AKAMLQ------SAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 211 TRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV----------KKYNWCLPSLL 260
           T    + GA+   +  +   P D+ K+ IQS  + SS+           ++Y   +  ++
Sbjct: 3   TLESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMI 62

Query: 261 VIYREEGFRALYKG 274
            I++E+G   LY+G
Sbjct: 63  NIFKEKGILGLYQG 76

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/282 (20%), Positives = 112/282 (39%), Gaps = 27/282 (9%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
             I G V G++   V+ P D++KTR Q    T     + +        I   K++ +   
Sbjct: 10  HLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKE--------IRSPKQLWRGAL 61

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXX 134
            S L   I S + +             + Q +        + T   ++            
Sbjct: 62  PSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGF 121

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
           + +P  +IK+R +    SY    +  +     EGI G + G  +T+ R+A + G Y  + 
Sbjct: 122 ITMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLY 181

Query: 195 YQVRNSMPVAK-------------TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQS 241
            + +  +P+               T    T  + I+  +  ++ T + +PFD +K+R+Q 
Sbjct: 182 EKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQ- 240

Query: 242 VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLA 283
           +D       K++    +L++I  +E F+ L+ G   ++ R A
Sbjct: 241 LDPT-----KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKA 277

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 71/170 (41%), Gaps = 23/170 (13%)

Query: 135 VIVPFELIKIRMQDVKSSYL-GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
           V+ PF+L+K R+Q  K + L G +  ++   +      L++G   +  R ++ +  Y   
Sbjct: 24  VLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQ------LWRGALPSSLRTSIGSALYLST 77

Query: 194 IYQVRNSMPVAKTKG---------QKTR-NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243
           +   R +M   KT+          Q T   +L +GA    V   +  P  ++K R +S  
Sbjct: 78  LNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKVRYEST- 136

Query: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                +  Y     +   IY  EG R  + G    V R AP   L ++++
Sbjct: 137 -----MYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLY 181

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 15/92 (16%)

Query: 210 KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFR 269
           KT + LI G +GG    ++  PFD++K+R+Q         +  +  L   L   R    +
Sbjct: 6   KTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQ---------QNKDTTLWGTLKEIRSP--K 54

Query: 270 ALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
            L++G +P   R + G +L L      +N FR
Sbjct: 55  QLWRGALPSSLRTSIGSALYL----STLNVFR 82

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/290 (19%), Positives = 120/290 (41%), Gaps = 38/290 (13%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           + G +A     + + PLD+VK R Q+              + Y   +   +KI+  EG+ 
Sbjct: 23  LGGIIACGPTHSSITPLDLVKCRLQVNP------------KLYTSNLQGFRKIIANEGWK 70

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVI 136
           ++Y G  +  +  + + A K+   + ++ ++ +  +   T   + +            ++
Sbjct: 71  KVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT---VYLMASATAEFLADIML 127

Query: 137 VPFELIKIRMQDVKSSYLGP-MDCLKKTIKNEGIM-GLYKGIESTMWRNALWNGGYFG-- 192
            PFE IK++ Q     +    +D  KK     G M   YKGI     R   +    F   
Sbjct: 128 CPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187

Query: 193 --VIYQVRNSMPVAKTKG---QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV----D 243
             ++ ++ + +P  K +    Q+     + G + G +   ++ P DV+ S+I S     +
Sbjct: 188 EKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANE 247

Query: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           ++S A K+          IY++ GF  L+ G + ++  +    S   +++
Sbjct: 248 SMSVASKR----------IYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIY 287

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/311 (20%), Positives = 121/311 (38%), Gaps = 29/311 (9%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY- 59
           M + SN+   P   + ISG  AG     V +PLD++K R QL       ++   QV+R  
Sbjct: 1   MDATSNSVLSPLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRII 60

Query: 60  ---NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF-NTNE 115
              +G    LK+  +  G + +   ++  +     + +     +   +   +N F N  +
Sbjct: 61  KDGSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRK 120

Query: 116 TTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS--YLGPMDCLKKTIKNEGIMGLY 173
            T  + +            +  P  +IK R+   KSS  Y   ++ + +    EG+   +
Sbjct: 121 MTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFW 180

Query: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG--TVGT----- 226
           +G+  +++   +  G  +  IY         K K    RND+    +    T+G      
Sbjct: 181 RGLVPSLF--GVTQGALYFAIYD------TLKLKYLHDRNDIQERRLNAVETIGIISLSK 232

Query: 227 MLNT----PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282
           M++     P  ++K+ +Q+     +   K N  + S   I+   G    YKG    + R 
Sbjct: 233 MISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRS---IWHTNGIAGFYKGLFANLVRA 289

Query: 283 APGGSLMLVVF 293
            P   +   V+
Sbjct: 290 IPSTCITFGVY 300

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 87/190 (45%), Gaps = 30/190 (15%)

Query: 135 VIVPFELIKIRMQ----DVK-SSYLGPMDCLKKTIKN-EGIMGL----YKGIESTMWRNA 184
           V  P +LIK+R+Q    D+K SSY    + +++ IK+  G   L    Y+G+   +  NA
Sbjct: 29  VTHPLDLIKLRLQLAAIDLKPSSY---YNQVQRIIKDGSGTQQLLKEAYRGLGINIIGNA 85

Query: 185 LWNGGYFG-------VIYQVRNSMPVAKTKGQKTRN-----DLIAGAIGGTVGTMLNTPF 232
           +  G YFG       V+Y + +S P  + K    R       L++    G    +L  P 
Sbjct: 86  VAWGLYFGLYRCSKDVVYSL-SSEPALQNKFMNDRKMTSSMYLVSAGASGLATALLTNPM 144

Query: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292
            V+K+RI S    + + + Y   L ++  IY EEG +  ++G VP +  +  G     + 
Sbjct: 145 WVIKTRIMS----TKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLFGVTQGALYFAIY 200

Query: 293 FTGMMNFFRD 302
            T  + +  D
Sbjct: 201 DTLKLKYLHD 210

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 115/295 (38%), Gaps = 49/295 (16%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           NAK L       +GAV G+  +   +P D++K R               Q  + +G +D 
Sbjct: 47  NAKSLA------AGAVGGVCAVLTGHPFDLLKVRC--------------QSNQASGTVDA 86

Query: 66  LKKIV----KKEGFSRL------YRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE 115
           ++KI+     + G S +      Y+G+  P+L   P  A  F   D  +K+     N+ +
Sbjct: 87  VRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGK 146

Query: 116 TTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKG 175
            T                 V+ P E +K+ +Q   +  LG     K  +   G+  L++G
Sbjct: 147 LTTAQLATAGFISAIPTTLVMAPTERVKVVLQTQSNHSLG--SAAKHILATGGVRSLFRG 204

Query: 176 IESTMWRNALWNGGYFGVIYQVRNSMPVAK--TKGQKTRNDLIAGAIGGTVGTMLNTPFD 233
             +T+ R+   +  YF   Y+   +   A+  T     +N  +AG + G    +   P D
Sbjct: 205 SLATLARDGPGSALYFAS-YEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPID 263

Query: 234 VVKSRIQSVDA----VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
            +K+ +QS +     + +  K YN             G +  + G  P + R  P
Sbjct: 264 TIKTELQSSNTRQTMMEATRKIYN----------TRGGIKGFFPGIGPALLRSFP 308

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 38/92 (41%), Gaps = 12/92 (13%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G +AG+S    ++P+D +KT  Q   T  T     +++  YN           + G  
Sbjct: 246 LAGGMAGVSMWVGVFPIDTIKTELQSSNTRQTMMEATRKI--YN----------TRGGIK 293

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFK 108
             + GI   +L   P  A  F   +    +FK
Sbjct: 294 GFFPGIGPALLRSFPANAATFLGVELTHSLFK 325

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 73/171 (42%), Gaps = 29/171 (16%)

Query: 138 PFELIKIRMQDVKSSYLGPMDCLKKTI----KNEGIM------GLYKG-IESTMWRNALW 186
           PF+L+K+R Q  ++S  G +D ++K +       G+       G YKG I   +    ++
Sbjct: 67  PFDLLKVRCQSNQAS--GTVDAVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIF 124

Query: 187 NGGYFGVIYQVRNSMPV-AKTKGQKTRNDL-IAGAIGGTVGTMLNTPFDVVKS--RIQSV 242
              ++G  Y V   +       G+ T   L  AG I     T++  P + VK   + QS 
Sbjct: 125 AVSFWG--YDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVMAPTERVKVVLQTQSN 182

Query: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
            ++ SA K           I    G R+L++G +  + R  PG +L    +
Sbjct: 183 HSLGSAAKH----------ILATGGVRSLFRGSLATLARDGPGSALYFASY 223

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/301 (20%), Positives = 116/301 (38%), Gaps = 33/301 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ++G+++G+   T + PLD VK + Q+   TP           +N   + L  I+K+EG 
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQV---TP-----------HNKNANVLINILKREGI 64

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
              ++G     +M       +F          +   + N + Q  S              
Sbjct: 65  RGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLA 124

Query: 136 IVPFELIKIRMQ-DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
             PF++++ R   + +   +   D +     +EG+MG + G  S+M    L     FGV 
Sbjct: 125 SYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGV- 183

Query: 195 YQVRNSMPVAKTKGQKTRN-----DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249
           Y+        ++K    R+     + +AG I G    +   P D V+ RIQ  ++ +   
Sbjct: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243

Query: 250 KKYNWC------------LPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297
               +             L   + + ++EG  +LY+G    + +  P  ++ L  +   M
Sbjct: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFM 303

Query: 298 N 298
           N
Sbjct: 304 N 304

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 16/85 (18%)

Query: 211 TRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRA 270
           T N L+AG++ G        P D VK ++Q        V  +N     L+ I + EG R 
Sbjct: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQ--------VTPHNKNANVLINILKREGIRG 66

Query: 271 LYKGFVPKVCRLAPGGSLMLVVFTG 295
            +KG VP        GS+M +++ G
Sbjct: 67  FWKGNVP--------GSIMYIIYGG 83

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 72/170 (42%), Gaps = 18/170 (10%)

Query: 136 IVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIY 195
           I P + +KI++Q   + +    + L   +K EGI G +KG         ++ G  FG   
Sbjct: 33  IAPLDTVKIKLQ--VTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYT 90

Query: 196 QVRNSMPVAKTKGQKTRN------DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV 249
            + + +     +G    N        + G++ G   ++ + PFDV+++R  + ++    +
Sbjct: 91  YIGSFL-----RGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRF-AANSQGQLI 144

Query: 250 KKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
           K  +     ++ I+  EG    + G    +  +    ++M  V+  +  F
Sbjct: 145 KLRD----EIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIF 190

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 11/77 (14%)

Query: 11  PFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIV 70
           P +Y  + G++AG++     YP DV++TRF        A + G+ ++    + D +  I 
Sbjct: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF-------AANSQGQLIK----LRDEIMAIW 154

Query: 71  KKEGFSRLYRGISSPML 87
             EG    + G  S M+
Sbjct: 155 SHEGLMGFFSGCGSSMI 171

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/303 (19%), Positives = 114/303 (37%), Gaps = 44/303 (14%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G +AG    T++ PLD +K  FQ   + P  A     +    G++   K I+  +G  
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQ--TSNPQFAQFAGSM---GGLVRASKYIMAHDGPR 78

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVI 136
             ++G S+ +L   P  A KF   +Q + +    +      ++  +            V 
Sbjct: 79  GFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRR--LLSGSLAGLCSVFVT 136

Query: 137 VPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQ 196
            P +L+++R+  V   +   +  +   I NE      +      W  A W+  Y G    
Sbjct: 137 YPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQW-FAHWSNFYRGYTPT 195

Query: 197 VRNSMPVA----------------------------------KTKGQKTRNDLIAGAIGG 222
           V   +P A                                  +T   KT   L+AG + G
Sbjct: 196 VIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAG 255

Query: 223 TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL-VIYREEGFRALYKGFVPKVCR 281
                   PF++++ R+Q V A++   +++   +  +  +IY E G+R  + G      +
Sbjct: 256 MASQTAAYPFEIIRRRLQ-VSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIK 314

Query: 282 LAP 284
           + P
Sbjct: 315 VTP 317

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 12/103 (11%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQV-----ERYNGVIDCLKKI 69
           + +SG++AG+  + V YPLD+V+ R    VT    A V K +     ER +   + L+K 
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAY-VTERHDAKVRKIMACIYNERPS---EALRKW 176

Query: 70  VKKEGF---SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109
              + F   S  YRG +  ++   P     F  +D  Q IF++
Sbjct: 177 YIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRH 219

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 9   PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLE-VTTPTAAAVGKQVERYNGVIDCLK 67
           PL    Q ++G +AG++  T  YP ++++ R Q+  +T PT          + G+ +  K
Sbjct: 241 PLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTR-------RHFVGINEIAK 293

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
            I  + G+   + G+S   +   P  A  F
Sbjct: 294 IIYTEGGWRGFFVGLSIGYIKVTPMVACSF 323

>Kwal_55.21338
          Length = 323

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 108/260 (41%), Gaps = 18/260 (6%)

Query: 26  ELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSP 85
            +T+ YPL VV T+ Q      T  A G+++     + D +K I +K+G    + G+ S 
Sbjct: 36  SMTLTYPLIVVTTKLQ------TQDAKGEKLS----LADTIKDIYRKDGAMGFFAGLESA 85

Query: 86  MLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIR 145
           +          + C +   +      +T   T   S+               P  +   R
Sbjct: 86  LFGTTLSNFVYYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTR 145

Query: 146 MQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR--NALWNGGYFGVIYQVRNSMPV 203
           M  V+ S  G +  +   +K+EGI GL+KG+   +    N +     + V  Q++N +  
Sbjct: 146 MT-VQKSDRGTLSTIFDIVKDEGISGLFKGLNPALILVINPIIQ---YTVYEQLKNWILS 201

Query: 204 AK-TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLV- 261
           ++ T+        I GA+G    T    P+  +K+R+  +    S+       L SL+  
Sbjct: 202 SRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAE 261

Query: 262 IYREEGFRALYKGFVPKVCR 281
           I +++G   LY+G   K+ +
Sbjct: 262 IIKKDGILGLYRGIGIKLVQ 281

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 67/165 (40%), Gaps = 21/165 (12%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           G++AG    T   PL V  TR  ++ +               G +  +  IVK EG S L
Sbjct: 125 GSIAGSLNATAANPLWVANTRMTVQKSD-------------RGTLSTIFDIVKDEGISGL 171

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVP 138
           ++G++ P L+       ++   +Q +    +   T   +   +                P
Sbjct: 172 FKGLN-PALILVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYP 230

Query: 139 FELIKIRMQ---DVKSSYLGP----MDCLKKTIKNEGIMGLYKGI 176
           +  +K RM    + KSS   P    +  + + IK +GI+GLY+GI
Sbjct: 231 YVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGI 275

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 9/82 (10%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQL--EVTTPTAAAVGKQVERYN 60
           S    + L   + FI GAV  ++     YP   +K R  L  E  + TAA          
Sbjct: 201 SSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPP-------R 253

Query: 61  GVIDCLKKIVKKEGFSRLYRGI 82
            ++  + +I+KK+G   LYRGI
Sbjct: 254 SLLSLMAEIIKKDGILGLYRGI 275

>Kwal_27.11419
          Length = 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 79/172 (45%), Gaps = 24/172 (13%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
           ++ PF+L+K R+Q  KSS L  +D + ++I+  G   L+KG   +  R ++ +  +   +
Sbjct: 24  ILQPFDLLKTRLQQNKSSNL--LDVV-RSIETPG--QLWKGTLPSALRTSVGSALFLSTL 78

Query: 195 YQVRNSMPVAKTKGQKTRN-------------DLIAGAIGGTVGTMLNTPFDVVKSRIQS 241
             VR+++   + KG   +N             +LI+GAI      +   P  V+K R +S
Sbjct: 79  NIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPITVLKVRFES 138

Query: 242 VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
                  +  Y     +   IYR EG R L+ G    V R AP   L ++ +
Sbjct: 139 T------MYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFY 184

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 116/294 (39%), Gaps = 48/294 (16%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER----YNGVI-DCLKKI 69
            FI G V G++   ++ P D++KTR Q   ++     V + +E     + G +   L+  
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVV-RSIETPGQLWKGTLPSALRTS 68

Query: 70  VKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQK------IFKNLFNTNETTQKISIX 123
           V    F      + S +   A KR    A  +          +++NL +   T   + + 
Sbjct: 69  VGSALFLSTLNIVRSAI---ADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGV- 124

Query: 124 XXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183
                        +P  ++K+R +    +Y    +      ++EGI GL+ G  +T+ R+
Sbjct: 125 -----------ATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRD 173

Query: 184 ALWNGGYFGVIYQVRNSMP--------------VAKTKGQKTRNDLIAGAIGGTVGTMLN 229
           A + G Y     Q +  +P              V  TK     N  IA     ++ T + 
Sbjct: 174 APYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINS-IAAFSSASLATTIT 232

Query: 230 TPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLA 283
           +PFD +K+R+Q   +      +Y   + +   I R E  R L+ G   ++ R A
Sbjct: 233 SPFDTIKTRMQLNPS------QYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 74/191 (38%), Gaps = 26/191 (13%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            ISGA+   +      P+ V+K RF+              +  Y  + +    I + EG 
Sbjct: 112 LISGAITRAAVGVATMPITVLKVRFE------------STMYNYKSLGEAATHIYRSEGI 159

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQ----KIF---------KNLFNTNETTQKISI 122
             L+ G  + ++ +AP         +Q +    +I            +F+T +T+  I+ 
Sbjct: 160 RGLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFST-KTSTIINS 218

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                       +  PF+ IK RMQ   S Y G +   K  I+ E    L+ G+   + R
Sbjct: 219 IAAFSSASLATTITSPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSR 278

Query: 183 NALWNGGYFGV 193
            AL  G  +G+
Sbjct: 279 KALSAGIAWGI 289

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 11/81 (13%)

Query: 210 KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFR 269
           + R+  I G +GG    ++  PFD++K+R+Q            N     L V+   E   
Sbjct: 6   RGRSHFIGGFVGGLTSAVILQPFDLLKTRLQQ-----------NKSSNLLDVVRSIETPG 54

Query: 270 ALYKGFVPKVCRLAPGGSLML 290
            L+KG +P   R + G +L L
Sbjct: 55  QLWKGTLPSALRTSVGSALFL 75

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/303 (19%), Positives = 118/303 (38%), Gaps = 30/303 (9%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLE---VTTPTAAAVGKQVERYNGVIDCLKKIVK 71
             I G   G+S    + PLD++KTRFQ         T  ++    + + G    L   ++
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDTPWQLWRG---TLPSAIR 63

Query: 72  KEGFSRLYRGISSPMLME-APKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXX 130
               S LY  +SS  LM  A  +  +F   D    +     N  + +   ++        
Sbjct: 64  TSVGSALY--LSSLNLMRTALAKRKQFDTADSV--VTGKSSNLPQLSMYENLVTGAFARG 119

Query: 131 XXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
               + +P  +IK+R +    +Y    +  K     EGI G ++G   T  R+A ++G Y
Sbjct: 120 TVGYITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLY 179

Query: 191 FGVIYQVRNSMPVAKTKG-------------QKTRNDLIAGAIGGTVGTMLNTPFDVVKS 237
             +  ++++++P    K                T  +  +  +  ++ T +  PFD +K+
Sbjct: 180 VLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKT 239

Query: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMM 297
           R+Q          K+     +L  I  +E    ++ G   ++ R A    +   ++  ++
Sbjct: 240 RMQLEPT------KFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELI 293

Query: 298 NFF 300
             F
Sbjct: 294 KHF 296

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 72/202 (35%), Gaps = 24/202 (11%)

Query: 4   DSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVI 63
            SN   L      ++GA A  +   +  P+ ++K R++              +  Y  + 
Sbjct: 99  SSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYE------------STLYNYKSIA 146

Query: 64  DCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF-----KNLFN------ 112
           +  K I  +EG    +RG     L +AP         ++ +        K+L        
Sbjct: 147 EAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGR 206

Query: 113 -TNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMG 171
            T  T+  I+             V  PF+ IK RMQ   + +      L   +  E  + 
Sbjct: 207 YTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIK 266

Query: 172 LYKGIESTMWRNALWNGGYFGV 193
           ++ G+   + R AL  G  +G+
Sbjct: 267 IFSGLSMRLTRKALSAGIAWGI 288

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKN-EGIMGLYKGIESTMWRNALWNGGYFGV 193
           ++ PF+L+K R+Q  K+S       L KT+K+ E    L++G   +  R ++ +  Y  +
Sbjct: 24  ILQPFDLLKTRLQQDKTS------TLWKTLKSIETPSQLWRGALPSCIRTSVGSAMYLTM 77

Query: 194 IYQVRNSMPVAKTKGQKTRN---------DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244
           +  +R ++   K  G    +         ++ +GA+   +  ++  P  V+K R +S   
Sbjct: 78  LNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYEST-- 135

Query: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGM 296
               + +Y     +   I+R EG R  ++GF     R AP   L ++ +  M
Sbjct: 136 ----LYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRM 183

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/289 (19%), Positives = 112/289 (38%), Gaps = 42/289 (14%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTP---TAAAVGKQVERYNGVI-DCLKKIV 70
             I G   G+    ++ P D++KTR Q + T+    T  ++    + + G +  C++  V
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSIETPSQLWRGALPSCIRTSV 69

Query: 71  KKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQ---KIFKNLFNTNETTQKISIXXXXX 127
                S +Y  + + +     K     +    Y     +++N+F+   T     +     
Sbjct: 70  G----SAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGL----- 120

Query: 128 XXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWN 187
                  + +P  +IK+R +     Y           + EG+ G ++G  +T  R+A + 
Sbjct: 121 -------ITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYA 173

Query: 188 GGYFGVIYQVRNSMP------VAKTKGQKTRNDLIAGAIGGT-------VGTMLNTPFDV 234
           G Y     +++  +P      V K       +   +  I G+       + T +  PFD 
Sbjct: 174 GLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDT 233

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLA 283
           VK+R+Q   A      K++    +   I  +E  R L+ G   ++ R A
Sbjct: 234 VKTRMQLEPA------KFHSFTSTFWHIATKESVRNLFAGISLRLTRKA 276

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 15/97 (15%)

Query: 206 TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYRE 265
           ++ ++    LI G  GG V  ++  PFD++K+R+Q  D  S+  K     L S+      
Sbjct: 2   SEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQ-DKTSTLWK----TLKSI------ 50

Query: 266 EGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302
           E    L++G +P   R + G ++ L     M+N  R 
Sbjct: 51  ETPSQLWRGALPSCIRTSVGSAMYLT----MLNSIRQ 83

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 122/303 (40%), Gaps = 31/303 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAV------GKQVERYNGVIDCLKKI 69
            ++G V G+  +   +P D++K R Q      T  AV       + +   NG +     +
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTT--SL 82

Query: 70  VKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKI--FKNLFNTNETTQKISIXXXXX 127
             K      Y+G+  P++   P  A  F   D  +++  +K   +   TT +++      
Sbjct: 83  FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMA-TAGFI 141

Query: 128 XXXXXXXVIVPFELIKIRMQ---DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                  V  P E IK+ +Q   + K S++      K  +   G+  L+ G  +T+ R+ 
Sbjct: 142 SAIPTTLVTAPTERIKVVLQTNSEFKGSFI---KAAKHIVSTGGVKSLFNGSLATLARDG 198

Query: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSR 238
             +  YF   Y++  +  + K+  +K ++++      +AG I G    ++  P D +K+R
Sbjct: 199 PGSALYFAS-YELSKAF-LNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTR 256

Query: 239 IQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
           +Q      S V+       +  +  +  G +  + G  P + R  P  +   +       
Sbjct: 257 LQVATTPISMVQA------TKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVELTHA 310

Query: 299 FFR 301
           FF+
Sbjct: 311 FFK 313

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 37/187 (19%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74
           FI+G VAG    TV+ P + VK   Q++ +T            YN G+I+ + ++ K+EG
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSSTSA----------YNHGIINAVGQVYKEEG 64

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXX---- 130
            + L+RG     +   P  A +F     Y+   K++F+ + T  K  +            
Sbjct: 65  VAGLFRGNGLNCVRIFPYSAVQFVV---YEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121

Query: 131 --XXXXVIVPFELIKIRMQDVKSSYL---------------GPMDCLKKTIKNE-GIMGL 172
                    P +L++ R+  ++++ L               G  + L KT K E GI GL
Sbjct: 122 GGMSVLATYPLDLVRTRL-SIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGL 180

Query: 173 YKGIEST 179
           Y+GI  T
Sbjct: 181 YRGIYPT 187

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 81/160 (50%), Gaps = 18/160 (11%)

Query: 135 VIVPFELIKI--RMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191
           V+ PFE +KI  ++Q   S+Y  G ++ + +  K EG+ GL++G      R   ++   F
Sbjct: 28  VVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQF 87

Query: 192 GVIYQV--RNSMPVAKTKGQK---TRNDLIAGAIGGTVGTMLNTPFDVVKSR--IQSVD- 243
            V+Y+   ++   V  T G++       L AGA+ G +  +   P D+V++R  IQ+ + 
Sbjct: 88  -VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANL 146

Query: 244 AVSSAVKKYNWCLP----SLLV-IYREE-GFRALYKGFVP 277
           A  S  K  +   P     LLV  ++EE G R LY+G  P
Sbjct: 147 AKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYP 186

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 201 MPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNW-CLPSL 259
           M + +   Q++    IAG + G V   + +PF+ VK  +Q    V S+   YN   + ++
Sbjct: 1   MDLKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQ----VQSSTSAYNHGIINAV 56

Query: 260 LVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
             +Y+EEG   L++G      R+ P  ++  VV+
Sbjct: 57  GQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274
            + GA+ G V      P D VK+R+Q++DA      +Y   +     + REEG RAL++G
Sbjct: 215 FLVGALSGIVTVYATMPVDTVKTRMQALDAA-----RYGSTVGCFRAVVREEGVRALWRG 269

Query: 275 FVPKVCRLAPGGSLMLVVFTGMM 297
             P++ RL   G ++   +  ++
Sbjct: 270 ATPRLGRLVLSGGIVFTAYEKLL 292

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 12/80 (15%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           +PL     F+ GA++GI  +    P+D VKTR Q                RY   + C +
Sbjct: 207 QPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ-----------ALDAARYGSTVGCFR 255

Query: 68  KIVKKEGFSRLYRGISSPML 87
            +V++EG   L+RG ++P L
Sbjct: 256 AVVREEGVRALWRG-ATPRL 274

>Kwal_55.21106
          Length = 328

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 126/318 (39%), Gaps = 52/318 (16%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTP---TAAAVGKQVE-------RYNGVIDCL 66
           I+GAVA      V+YPLD+VKT  Q +   P   + A V  Q +       RY   +D L
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 67  KKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL---------FNTNETT 117
            KI K +G   LY+G+ + ++    +  + F      +K F            F+T E  
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPE-- 125

Query: 118 QKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNE--GIMGLYKG 175
               +               P  +I  R Q   S   G    +   I +E   I G ++G
Sbjct: 126 ---ELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRG 182

Query: 176 IESTMWRNALWNGGYFGVIYQ------------VRNSMPVAKTKGQKT-RNDLIAGAIGG 222
            + ++      N       Y+            V  +  + +T GQ + R + + G    
Sbjct: 183 FKVSLILTV--NPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSK 240

Query: 223 TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR- 281
            + T++  P  V K+ +Q   +   + ++       LL +Y++EG  +L+KG  P++ + 
Sbjct: 241 VISTLITQPLIVSKAYLQRTGSNFQSFQQV------LLYLYKQEGLISLWKGLAPQLSKG 294

Query: 282 -LAPGGSLMLVVFTGMMN 298
            L  G   +L +F G + 
Sbjct: 295 ILVQG---LLFMFKGELT 309

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 112/283 (39%), Gaps = 31/283 (10%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGK--QVERYNGVIDCLKKIVKKEGF 75
           +G V G+  +   +P D+VK R Q         AV    Q  R       L  +    GF
Sbjct: 34  AGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLNAV---RGF 90

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN---------ETTQKISIXXXX 126
              Y+G+  P+L   P  A  F   D  +K+  ++ ++          E T         
Sbjct: 91  ---YKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 127 XXXXXXXXVIVPFELIKIRMQDV--KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                   V  P E +K+ +Q    K+S+L   D  K+ ++ +G   L+KG  +T+ R+ 
Sbjct: 148 ISAIPTTLVTAPTERVKVVLQTTQGKASFL---DAAKQIVRTQGFQSLFKGSLATLSRDG 204

Query: 185 LWNGGYFGVIYQVRNSMPVA--KTKGQ-KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQS 241
             +  YF      +  +  A   T G+    N  I+G + G    ++  P D VK+++Q 
Sbjct: 205 PGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQ- 263

Query: 242 VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
                S+ K+ +    + ++     G +  + G  P + R  P
Sbjct: 264 -----SSSKRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFP 301

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 14/91 (15%)

Query: 203 VAKTKGQKTRN--DLIAGAIGGTVGTMLNTPFDVVKSRIQS------VDAVSSAVKKYNW 254
           V++TK Q T N   L AG +GG    +   PFD+VK R QS      +DAVS  ++    
Sbjct: 18  VSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQ 77

Query: 255 CL-PSLLVIYREEGFRALYKGFVPKVCRLAP 284
              P+ L        R  YKG VP +  + P
Sbjct: 78  AAGPTSL-----NAVRGFYKGVVPPLLGVTP 103

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 14/137 (10%)

Query: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN--TNETTQKI 120
           +D  K+IV+ +GF  L++G  + +  + P  A  FA  +    I K   N  +  T+ ++
Sbjct: 177 LDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYE----ICKEYLNKASGHTSGEL 232

Query: 121 SIX----XXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNE--GIMGLYK 174
           SI                V+ P + +K ++Q   SS    M  + + I N   GI G + 
Sbjct: 233 SITNVCISGGMAGVSMWVVVFPIDTVKTQLQS--SSKRQSMLEVTRMIYNTRGGIKGFFP 290

Query: 175 GIESTMWRNALWNGGYF 191
           G+   + R+   N   F
Sbjct: 291 GVGPAILRSFPANAATF 307

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 12/94 (12%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ISG +AG+S   V++P+D VKT+ Q      +   V + +  YN           + G  
Sbjct: 239 ISGGMAGVSMWVVVFPIDTVKTQLQSSSKRQSMLEVTRMI--YN----------TRGGIK 286

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110
             + G+   +L   P  A  F   +    +FK  
Sbjct: 287 GFFPGVGPAILRSFPANAATFLGVELTHSLFKKF 320

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 75/174 (43%), Gaps = 35/174 (20%)

Query: 138 PFELIKIRMQDVKSSYLGPMDCLKKTIKN----------EGIMGLYKGIE------STMW 181
           PF+L+K+R Q  ++     MD +   ++             + G YKG+       + ++
Sbjct: 48  PFDLVKVRCQSNQAR--SAMDAVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIF 105

Query: 182 RNALWNGGYFGVIYQVRNSMPVAK------TKGQKTRNDLIA-GAIGGTVGTMLNTPFDV 234
             + W    + V  ++  S+P +        + + T + + A G I     T++  P + 
Sbjct: 106 AVSFWG---YDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTER 162

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288
           VK  +Q+    +S        L +   I R +GF++L+KG +  + R  PG +L
Sbjct: 163 VKVVLQTTQGKAS-------FLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSAL 209

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 70/149 (46%), Gaps = 14/149 (9%)

Query: 138 PFELIKIRMQ----DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
           P   I  ++Q    D  +     ++ +K+  + +G++G Y G+ES ++  AL N  Y+  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYY-Y 91

Query: 194 IYQV--RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKK 251
            Y++  RN + V K K   T   ++ G + G+V  + + P  V  +R+       +  K 
Sbjct: 92  FYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRM-------TVTKS 144

Query: 252 YNWCLPSLLVIYREEGFRALYKGFVPKVC 280
               L +++ I +++  + L+ G  P + 
Sbjct: 145 EKTALATIIEIVKKDSAKTLFNGLKPALV 173

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 14  YQFISGAVAGISELTVMYPLDVVKTRFQL-EVTTPTAAAVGKQVERYNG----VIDCLKK 68
           + F+ GA+  ++     YP   +KTR  L E    T    GK+ + +      ++  + +
Sbjct: 205 WAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITE 264

Query: 69  IVKKEGFSRLYRGI 82
           IVKK+G S LYRG+
Sbjct: 265 IVKKDGVSGLYRGV 278

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 127/311 (40%), Gaps = 33/311 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVK----TRFQLEVT------TPTAAAVGKQVERYNG-VID 64
           FI+G  +G+   T   P D +K     R  L  T      T  A      + +    +I 
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKI---FKNLFNTNETTQKIS 121
               + ++ G    Y G    ++   P+ A KF   +  ++I    +N+ +T+E ++  +
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQDV-------KSSYLGPMDCLKKTIKNEGIMGLYK 174
                         + P + +K R+Q         KSS L  +   K+  +  GI   Y+
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSIL--LQTAKEMYQQGGIRLFYR 380

Query: 175 GIE---STMWRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRNDLIA---GAIGGTVG 225
           G+      ++  A  + G F  +   Y  + +      + +   ++LI    GA  GTVG
Sbjct: 381 GVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVG 440

Query: 226 TMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPG 285
             L  P +++++R+Q+     +    YN     L    + EG++ L+KG VP + ++ P 
Sbjct: 441 ATLVYPINLLRTRLQA-QGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPA 499

Query: 286 GSLMLVVFTGM 296
            S+  + +  +
Sbjct: 500 VSISYLCYENL 510

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           GA +G    T++YP+++++TR Q       A         YNG  D LKK +++EG+  L
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQ-------AQGTYAHPHTYNGFSDVLKKTIQREGYQGL 485

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFK 108
           ++G+   +    P  +  + C +  +++ K
Sbjct: 486 FKGLVPNLAKVCPAVSISYLCYENLKRLMK 515

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/319 (19%), Positives = 129/319 (40%), Gaps = 43/319 (13%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY----NGVID------- 64
           FI+G ++G+   T   P D +K  F +  T  ++  +  + +      N  I+       
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKV-FLIARTDLSSILLNSKTDLLAKNPNADINKISSPLA 289

Query: 65  -CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL---FNTNETTQKI 120
             +K + ++ G    Y G    ++   P+ + KF   +  +KI   L    +T + ++  
Sbjct: 290 KAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFS 349

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDC-----------LKKTIKNEGI 169
           +              + P + +K R+Q        P+D             K   +  G+
Sbjct: 350 TYIAGGLAGMAAQFSVYPIDTLKFRVQ------CAPLDTKLKGNNLLFQTAKDMFREGGL 403

Query: 170 MGLYKGIESTM---WRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRNDLIA---GAI 220
              Y+G+   +   +  A  + G F  +   Y  + +  +   + Q T ++L+    GA 
Sbjct: 404 RLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAF 463

Query: 221 GGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVC 280
            GTVG  +  P +++++R+Q+    +     YN     LL     EG++ L+KG VP + 
Sbjct: 464 SGTVGASVVYPINLLRTRLQAQGTYAHPYV-YNGFKDVLLKTLEREGYQGLFKGLVPTLA 522

Query: 281 RLAPGGSLMLVVFTGMMNF 299
           ++ P  S+  + +  +  F
Sbjct: 523 KVCPAVSISYLCYENLKKF 541

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 81/191 (42%), Gaps = 22/191 (11%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           + K L     +I+G +AG++    +YP+D +K R Q        A +  +++  N +   
Sbjct: 341 DTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQ-------CAPLDTKLKGNNLLFQT 393

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQK--IFKNLFNTNETTQKISIX 123
            K + ++ G    YRG++  ++   P  A         +K  I K     N    ++++ 
Sbjct: 394 AKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLS 453

Query: 124 XX------XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPM------DCLKKTIKNEGIMG 171
                            V+ P  L++ R+Q  + +Y  P       D L KT++ EG  G
Sbjct: 454 NLVVLPMGAFSGTVGASVVYPINLLRTRLQ-AQGTYAHPYVYNGFKDVLLKTLEREGYQG 512

Query: 172 LYKGIESTMWR 182
           L+KG+  T+ +
Sbjct: 513 LFKGLVPTLAK 523

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 7/104 (6%)

Query: 203 VAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCL 256
           + K +G +   DL      IAG + G        P D +K R+Q    + + +K  N   
Sbjct: 333 MTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCA-PLDTKLKGNNLLF 391

Query: 257 PSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            +   ++RE G R  Y+G    +  + P  +L L  F+ +  ++
Sbjct: 392 QTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWY 435

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 157 MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQV--RNSMPVAKTKGQKTRND 214
           ++ +++  + EG++G Y G+ES M+  A  +  Y+   Y++  R +M V  ++   T   
Sbjct: 61  LEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY-YFYELAARATMRVRGSRRLNTSEA 119

Query: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274
           +++ A+ G++  + + P  VV +R+       +  K     L  LL I R++G  AL+ G
Sbjct: 120 ILSSAVAGSMTAIASNPIWVVNTRM-------TVAKSEQSTLAVLLDIVRKDGVTALFNG 172

Query: 275 FVPKV 279
             P +
Sbjct: 173 LRPAL 177

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 63/170 (37%), Gaps = 27/170 (15%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
            +S AVAG        P+ VV TR  +  +  +  AV             L  IV+K+G 
Sbjct: 120 ILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTLAV-------------LLDIVRKDGV 166

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXV 135
           + L+ G+  P LM       ++   +Q + +      ++      +              
Sbjct: 167 TALFNGLR-PALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAFLLGAVGKLAATGS 225

Query: 136 IVPFELIKIRMQ--------DVKSSYLGPM-DCLKKTIKNEGIMGLYKGI 176
             P+  +K RM         D + S    M D +KK    EGI GLY GI
Sbjct: 226 TYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKK----EGIQGLYHGI 271

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 44/230 (19%), Positives = 86/230 (37%), Gaps = 14/230 (6%)

Query: 58  RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT 117
           R    ++ +++I +KEG    Y G+ S M   A      +   +   +    +  +    
Sbjct: 56  RSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGSRRLN 115

Query: 118 QKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIE 177
              +I               P  ++  RM   KS     +  L   ++ +G+  L+ G+ 
Sbjct: 116 TSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQ-STLAVLLDIVRKDGVTALFNGLR 174

Query: 178 STMW--RNALWNGGYFGVIYQVRNSMPVAKTKGQKT---RNDLIAGAIGGTVGTMLNTPF 232
             +    N +     + V  Q++N   V K  G          + GA+G    T    P+
Sbjct: 175 PALMLVSNPIIQ---YTVFEQLKN--VVLKWSGSDVLLPSWAFLLGAVGKLAATGSTYPY 229

Query: 233 DVVKSRIQSVDAVSSA-VKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
             +K+R+        A  ++  W L  ++ I ++EG + LY G   K+ +
Sbjct: 230 ITLKTRMHLAKGKEDADTQQSMWSL--MVDIVKKEGIQGLYHGIGVKLTQ 277

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           GA +G    TV+YP+++++TR Q + T            RY+G  D  +K V++EG   L
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTY-------AHPHRYDGFQDVFRKTVQREGLPGL 461

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFK 108
           Y+G+   +    P  A  + C +  ++  +
Sbjct: 462 YKGLVPTLAKVCPAVAISYLCYENLKRAMR 491

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 73/179 (40%), Gaps = 22/179 (12%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           +++G + GI     +YP+D +K R Q        A +  +      +I   K + ++ G 
Sbjct: 299 YVAGGLGGIMAQFSVYPIDTLKFRIQ-------CAPLDTRCRGLPLLIKTAKDMYREGGL 351

Query: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIF----KNLFNTNET----TQKISIXXXXX 127
              YRG+   +L   P  A         ++ +     N    +E     +  + +     
Sbjct: 352 RLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAF 411

Query: 128 XXXXXXXVIVPFELIKIRMQDVKSSYLGP------MDCLKKTIKNEGIMGLYKGIESTM 180
                  V+ P  L++ R+Q  + +Y  P       D  +KT++ EG+ GLYKG+  T+
Sbjct: 412 SGTVGATVVYPINLLRTRLQ-AQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/257 (18%), Positives = 104/257 (40%), Gaps = 18/257 (7%)

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS 121
           ++     + ++ G    Y G    ++   P+ A KF   +  +++   L    ET +   
Sbjct: 236 LVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSR 295

Query: 122 IXXXXXXXXXXXXV---IVPFELIKIRMQ----DVKSSYLGPMDCLKKTIKNEGIMGL-Y 173
           +                + P + +K R+Q    D +   L  +    K +  EG + L Y
Sbjct: 296 LSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFY 355

Query: 174 KGIESTM---WRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRNDLIA---GAIGGTV 224
           +G+   +   +  A  + G F  +   Y  R +  +  ++ +   ++L+    GA  GTV
Sbjct: 356 RGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTV 415

Query: 225 GTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           G  +  P +++++R+Q+     +   +Y+          + EG   LYKG VP + ++ P
Sbjct: 416 GATVVYPINLLRTRLQA-QGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCP 474

Query: 285 GGSLMLVVFTGMMNFFR 301
             ++  + +  +    R
Sbjct: 475 AVAISYLCYENLKRAMR 491

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 80/190 (42%), Gaps = 20/190 (10%)

Query: 6   NAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDC 65
           + K L  +  FI+G +AG+     +YP+D +K R Q        A +  +++    +I  
Sbjct: 314 DTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQ-------CAPLNAELKGRKLMIQT 366

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF----KNLFNTNETTQKIS 121
            K++  + G    YRG++  +L   P  A         +K +        N  E   ++S
Sbjct: 367 AKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELS 426

Query: 122 ----IXXXXXXXXXXXXVIVPFELIKIRMQDVKS-----SYLGPMDCLKKTIKNEGIMGL 172
               +            V+ P  L++ R+Q   +      Y G  D L KTI+ EG  GL
Sbjct: 427 NLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGL 486

Query: 173 YKGIESTMWR 182
           +KG+  T+ +
Sbjct: 487 FKGLVPTLAK 496

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           GA +G    TV+YP+++++TR Q       A        RY+G  D L K +++EG+  L
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQ-------AQGTFAHPYRYDGFRDVLLKTIQREGYPGL 486

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFK 108
           ++G+   +    P  +  + C +  +K+ K
Sbjct: 487 FKGLVPTLAKVCPAVSISYLCYENLKKLMK 516

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/311 (19%), Positives = 127/311 (40%), Gaps = 33/311 (10%)

Query: 16  FISGAVAGISELTVMYPLD------VVKTRFQLEVTTPTAAAVGKQVER-----YNGVID 64
           FI+G ++G+   T   P D      + +T     +   T   + K          + ++ 
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF---KNLFNTNETTQKIS 121
            +  + ++ G    Y G     L   P+ + KF   +  +K+    +N  +T + ++  +
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 122 IXXXXXXXXXXXXVIVPFELIKIRMQ------DVKSSYLGPMDCLKKTIKNEGIMGL-YK 174
                         + P + +K RMQ      ++K   L  M    K +  EG + L Y+
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKL--MIQTAKEMYTEGGLKLFYR 381

Query: 175 GIEST---MWRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRNDLIA---GAIGGTVG 225
           G+      ++  A  + G F ++   Y    +  + K +     ++L+    GA  GT G
Sbjct: 382 GVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFG 441

Query: 226 TMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPG 285
             +  P +++++R+Q+    +   + Y+     LL   + EG+  L+KG VP + ++ P 
Sbjct: 442 ATVVYPINLLRTRLQAQGTFAHPYR-YDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPA 500

Query: 286 GSLMLVVFTGM 296
            S+  + +  +
Sbjct: 501 VSISYLCYENL 511

>Kwal_23.3042
          Length = 542

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 122/310 (39%), Gaps = 31/310 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQV---ERYNGVIDCLKK---- 68
           FI+G V+G+   T   P D +K          +     K +   +  N  +  +K     
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 69  ----IVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT--QKISI 122
               + ++ G    Y G     +   P+ A KF   +  +++   L    +T    + S 
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 123 XXXXXXXXXXXXVIV-PFELIKIRMQ------DVKSSYLGPMDCLKKTIKNEGIMGLYKG 175
                       + V P + +K R+Q      + K   L  +   K   K  G+   Y+G
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL-LISTAKDMYKEGGLRIFYRG 406

Query: 176 IE---STMWRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRND---LIAGAIGGTVGT 226
           I      ++  A  + G F  +   Y  R +      + Q T ++   L+ GA  GTVG 
Sbjct: 407 ITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGA 466

Query: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGG 286
               P +++++R+Q+    +    +YN     LL   + EG++ L+KG VP + ++ P  
Sbjct: 467 TAVYPVNLLRTRLQAQGTFAHP-HRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAV 525

Query: 287 SLMLVVFTGM 296
           S+  + +  +
Sbjct: 526 SISYLCYENL 535

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           ++  + GA +G    T +YP+++++TR Q       A        RYNG  D L K V++
Sbjct: 452 MFVLLMGAFSGTVGATAVYPVNLLRTRLQ-------AQGTFAHPHRYNGFRDVLLKTVQR 504

Query: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFK 108
           EG+  L++G+   +    P  +  + C +  ++  K
Sbjct: 505 EGYQGLFKGLVPNLAKVCPAVSISYLCYENLKRGMK 540

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 1/98 (1%)

Query: 203 VAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVI 262
           V  T G    +  +AG +GG +  +   P D +K R+Q    +++  K     + +   +
Sbjct: 336 VQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCA-PLNTESKGRQLLISTAKDM 394

Query: 263 YREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
           Y+E G R  Y+G    +  + P  ++ L  F+ +  ++
Sbjct: 395 YKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWY 432

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 79/180 (43%), Gaps = 19/180 (10%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           + LP     ++   +GI+   +  P+ V+KTR    + T  A         Y    D + 
Sbjct: 109 RRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRI---MATSRAGP-------YKSTFDGVY 158

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN-TNETTQKISIXXXX 126
           K+ + EG    +RG+  P L+   + A  FA  D  +  F  L + T++  +++S+    
Sbjct: 159 KLYQTEGVLAFWRGVV-PSLLGVSQGAIYFALYDTLK--FHYLHSSTDKAERRLSVSEII 215

Query: 127 XXXXXXXXVIV----PFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182
                   + V    PF+L+K ++QD  +   G    ++     EGI G Y+G+ + + R
Sbjct: 216 GITCISKMISVTSVYPFQLLKSKLQDFGAPS-GITQLVQTVYSREGIRGFYRGLSANLLR 274

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 98/251 (39%), Gaps = 28/251 (11%)

Query: 59  YNGVIDCLKKIVKKEGFSR-LYRGISSPMLMEAPKRATKFACNDQYQKI-FKNLFNTNET 116
           Y G+I   + I +++ + R LYRG+   +L  +   A  F C    + I  ++L N + T
Sbjct: 48  YTGLI---RDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESAT 104

Query: 117 T-------QKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSS--YLGPMDCLKKTIKNE 167
                       +            +  P  +IK R+     +  Y    D + K  + E
Sbjct: 105 GIMDRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTE 164

Query: 168 GIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGT-VGT 226
           G++  ++G+  ++    +  G  +  +Y       +  +  +  R   ++  IG T +  
Sbjct: 165 GVLAFWRGVVPSLL--GVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISK 222

Query: 227 MLNT----PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282
           M++     PF ++KS++Q   A S   +           +Y  EG R  Y+G    + R 
Sbjct: 223 MISVTSVYPFQLLKSKLQDFGAPSGITQLVQ-------TVYSREGIRGFYRGLSANLLRA 275

Query: 283 APGGSLMLVVF 293
            P   +   V+
Sbjct: 276 VPATCITFFVY 286

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query: 26  ELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSP 85
            +T +YP  ++K++ Q +   P+            G+   ++ +  +EG    YRG+S+ 
Sbjct: 225 SVTSVYPFQLLKSKLQ-DFGAPS------------GITQLVQTVYSREGIRGFYRGLSAN 271

Query: 86  MLMEAPKRATKF 97
           +L   P     F
Sbjct: 272 LLRAVPATCITF 283

>Kwal_26.7972
          Length = 358

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/309 (19%), Positives = 112/309 (36%), Gaps = 50/309 (16%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G +AG    T++ PLD +K  FQ   + P      K      G+I     I   +G  
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQ--TSNPHYL---KYSGSTMGLIRAGAHINAHDGIR 86

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE-TTQKISIXXXXXXXXXXXXV 135
             Y+G S+ ++   P  A KF     Y++I   +  + E  T    +            +
Sbjct: 87  GFYQGHSATLIRIFPYAAIKFIA---YEQIRHFMIPSKEYETHARRLASGSMAGLCSVFM 143

Query: 136 IVPFELIKIRMQDVKS-SYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVI 194
             P +LI++R+  V   S +  +  +K+         L        W  A W   Y G  
Sbjct: 144 TYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRW-FAHWCNFYRGFT 202

Query: 195 YQVRNSMPVA----------------------------------KTKGQKTR-----NDL 215
             V   +P A                                  ++K Q +R      +L
Sbjct: 203 PTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAEL 262

Query: 216 IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGF 275
           +AG + G      + PF++++ R+Q      +++  +      + +IY+E G+R  + G 
Sbjct: 263 VAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGL 322

Query: 276 VPKVCRLAP 284
                ++ P
Sbjct: 323 SIGYIKVTP 331

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 49/96 (51%), Gaps = 6/96 (6%)

Query: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNG 61
           S   +++PL    + ++G +AG++  T  YP ++++ R Q+ V +PT+      +  +  
Sbjct: 248 SKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTS------IHNFQT 301

Query: 62  VIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
           + D ++ I K+ G+   + G+S   +   P  A  F
Sbjct: 302 IPDMIRIIYKERGWRGFFVGLSIGYIKVTPMVACSF 337

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 12/138 (8%)

Query: 165 KNEGIMGLYKGIESTMWR---NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIG 221
           +  G+ G  +G   T++R   N++     +  I Q      ++  K         AGA+ 
Sbjct: 204 RTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQ-----SLSPHKALDEYQAFAAGALS 258

Query: 222 GTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281
                 L  P DV+K+R+QS     +A   Y   L     I+ EEGFR ++KG+VP++ +
Sbjct: 259 SAAVVALTQPIDVIKTRMQS----KTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFK 314

Query: 282 LAPGGSLMLVVFTGMMNF 299
           ++  G +   V+  + N 
Sbjct: 315 VSLSGGISFGVYQYVENL 332

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           + S S  K L     F +GA++  + + +  P+DV+KTR Q +    T          Y 
Sbjct: 237 VQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFT----------YK 286

Query: 61  GVIDCLKKIVKKEGFSRLYRG 81
             ++C  +I  +EGF  +++G
Sbjct: 287 SSLNCAYRIFVEEGFRYMWKG 307

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 138 PFELIKIRMQDVKS--SYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIY 195
           P ++IK RMQ   +  +Y   ++C  +    EG   ++KG    +++ +L  G  FGV  
Sbjct: 268 PIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

Query: 196 QVRN 199
            V N
Sbjct: 328 YVEN 331

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 17 ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAA 51
          I+GA A + + T+ +P + +KT  QL    P AAA
Sbjct: 25 IAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAA 59

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           GA +G    TV+YP+++++TR Q       A         Y G  D L K V++EG+  L
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQ-------AQGTYAHPHTYTGFRDVLWKTVQREGYQGL 481

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQKIFK 108
           ++G+   +    P  +  + C + ++++ K
Sbjct: 482 FKGLVPNLAKVCPAVSISYLCYENFKRLMK 511

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/313 (19%), Positives = 126/313 (40%), Gaps = 43/313 (13%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQ----VERYNGVIDCLKK--- 68
           FI+G  +G+   T   P D +K  F +  T  ++  +  +    ++  N  I  +K    
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKV-FLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLI 257

Query: 69  -----IVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL---FNTNETTQKI 120
                + ++ G    Y G    ++   P+ A KF   +  +++  +L    +T+E ++  
Sbjct: 258 KAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFS 317

Query: 121 SIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCL-----------KKTIKNEGI 169
           +              + P + +K R+Q        P+D             ++  ++ G+
Sbjct: 318 TYIAGGMGGVVAQFSVYPIDTLKYRVQ------CAPLDTALKGNELLISTARQMYRDGGL 371

Query: 170 MGLYKGIE---STMWRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRNDLIA---GAI 220
              Y+G+      ++  A  + G F  +   Y  R +        Q T ++ I    GA 
Sbjct: 372 KLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAF 431

Query: 221 GGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVC 280
            GTVG  +  P +++++R+Q+     +    Y      L    + EG++ L+KG VP + 
Sbjct: 432 SGTVGATVVYPINLLRTRLQA-QGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLA 490

Query: 281 RLAPGGSLMLVVF 293
           ++ P  S+  + +
Sbjct: 491 KVCPAVSISYLCY 503

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 216 IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGF 275
           IAG +GG V      P D +K R+Q    + +A+K     + +   +YR+ G +  Y+G 
Sbjct: 320 IAGGMGGVVAQFSVYPIDTLKYRVQCA-PLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 276 VPKVCRLAPGGSLMLVVFTGMMNFF 300
              V  + P  +L L  F+ +  ++
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWY 403

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 63/153 (41%), Gaps = 9/153 (5%)

Query: 136 IVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM----WRNALWNGGYF 191
           + P +L+K R+Q     Y   +D  K  +++EG+  ++ G+ +T      + A   GGY 
Sbjct: 33  VTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92

Query: 192 GVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKK 251
                  N +        +T   L A A    +  +L  P++ +K + Q+   +    K 
Sbjct: 93  YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT--IPPFCKN 150

Query: 252 YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +   L     I   EG   LYKG  P  CR  P
Sbjct: 151 F---LEGWSKITAAEGLSGLYKGITPLWCRQIP 180

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 64/159 (40%), Gaps = 26/159 (16%)

Query: 100 NDQYQKIFKNLFNTNETTQKISIXXXXXXXXX------------XXXVIVPFELIKIRMQ 147
           ND Y+ I KN      TTQK S                         +I P + IKI  Q
Sbjct: 9   NDSYKHINKN------TTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQ 62

Query: 148 DVKSSY-------LGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNS 200
                Y       +G ++  K    N+G+ G ++G  +T+ R   +    F    Q+RN+
Sbjct: 63  TSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNT 122

Query: 201 MPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
           +  +K      R  L++G++ G     +  P D+V+ R+
Sbjct: 123 LIPSKEFESHWRR-LVSGSLAGLCSVFITYPLDLVRVRL 160

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/326 (19%), Positives = 118/326 (36%), Gaps = 58/326 (17%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G ++G    T++ PLD +K  FQ   + P      K      G+++  K I   +G  
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQ--TSNPHYT---KYTGSLIGLVEAAKHIWINDGVR 92

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE-TTQKISIXXXXXXXXXXXXV 135
             ++G S+ +L   P  A KF     Y++I   L  + E  +    +            +
Sbjct: 93  GFFQGHSATLLRIFPYAAVKFVA---YEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFI 149

Query: 136 IVPFELIKIRMQ---DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
             P +L+++R+    + K   LG +  +KK  K      L K      W    W   Y G
Sbjct: 150 TYPLDLVRVRLAYETEHKRVKLGRI--IKKIYKEPASATLIKNDYIPNW-FCHWCNFYRG 206

Query: 193 VIYQVRNSMPVA---------------------------------------KTKGQKTRN 213
            +  V   +P A                                       + +  +T  
Sbjct: 207 YVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWA 266

Query: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAV---KKYNWCLPSLLVIYREEGFRA 270
           +LI+G + G        PF++++ R+Q V A+S       K+        +I++E G R 
Sbjct: 267 ELISGGLAGMASQTAAYPFEIIRRRLQ-VSALSPKTMYDHKFQSISEIAHIIFKERGVRG 325

Query: 271 LYKGFVPKVCRLAPGGSLMLVVFTGM 296
            + G      ++ P  +    V+  M
Sbjct: 326 FFVGLSIGYIKVTPMVACSFFVYERM 351

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 4/90 (4%)

Query: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLK 67
           +PL    + ISG +AG++  T  YP ++++ R Q+   +P      K    +  + +   
Sbjct: 260 RPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHK----FQSISEIAH 315

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
            I K+ G    + G+S   +   P  A  F
Sbjct: 316 IIFKERGVRGFFVGLSIGYIKVTPMVACSF 345

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTR--FQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72
           + +SG++AG+  + + YPLD+V+ R  ++ E        + K++ +       +K     
Sbjct: 135 RLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIP 194

Query: 73  EGFSR---LYRGISSPMLMEAPKRATKFACNDQYQKIFKNLF 111
             F      YRG    +L   P     F  +D    + K+ F
Sbjct: 195 NWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPF 236

>Scas_578.3*
          Length = 524

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 122/301 (40%), Gaps = 31/301 (10%)

Query: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE-RYNG---------VIDC 65
           FI+G ++G+   T   PLD +K  F +  T  ++  +  ++  R  G         +I  
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKV-FLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKA 270

Query: 66  LKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN---TNETTQKISI 122
           ++ + ++ G    Y G    +    P+ + KF   +  +++  NL      N+ ++  + 
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTY 330

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQ------DVKSSYLGPMDCLKKTIKNEGIMGLYKGI 176
                        I P + +K R+Q      ++K + L  +   K+  K  GI   Y+G+
Sbjct: 331 VAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNAL-LISTAKEMYKEGGIRVFYRGV 389

Query: 177 ---ESTMWRNALWNGGYFGVI---YQVRNSMPVAKTKGQKTRNDLIA---GAIGGTVGTM 227
                 ++  A  + G F  +   Y  R S  +   +     + L+    GA  GTVG  
Sbjct: 390 LLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGAT 449

Query: 228 LNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGS 287
              P +++++R+Q+    +     Y       +   + EG    YKG VP + ++ P  S
Sbjct: 450 AVYPINLLRTRLQAQGTYAHPYT-YTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCPAVS 508

Query: 288 L 288
           +
Sbjct: 509 I 509

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 76/193 (39%), Gaps = 20/193 (10%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           +S D     L  +  +++G +AG+     +YP+D +K R Q        A +   ++   
Sbjct: 315 LSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQ-------CAPLEGNLKGNA 367

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF----ACNDQYQKIFKNLFNTNET 116
            +I   K++ K+ G    YRG+    L   P  A       A    Y K      N  E 
Sbjct: 368 LLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEK 427

Query: 117 TQKISIXXXXXXXXXXXXV----IVPFELIKIRMQDVKS-----SYLGPMDCLKKTIKNE 167
              +S             V    + P  L++ R+Q   +     +Y G  D   +T+K E
Sbjct: 428 DVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKRE 487

Query: 168 GIMGLYKGIESTM 180
           G+ G YKG+  T+
Sbjct: 488 GVPGFYKGLVPTL 500

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRL 78
           GA +G    T +YP+++++TR Q + T             Y G  D   + +K+EG    
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYT-------YTGFRDVFMQTLKREGVPGF 492

Query: 79  YRGISSPMLMEAPKRATKFACNDQYQ 104
           Y+G+   ++   P  +  + C ++++
Sbjct: 493 YKGLVPTLVKVCPAVSIGYLCYEKFK 518

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 7/104 (6%)

Query: 203 VAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCL 256
           +A   G K  NDL      +AG I G +  +   P D +K RIQ    +   +K     +
Sbjct: 312 MANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCA-PLEGNLKGNALLI 370

Query: 257 PSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF 300
            +   +Y+E G R  Y+G +     + P  +L L  F+ +  ++
Sbjct: 371 STAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWY 414

>Scas_328.1
          Length = 227

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 12  FIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVK 71
           F+  F+ G    IS  T  YPLD V+ R  +            Q  +Y G IDC ++IV 
Sbjct: 136 FLPSFLLGWAVTISASTTSYPLDTVRRRMMM---------TSGQAVKYKGAIDCFQQIVS 186

Query: 72  KEGFSRLYRGISS 84
           +EG   L++G  +
Sbjct: 187 QEGVYSLFKGCGA 199

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 56/137 (40%), Gaps = 9/137 (6%)

Query: 57  ERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNET 116
            ++NG++D  KK +  +G   LYRG    ++     R   F   D  + +   L  + E 
Sbjct: 77  RKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVL--LTGSFEN 134

Query: 117 TQKISIXXXXXXXXXXXXVIVPFELIKIRM-----QDVKSSYLGPMDCLKKTIKNEGIMG 171
               S                P + ++ RM     Q VK  Y G +DC ++ +  EG+  
Sbjct: 135 AFLPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVK--YKGAIDCFQQIVSQEGVYS 192

Query: 172 LYKGIESTMWRNALWNG 188
           L+KG  + ++R     G
Sbjct: 193 LFKGCGANIFRGVAAAG 209

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 155 GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRND 214
           G +D  KKT+  +G++GLY+G   ++    ++ G YFG+   ++  +     +     + 
Sbjct: 81  GILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSF 140

Query: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274
           L+  A+  +  T  + P D V+ R+      S    KY   +     I  +EG  +L+KG
Sbjct: 141 LLGWAVTISASTT-SYPLDTVRRRMM---MTSGQAVKYKGAIDCFQQIVSQEGVYSLFKG 196

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 72/332 (21%), Positives = 131/332 (39%), Gaps = 67/332 (20%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEV----------TTPTAAAVGKQVE--------- 57
           +SGAVA     TV+YPLD+VKT  Q ++          T P +    + V+         
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 58  ------RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF---- 107
                 +YN   D + KI K+EG   LY+G+++ ++    +  + F      +K +    
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 108 -KNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCL--KKTI 164
             N  NT  TT +  +               P  LI  R Q  +    G  D L   K I
Sbjct: 128 LINRKNTKFTTIE-ELLLGIVAAATSQIFTNPISLISAR-QQTRQGIDGDNDFLTVAKEI 185

Query: 165 KNE--GIMGLYKGIESTM---------------WRNALWNGGYFGVIYQVRNSMPVAKTK 207
             E   I G +KG++ ++                ++AL+      +  ++ +S     + 
Sbjct: 186 YKEQRSIKGFWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDS-----SS 240

Query: 208 GQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEG 267
                 +   G +   +  ++  P  + K+ +Q   +  S+ ++       L  +Y+ EG
Sbjct: 241 QLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQV------LYYLYKNEG 294

Query: 268 FRALYKGFVPKVCR--LAPGGSLMLVVFTGMM 297
            R+ +KG  P++ +  L  G   +L +F G +
Sbjct: 295 LRSWWKGLSPQLAKGVLVQG---LLFMFKGEL 323

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 13 IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE-RYNGVIDCLKKIVK 71
          +Y+   GA++G    T++YP D+++ RFQ+       A  G ++  RY  V D L  I K
Sbjct: 11 LYKLAMGAISGGVAQTLVYPFDLLRRRFQV------LAMGGNELGFRYKSVSDALITIGK 64

Query: 72 KEGFSRLYRGISSPMLMEAPKRATKF 97
           EG    Y+G+++ +    P  A  +
Sbjct: 65 TEGPKGYYKGLTANLFKVIPSTAVSW 90

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYK 273
           L  GAI G V   L  PFD+++ R Q +    + +  +Y     +L+ I + EG +  YK
Sbjct: 14  LAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYK 73

Query: 274 GFVPKVCRLAPGGSLMLVVF 293
           G    + ++ P  ++  +V+
Sbjct: 74  GLTANLFKVIPSTAVSWLVY 93

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 115/285 (40%), Gaps = 32/285 (11%)

Query: 8   KPLPFIYQFISGAVAGISELTVM-YPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCL 66
           KP+ F    + GA   +SE+T +  PL+VVKT         T AA      R    ++ +
Sbjct: 16  KPVSF-SNILLGACLNLSEVTTLGQPLEVVKT---------TMAA-----NRNFTFLESV 60

Query: 67  KKIVKKEGFSRLYRGISSPMLMEAP-KRATKFACNDQYQKIFKNLFNTNETTQKIS-IXX 124
           K +  + G    Y+G+     +EA  K A     + + +  FK+L   N  +  +  +  
Sbjct: 61  KHVWSRGGILGYYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSLGLNNFASGILGGVTG 120

Query: 125 XXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDC---LKKTIKNEGIMGLYKGIESTMW 181
                          + ++I      S+   P       K   K EGI G+ KG+ +   
Sbjct: 121 GVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVAI 180

Query: 182 RNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLI-------AGAIGGTVGTMLNTPFDV 234
           R     G  FG+   V +   + K  G+  ++D +       A A+GG + +  N P +V
Sbjct: 181 RQMTNWGSRFGLSRLVEDG--IRKITGKTNKDDKLNPFEKIGASALGGGL-SAWNQPIEV 237

Query: 235 VKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKV 279
           ++  +QS     +  K       +   IY+  G + LY+G  P++
Sbjct: 238 IRVEMQSKKEDPNRPKNLT-VGKTFKYIYQSNGLKGLYRGVTPRI 281

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 69/325 (21%), Positives = 120/325 (36%), Gaps = 56/325 (17%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G V+G    T++ PLD +K  FQ   + P  +   K      G+ +  K I   +G  
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQ--TSNPHYS---KYAGSLVGLYEAAKHIWINDGIR 77

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE-TTQKISIXXXXXXXXXXXXV 135
             ++G S  +L   P  A KF   +Q + I   L  + E  +    +            +
Sbjct: 78  GFFQGHSVTLLRIFPYAAVKFVAYEQIRSI---LIPSREYESHWRRLASGSLAGLCSVFI 134

Query: 136 IVPFELIKIRMQDVKSSYLGPMDCLKKTIKNE-GIMGLYKGIESTMWRNALWNGGYFGVI 194
             P +L ++R+  V       +  + KTI +E    GL   +    W  A W   Y G +
Sbjct: 135 TYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKW-FAHWCNFYRGYV 193

Query: 195 YQVRNSMPVA-----------------------------------KTKGQK----TRNDL 215
             V   +P A                                   K   QK    T  +L
Sbjct: 194 PTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAEL 253

Query: 216 IAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSL----LVIYREEGFRAL 271
           +AG + G +      P ++++ R+Q   +  S  K Y+    S+     +IY+E+G+R  
Sbjct: 254 VAGGLSGILSQTAAYPLEIIRRRLQV--STLSPRKMYDHKFQSISSIARIIYQEKGWRGF 311

Query: 272 YKGFVPKVCRLAPGGSLMLVVFTGM 296
           + G      ++ P  +    V+  M
Sbjct: 312 FVGLSIGYIKVTPMVACSFFVYERM 336

 Score = 34.7 bits (78), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 9   PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKK 68
           PL    + ++G ++GI   T  YPL++++ R Q+   +P      K    +  +    + 
Sbjct: 246 PLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHK----FQSISSIARI 301

Query: 69  IVKKEGFSRLYRGISSPMLMEAPKRATKF 97
           I +++G+   + G+S   +   P  A  F
Sbjct: 302 IYQEKGWRGFFVGLSIGYIKVTPMVACSF 330

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 57/139 (41%), Gaps = 9/139 (6%)

Query: 142 IKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVR-NS 200
           I +R       Y G +D L++    EG+ GLY+G+ S+     + +  YF     VR + 
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY 120

Query: 201 MPVAKTKGQKTR----NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCL 256
             + + +G   R     +L+ G +      +   P +VV +R Q+    + A        
Sbjct: 121 FRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAR 180

Query: 257 PSLLVIYREEGFRALYKGF 275
                ++ E G+R  + G 
Sbjct: 181 E----VHAENGWRGFWAGL 195

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/302 (19%), Positives = 112/302 (37%), Gaps = 47/302 (15%)

Query: 19  GAVAGISELTVMYPLDVVKTRFQLEV-----------------------TTPTAAAVGKQ 55
           GA A       +YPLD+ KT  Q ++                         P A    + 
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 56  VERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE 115
            E+Y G +D L++I   EG + LYRG+ S  +    +  + F      +K +  L     
Sbjct: 69  AEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARG 128

Query: 116 TTQKIS----IXXXXXXXXXXXXVIVPFELIKIRMQDV-KSSYLGPMDCLKKTIKNE-GI 169
              + S    +             + P  ++  R Q   +++    M  + + +  E G 
Sbjct: 129 GDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAENGW 188

Query: 170 MGLYKGIESTMWRNALWNGGYFGVIYQ-VRNSM---PVAKTKGQKTR------NDLIAGA 219
            G + G++ ++      N       Y+ +R ++   P A +    +        + + G 
Sbjct: 189 RGFWAGLKVSLVLTV--NPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGV 246

Query: 220 IGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKV 279
           +   V T+L  P  + K+ +Q      S  + ++  L  L   Y  EG  +L+KG  P++
Sbjct: 247 LSKIVSTVLTQPLIIAKASLQR---SGSCFQDFHQVLHHL---YSTEGPLSLWKGLGPQI 300

Query: 280 CR 281
            +
Sbjct: 301 TK 302

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 115/297 (38%), Gaps = 41/297 (13%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVM-YPLDVVKTRFQLEVTTPTAAAVGKQVERY 59
           M+     KP+ F    + GA   +SE+T +  PL+VVKT         T AA      R 
Sbjct: 1   MAQTIEKKPVSF-SNILLGAGLNLSEVTTLGQPLEVVKT---------TMAA-----HRE 45

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAP-KRATKFACNDQYQKIFKNL-FNTNETT 117
              +   K +  + G    Y+G+     +EA  K A     + + +  FK L  N     
Sbjct: 46  FNFLQATKHVWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGAG 105

Query: 118 QKISIXXXXXXXXXXXXVIVPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGI 169
               I                 + ++I  Q          +SS+       K   K EGI
Sbjct: 106 IMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSW----QVFKSIYKKEGI 161

Query: 170 MGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRND-------LIAGAIGG 222
            G+ KG+ +   R     G  FG+   V +   + K  G+  ++D       ++A AIGG
Sbjct: 162 RGINKGVNAVAIRQMTNWGSRFGLSRLVEDG--IRKLTGKTGKDDKLTALEKIMASAIGG 219

Query: 223 TVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKV 279
            + +  N P +V++  +QS     +  K       +   IY+  G + LY+G  P+V
Sbjct: 220 GL-SAWNQPIEVIRVEMQSKKEDPNRPKNLT-VGKTFKYIYQSNGLKGLYRGVTPRV 274

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 14/71 (19%)

Query: 228 LNTPFDVVKSRIQSVDAVSSAVKKYNWCL--PSLLVIYR---EEGFRALYKGFVPKVCRL 282
           L  P DVVK+R+QS         KY W L   SL  +YR   EEG  +L+KG+VP++ ++
Sbjct: 263 LTQPIDVVKTRMQS---------KYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKV 313

Query: 283 APGGSLMLVVF 293
              G +   V+
Sbjct: 314 GLSGGVSFGVY 324

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 89/231 (38%), Gaps = 50/231 (21%)

Query: 18  SGAVAGISELTVMYPLDVVKTR-----------FQLEVTT-----PTAAAVG-------- 53
           +G++ G  E  ++ P + +KTR           +Q EV T     P + +V         
Sbjct: 104 AGSITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQI 163

Query: 54  -----KQVE-----RYN-----------GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPK 92
                KQV+     RY             +   ++++V+  GF+  ++G    +  +   
Sbjct: 164 RPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGN 223

Query: 93  RATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVIVPFELIKIRMQD--VK 150
            A +F     Y  + + +      ++  +             +  P +++K RMQ     
Sbjct: 224 SAVRFTT---YTTLKQMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTW 280

Query: 151 SSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSM 201
           S Y   ++C+ +T   EG+  L+KG    +++  L  G  FGV   V N M
Sbjct: 281 SLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNLM 331

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 63/148 (42%), Gaps = 27/148 (18%)

Query: 3   SDSNAKPLPFIY-QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVG--KQVERY 59
           SD+N    P +Y   ++G+ A + + T+ +P + +KT  QL  + P A A      V+ Y
Sbjct: 2   SDTN----PSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAFNMFHHVKSY 57

Query: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119
                         G S L  GI   +L    K AT+FA  D+  ++ K+  N       
Sbjct: 58  FA------------GCSALNIGI---LL----KTATRFATFDKACQLLKDPENPEAPVSG 98

Query: 120 IS-IXXXXXXXXXXXXVIVPFELIKIRM 146
           +  I            +I+PFE IK RM
Sbjct: 99  LRLIAAGSITGFMESMLIIPFENIKTRM 126

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 10/77 (12%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S  KPL   Y F  G  +  + + +  P+DVVKTR Q + T             Y   ++
Sbjct: 239 SPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYT----------WSLYRNSLN 288

Query: 65  CLKKIVKKEGFSRLYRG 81
           C+ +   +EG + L++G
Sbjct: 289 CVYRTFIEEGLTSLWKG 305

>Kwal_47.19228
          Length = 281

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 11/85 (12%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S  KPL   Y F  G ++  + + V  P+DV+KTR Q + T             Y   ++
Sbjct: 177 SPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYT----------WSNYKNSLN 226

Query: 65  CLKKIVKKEGFSRLYRGISSPMLME 89
           C  +I  +EGF++ ++G  +P LM+
Sbjct: 227 CAYRIFVEEGFTKFWKGW-APRLMK 250

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 63/153 (41%), Gaps = 22/153 (14%)

Query: 157 MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLI 216
           +  +++  ++ GI G  +G   T+ R    +   F     ++  +        K  N+  
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-----SPNKPLNEYY 186

Query: 217 AGAIG---GTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWC-----LPSLLVIYREEGF 268
           A A+G         +  P DV+K+R+QS         KY W      L     I+ EEGF
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQS---------KYTWSNYKNSLNCAYRIFVEEGF 237

Query: 269 RALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
              +KG+ P++ ++   G +   V+  + N  +
Sbjct: 238 TKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMK 270

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 135 VIVPFELIKIRMQD--VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
           V  P ++IK RMQ     S+Y   ++C  +    EG    +KG    + +  L  G  FG
Sbjct: 201 VTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFG 260

Query: 193 VIYQVRNSM 201
           V   V N M
Sbjct: 261 VYQYVDNLM 269

>Kwal_23.5757
          Length = 307

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 8/154 (5%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM----WRNALWNGGY 190
            + P +L+K R Q   S Y   +D  ++ +++EG   ++ G+ +T      + A   GGY
Sbjct: 36  AVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY 95

Query: 191 FGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVK 250
               +Q    +        +T   L A A    +  +   P++ +K R Q+  AV     
Sbjct: 96  EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT--AVPPPFA 153

Query: 251 KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284
           +  +   S +V    EGF +LYKG  P   R  P
Sbjct: 154 RNVFDAYSKMV--GAEGFASLYKGITPLWFRQIP 185

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 10/66 (15%)

Query: 32  PLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAP 91
           P + +K R Q  V  P A            V D   K+V  EGF+ LY+GI+     + P
Sbjct: 136 PWEAIKVRQQTAVPPPFA----------RNVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185

Query: 92  KRATKF 97
               KF
Sbjct: 186 YTMCKF 191

>Scas_687.15*
          Length = 328

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 116/330 (35%), Gaps = 68/330 (20%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
           Q ++G+ A + E T+ YP + +KT FQL   T  A              + L+ I     
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKP-----------FEALRPI----- 54

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFK--NLFNTNETTQKISIXXXXXXXXXX 132
               + G ++  L    K + +FA  D+  +I +  NL   +       +          
Sbjct: 55  -KVYFAGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVE 113

Query: 133 XXVIVPFELIKIRMQD---------------------------VKSSYLGPMDCLKKTIK 165
              I+PFE +K+ M +                            K   L P +  ++   
Sbjct: 114 SLCIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYS 173

Query: 166 ---NEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA----- 217
              +  I  + K I  T        G    V  QV NS    +     T   LI+     
Sbjct: 174 KYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNS--TVRFTAYTTLKQLISPTQPL 231

Query: 218 --------GAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFR 269
                   G         L  P DVVK+R+QS     +A   Y   L     ++ EEG  
Sbjct: 232 NEVYAFGIGLFSSCAVVALTQPIDVVKTRMQS----KTAHYFYKNSLNCAYRVFVEEGMV 287

Query: 270 ALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
           +L+KG++P++ ++   G +   V+  + N 
Sbjct: 288 SLWKGWLPRLFKVGLSGGISFGVYQYVENL 317

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S  +PL  +Y F  G  +  + + +  P+DVVKTR Q    + TA         Y   ++
Sbjct: 226 SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQ----SKTAHYF------YKNSLN 275

Query: 65  CLKKIVKKEGFSRLYRG 81
           C  ++  +EG   L++G
Sbjct: 276 CAYRVFVEEGMVSLWKG 292

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/327 (20%), Positives = 119/327 (36%), Gaps = 56/327 (17%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G VAG    T++ PLD +K  FQ   + P      K    + G+++    I  ++   
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQ--TSNPHYV---KYAGSFQGLLNAGVHIWSRDRLR 112

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXXXXXXXXVI 136
            +++G S+ +L   P  A KF   +Q + +   + +    T    +              
Sbjct: 113 GVFQGHSATLLRIFPYAAVKFIAYEQIRNVI--IPSKEYETHFRRLCSGSLAGLCSVFCT 170

Query: 137 VPFELIKIRMQDVKSSYLGPMDCLKKTIKNE-GIMGLYKGIESTMWRNALWNGGYFGVIY 195
            P +LI++R+  V   +   +  L K I +E     L        W  A W   Y G I 
Sbjct: 171 YPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKW-FAQWCNFYRGYIP 229

Query: 196 QVRNSMPVA-----------------------------------KTKGQKTRN------- 213
            V   +P A                                   K   Q TR        
Sbjct: 230 TVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLN 289

Query: 214 ---DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFR 269
              +L+AG + G        PF++++ R+Q V AV++ ++ K+        +I+ E G+R
Sbjct: 290 TWAELLAGGLAGMASQTAAYPFEIIRRRLQ-VGAVTNPLEHKFTSMSEMAKIIFHERGWR 348

Query: 270 ALYKGFVPKVCRLAPGGSLMLVVFTGM 296
             + G      ++ P  +    V+  M
Sbjct: 349 GFFVGLSIGYIKVTPMVACSFFVYERM 375

 Score = 34.7 bits (78), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 9   PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQL-EVTTPTAAAVGKQVERYNGVIDCLK 67
           PL    + ++G +AG++  T  YP ++++ R Q+  VT P          ++  + +  K
Sbjct: 287 PLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLE-------HKFTSMSEMAK 339

Query: 68  KIVKKEGFSRLYRGISSPMLMEAPKRATKF 97
            I  + G+   + G+S   +   P  A  F
Sbjct: 340 IIFHERGWRGFFVGLSIGYIKVTPMVACSF 369

>Scas_717.20
          Length = 356

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 14/151 (9%)

Query: 135 VIVPFELIKIRMQDVK---SSYLGPMDCLKKTIK----NEGIMGLYKGIESTMWRNALWN 187
           +I P + IKI  Q      + Y G +  LK+  K    N+GI G ++G   T+ R   + 
Sbjct: 49  LIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYA 108

Query: 188 GGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSS 247
              F    Q+RN++  +K      R  L++G++ G        P D+++ R+  V     
Sbjct: 109 AVKFVAYEQIRNTLIPSKEYESHWRR-LMSGSLAGLCSVFTTYPLDLIRVRLAYVTE--- 164

Query: 248 AVKKYNWCLPSLLVIYREEGFRAL-YKGFVP 277
              K    L  +  IY+E     L  KG++P
Sbjct: 165 --HKRISLLGLVKTIYKEPASTTLEAKGYIP 193

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/322 (20%), Positives = 122/322 (37%), Gaps = 50/322 (15%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76
           ++G ++G    T++ PLD +K  FQ      T  A G  V    G+ +  K I   +G  
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYA-GSLV----GLKEAAKHIWLNDGIR 91

Query: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNE-TTQKISIXXXXXXXXXXXXV 135
             ++G S  ++   P  A KF     Y++I   L  + E  +    +             
Sbjct: 92  GFFQGHSVTLMRIFPYAAVKFVA---YEQIRNTLIPSKEYESHWRRLMSGSLAGLCSVFT 148

Query: 136 IVPFELIKIRMQDV----KSSYLGPMDCLKK-----TIKNEGIM--------GLYKGIES 178
             P +LI++R+  V    + S LG +  + K     T++ +G +          Y+G   
Sbjct: 149 TYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 179 TMWRNALWNGGYF------------------GVIYQVRNSMPVAKTKGQK----TRNDLI 216
           T+     + G  F                   V+    +       K Q+    T  +L+
Sbjct: 209 TVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELL 268

Query: 217 AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLL--VIYREEGFRALYKG 274
           +G + G        PF++++ R+Q      S +  + +   S +  +IY+E G+R  + G
Sbjct: 269 SGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVG 328

Query: 275 FVPKVCRLAPGGSLMLVVFTGM 296
                 ++ P  +    V+  M
Sbjct: 329 LSIGYIKVTPMVACSFFVYERM 350

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 9   PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKK 68
           PL    + +SG +AG++  T  YP ++++ R  L+V+T + + +     R+  + +  K 
Sbjct: 260 PLRTWAELLSGGLAGMASQTAAYPFEIIRRR--LQVSTLSVSQMYDH--RFQSISEIAKI 315

Query: 69  IVKKEGFSRLYRGISSPMLMEAPKRATKF 97
           I K+ G+   + G+S   +   P  A  F
Sbjct: 316 IYKERGWRGFFVGLSIGYIKVTPMVACSF 344

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%), Gaps = 7/105 (6%)

Query: 198 RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLP 257
           RN MP+ K   +      +AG I G+    L  P D +K   Q+ +       KY   L 
Sbjct: 19  RNQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNP---HYTKYAGSLV 75

Query: 258 SL----LVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
            L      I+  +G R  ++G    + R+ P  ++  V +  + N
Sbjct: 76  GLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRN 120

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/320 (19%), Positives = 117/320 (36%), Gaps = 64/320 (20%)

Query: 16  FISGAVAGISELTVMYPLDVVKT---------------RFQLEVTT-------------- 46
           F+    +G + L V YPLD+ KT                 Q +V+T              
Sbjct: 8   FVGAVSSGFANLAV-YPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSKPKKHGI 66

Query: 47  --------PTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFA 98
                   P  A      +RY   +D + K+ + EGF  LY G+S+ +L    +  + F 
Sbjct: 67  QQIKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFF 126

Query: 99  CNDQYQKIFKNLFNTNETTQKIS-------IXXXXXXXXXXXXVIVPFELIKIRMQDVKS 151
               Y  I ++ F   +   + +       +               P  ++  + Q  + 
Sbjct: 127 W---YTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRG 183

Query: 152 -SYLGPMDCLKKTIKNE-GIMGLYKGIESTMWRNALWNGGYFG------VIYQVR-NSMP 202
                    + K + +E GI G +K ++ ++      +  Y        ++Y V  N+  
Sbjct: 184 LEGDNSFKAIAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKD 243

Query: 203 VAKTKGQ-KTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLV 261
           +  +  Q K   + + G +   + T L  P  V K+ +Q   +      K+      L  
Sbjct: 244 LNDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRSSS------KFTSFQEVLTY 297

Query: 262 IYREEGFRALYKGFVPKVCR 281
           +YR EG  AL+KG +P++ +
Sbjct: 298 LYRHEGAHALWKGLLPQLTK 317

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 231 PFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290
           P DV+K+R+Q+ D+V      Y   +     I+ EEGF  L+KG++P++ ++   GS+  
Sbjct: 254 PLDVIKTRMQAKDSV----LLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSF 309

Query: 291 VVF 293
            ++
Sbjct: 310 GIY 312

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 15/64 (23%)

Query: 18  SGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSR 77
           S AV G ++     PLDV+KTR Q +            V  Y   I+C  +I  +EGF+ 
Sbjct: 245 SCAVVGATQ-----PLDVIKTRMQAK----------DSVLLYRNSINCAYRIFVEEGFAM 289

Query: 78  LYRG 81
           L++G
Sbjct: 290 LWKG 293

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 48/121 (39%), Gaps = 36/121 (29%)

Query: 215 LIAGAIGGTVGTMLNTPFDVVK-----------SRIQSVDA-----VSSAVKK------- 251
           L+AGA+ GT+ ++   PF+ VK            R+ +  +     V++ VKK       
Sbjct: 105 LMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPT 164

Query: 252 ----YNWCLPSLL---------VIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298
               Y    P  L          +YR+ G RA +KG +P + R      +    FT +  
Sbjct: 165 LRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ 224

Query: 299 F 299
           F
Sbjct: 225 F 225

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 138 PFELIKIRMQDVKSS--YLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIY 195
           P ++IK RMQ   S   Y   ++C  +    EG   L+KG    + +  L     FG IY
Sbjct: 254 PLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFG-IY 312

Query: 196 QVRNSM 201
           Q   +M
Sbjct: 313 QYTENM 318

>Scas_696.9
          Length = 312

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 107/274 (39%), Gaps = 27/274 (9%)

Query: 17  ISGAVAGISELTVM-YPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75
           I GA   ++E+T +  PL+VVKT         T AA      R    ++ +K +  + G 
Sbjct: 22  ILGATINMAEVTSLGQPLEVVKT---------TMAA-----NRNLNFVNSMKYVWSRGGI 67

Query: 76  SRLYRGISSPMLMEAP-KRATKFACNDQYQKIFKNL----FNTNETTQKISIXXXXXXXX 130
              Y+G+     +EA  K A     + + +  FK L    F +      +          
Sbjct: 68  VGFYQGLIPWAWIEASTKGAVLLFVSAESEYRFKLLGMGNFTSGILGGVLGGVTQSYLTM 127

Query: 131 XXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190
                +   E+ +++     +      +  +     EG+ G+YKG+ +   R     G  
Sbjct: 128 GFCTCMKTVEITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSR 187

Query: 191 FGVIYQVRNSM--PVAKTKGQKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAV 245
           FG    V + +     KTK +   N    + A A+GG + +  N P +V++  +QS    
Sbjct: 188 FGFSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGL-SAWNQPIEVIRVEMQSKKED 246

Query: 246 SSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKV 279
            +  K       +   I +  G + LY+G  P++
Sbjct: 247 PNRPKNLT-VAKTFKYIMKTNGVKGLYRGVTPRI 279

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 157 MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTR---- 212
           +   K+    EG+ G+ KG+ +   R     G  FG+   V + +     K    +    
Sbjct: 154 LQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAM 213

Query: 213 NDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALY 272
             ++A A+GG + +  N P +V++  +QS     +  K       +   IY   G R LY
Sbjct: 214 EKIVASALGGGL-SAWNQPIEVIRVEMQSRTNDPNRPKNLT-VGKTFRYIYENNGLRGLY 271

Query: 273 KGFVPKV 279
           +G  P++
Sbjct: 272 RGVTPRI 278

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 120/320 (37%), Gaps = 60/320 (18%)

Query: 8   KPLPFIYQFISGAVAGISELTVM-YPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCL 66
           KP+ F    + GA   + E+T +  PL+V+KT         T AA      R     + +
Sbjct: 14  KPISF-SNILLGAGLNMCEVTTLGQPLEVIKT---------TMAA-----NRSFSFFNAI 58

Query: 67  KKIVKKEGFSRLYRGISSPMLMEAPKRATKF---ACNDQYQKIFKNLFNTNETTQKISIX 123
           K +  + G    Y+G+     +EA  +       +   +YQ  FK +  +N  +    I 
Sbjct: 59  KHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAESEYQ--FKRMGLSNFGS---GIM 113

Query: 124 XXXXXXXXXXXVIVPF-------ELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGI 176
                      + + F       E+ K +     +         K+  K +GI G+ KG+
Sbjct: 114 GGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGV 173

Query: 177 ESTMWRNALWNGGYFG----VIYQVRNSMPVAKTKGQKTRNDLIAG-AIGGTVGTMLNTP 231
            +   R     G  FG    V   +RN+        + T  + IA  AIGG + +  N P
Sbjct: 174 NAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGL-SAWNQP 232

Query: 232 FDVVKSRIQSVD---------AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282
            +V++  +QS            VSSA K           IY+  G + LY+G  P++   
Sbjct: 233 IEVIRVEMQSKKEDPNRPKNLTVSSAFK----------YIYQSSGIKGLYRGVAPRIGL- 281

Query: 283 APGGSLMLVVFTGMMNFFRD 302
              G    V   G  +  RD
Sbjct: 282 ---GVWQTVFMVGFGDMARD 298

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
           V  PF+ IK RMQ   S +    +     +KNE ++ L+ G+   + R A   G  +G+
Sbjct: 240 VTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGI 298

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 54/292 (18%), Positives = 112/292 (38%), Gaps = 38/292 (13%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID----CLKKIV 70
             I G   G++    + PLD++KTR Q +      A + K ++  +  +      L   +
Sbjct: 13  HLIGGFFGGLTSAVALQPLDLLKTRIQQD----KKATLWKNLKEIDSPLQLWRGTLPSAL 68

Query: 71  KKEGFSRLYRGISSPMLMEAPKR--ATKFACNDQYQKIFKNLFNTNETTQKISIXXXXXX 128
           +    S LY    + M     KR  A     ND        ++N + +  ++++      
Sbjct: 69  RTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDS-----NIVYNKSSSLPRLTMYENLLT 123

Query: 129 XXXXXXVI----VPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184
                 ++    +P  +IK+R +    +Y    + +      EG+ G ++G  +T  R+A
Sbjct: 124 GAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDA 183

Query: 185 LWNGGYFGVIYQVRNSMPVAK-------------TKGQKTRNDLIAGAIGGTVGTMLNTP 231
            + G Y  +  + +  +P+               T    T  +  +  +  ++ T +  P
Sbjct: 184 PYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAP 243

Query: 232 FDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLA 283
           FD +K+R+Q   +      K+     +   I + E    L+ G   ++ R A
Sbjct: 244 FDTIKTRMQLEPS------KFTNSFNTFTSIVKNENVLKLFSGLSMRLARKA 289

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 11/85 (12%)

Query: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64
           S  KPL   Y F+ G ++  + + V  P+DV+KTR Q    +  A A       Y   ++
Sbjct: 316 SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQ----SKYAWA------NYKNSLN 365

Query: 65  CLKKIVKKEGFSRLYRGISSPMLME 89
           C  +I  +EG  + ++G  +P LM+
Sbjct: 366 CAYRIFVEEGIPKFWKGW-APRLMK 389

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 68/173 (39%), Gaps = 22/173 (12%)

Query: 136 IVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIY 195
           I P E + +  ++  +S       +K+     G+ G  +G   T++R      G   V +
Sbjct: 252 ISPRERLFLHYEEHPTSRF--FSTVKEIYLTRGLRGFVQGTAPTIFRQM----GNSAVRF 305

Query: 196 QVRNSMP--VAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN 253
               S+   ++  K        + G I       +  P DV+K+R+QS         KY 
Sbjct: 306 TTYTSLKQLISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQS---------KYA 356

Query: 254 WC-----LPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFR 301
           W      L     I+ EEG    +KG+ P++ ++   G +   V+  + N  +
Sbjct: 357 WANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIK 409

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 135 VIVPFELIKIRMQD--VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFG 192
           V  P ++IK RMQ     ++Y   ++C  +    EGI   +KG    + +  L  G  FG
Sbjct: 340 VTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFG 399

Query: 193 VIYQVRNSMPVAKTKGQ 209
           V   V N + +   + Q
Sbjct: 400 VYQYVENLIKLMAHEKQ 416

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTA 49
           ++G+ A + + T+ YP + +KT  QL  + P A
Sbjct: 99  VAGSCASVFQTTISYPFEFLKTGLQLHRSLPNA 131

>Kwal_34.15907
          Length = 312

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 62/148 (41%), Gaps = 16/148 (10%)

Query: 144 IRMQDVKSSYLGPM-----DCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVR 198
           + +   KS+  G +        K+    EGI G+ KG+ +   R     G  FG+   V 
Sbjct: 136 VEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVE 195

Query: 199 NSMPVAKTKGQKTRND-------LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKK 251
               +    G+   +D       + A A+GG + +  N P +V++  +QS     +  KK
Sbjct: 196 QG--IRDFTGKTNPDDKLTALEKIFASALGGGL-SAWNQPIEVIRVEMQSKKEDPNRPKK 252

Query: 252 YNWCLPSLLVIYREEGFRALYKGFVPKV 279
                 +   IY+  G + LY+G  P++
Sbjct: 253 LT-VGSAFKYIYQSSGIKGLYRGVAPRI 279

>Kwal_23.2913
          Length = 320

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 73/180 (40%), Gaps = 36/180 (20%)

Query: 138 PFELIKIRMQDVKSSYLGPMDCLKKTIKN----------EGIMGLYKGI------ESTMW 181
           PF+L+K+R Q  ++S  G +D + + +              I G Y+G+       + ++
Sbjct: 48  PFDLLKVRCQSNQAS--GTLDAISRVLHEAKSKSGPLPLNQIKGFYRGVIPPLLGVTPIF 105

Query: 182 RNALWNGGY-FGVIYQVRNSMPVAKTKGQK-------TRNDLIAGAIGGTVGTMLNTPFD 233
             + W  GY  G       S PV    G         T    +AG       T++  P +
Sbjct: 106 AVSFW--GYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTE 163

Query: 234 VVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
            VK  +Q+ ++ S         L +   + RE G R+L++G +  + R  PG +L    +
Sbjct: 164 RVKVVLQTSESGS--------FLGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASY 215

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/109 (19%), Positives = 45/109 (41%), Gaps = 13/109 (11%)

Query: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60
           +S + +   L  +   ++G VAG+S    ++P+D +KT+ Q                R  
Sbjct: 222 LSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQ-------------SSSRSQ 268

Query: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109
            ++   ++I  + G    + G+   ++   P  A  F   +   ++FK 
Sbjct: 269 SMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFTHQLFKQ 317

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 16/81 (19%)

Query: 213 NDLIAGAIGGTVGTMLNTPFDVVKSRIQS------VDAVSSAV---KKYNWCLPSLLVIY 263
             L AG +GG    +   PFD++K R QS      +DA+S  +   K  +  LP    + 
Sbjct: 30  ESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLP----LN 85

Query: 264 REEGFRALYKGFVPKVCRLAP 284
           + +GF   Y+G +P +  + P
Sbjct: 86  QIKGF---YRGVIPPLLGVTP 103

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 54/128 (42%), Gaps = 11/128 (8%)

Query: 159 CLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRND---- 214
             K+    EGI G+ KG+ +   R     G  FG    V   +   K  G+   +D    
Sbjct: 152 AFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGL--RKFTGKTNPDDKLTA 209

Query: 215 ---LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRAL 271
              + A AIGG + +  N P +V++  +QS     +  K       +   IY+  G + L
Sbjct: 210 LEKIFASAIGGGL-SAWNQPIEVIRVEMQSKTNDPNRPKDLT-VGKAFRYIYQSNGVKGL 267

Query: 272 YKGFVPKV 279
           Y+G  P++
Sbjct: 268 YRGVTPRI 275

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/201 (17%), Positives = 76/201 (37%), Gaps = 25/201 (12%)

Query: 17  ISGAVAGISELTVMYPLDVVKTRF---------QLEVTTPTA---------AAVGKQVER 58
           I+G + GI E   + P + +KT           +LE   P           A     V R
Sbjct: 80  IAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVAR 139

Query: 59  YNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ 118
              ++  +K + +  G +   +G ++ +  +    + +F     ++++ +         +
Sbjct: 140 IEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQA-----RNDK 194

Query: 119 KISIXXXXXXXXXXXXVIVPFELIKIRM--QDVKSSYLGPMDCLKKTIKNEGIMGLYKGI 176
             S+            +  P +++K RM  Q+ K+ Y   ++C+ +    EG+   +KG 
Sbjct: 195 ASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGS 254

Query: 177 ESTMWRNALWNGGYFGVIYQV 197
                +  +  G  F V  QV
Sbjct: 255 IFRFMKVGISGGLTFTVYEQV 275

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 59/143 (41%), Gaps = 20/143 (13%)

Query: 157 MDCLKKTIKNEGIMGLYKGIESTMWRN----ALWNGGY--FGVIYQVRNSMPVAKTKGQK 210
           +  +K   +  G     +G  +T++R     ++    Y  F  + Q RN    +   G  
Sbjct: 144 LPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSVITGLA 203

Query: 211 TRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRA 270
           T   L+A          +  P DVVK+R+ S +A +    +Y   L  +  I+ +EG   
Sbjct: 204 TSFTLVA----------MTQPIDVVKTRMMSQNAKT----EYKNTLNCMYRIFVQEGMAT 249

Query: 271 LYKGFVPKVCRLAPGGSLMLVVF 293
            +KG + +  ++   G L   V+
Sbjct: 250 FWKGSIFRFMKVGISGGLTFTVY 272

>Scas_671.1*
          Length = 123

 Score = 33.9 bits (76), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%)

Query: 135 VIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGV 193
           +  PF+ IK RMQ     +      L    KNE I  L+ G+   + R AL  G  +G+
Sbjct: 56  ITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAGIAWGI 114

>Scas_613.24
          Length = 177

 Score = 34.3 bits (77), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 64/175 (36%), Gaps = 26/175 (14%)

Query: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74
             +SG + G+S    + PLD++KTR Q            K    ++ + D    I     
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQQH----------KGATLWSAIKDIKDPI----- 55

Query: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN---------ETTQKISIXXX 125
             + +RG     L  +   A   +C +  +    +    +         + T   ++   
Sbjct: 56  --QFWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTG 113

Query: 126 XXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM 180
                    + +P  ++K+R +    SY    + +K   K EGI G +KG   T+
Sbjct: 114 AMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 207 KGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVS--SAVK 250
           K  KT   L++G IGG    +   P D++K+RIQ     +  SA+K
Sbjct: 4   KSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIK 49

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 117/303 (38%), Gaps = 30/303 (9%)

Query: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGV 62
           S+ N   +  +   I+G++ G + + V YPL  + T  Q    T    A  K        
Sbjct: 2   SEINPNDVDELAHAIAGSLGGAASIAVTYPLVTITTNLQ----TKENEARPK-------- 49

Query: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI 122
           ++ +K+I  K G    + G+ S +   A      +   +   K  + L      +   SI
Sbjct: 50  LETIKEIYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESI 109

Query: 123 XXXXXXXXXXXXVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIEST--M 180
                          P  +   RM   KS++   +  +   +K +G + L  G++    +
Sbjct: 110 LASTIAGSMTAVASNPIWVANTRMTVAKSNH-STLRTVIDIVKTDGPLTLLNGLKPALVL 168

Query: 181 WRNALWNGGYFGVIYQVRN-SMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239
             N +     + V  Q++N  + + + K        + GAIG    T    P+  +K+R+
Sbjct: 169 VSNPIIQ---YTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRM 225

Query: 240 QSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNF 299
             +       +K  W L  ++ I +++G   LY G   K+ +     S+M   F   + F
Sbjct: 226 HLMQN-DPKHQKSMWSL--IVEIVKKDGVSGLYNGVAVKLVQ-----SIMTAAF---LFF 274

Query: 300 FRD 302
           F++
Sbjct: 275 FKE 277

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 8/100 (8%)

Query: 199 NSMPVAKTKGQKTRN--DLI-AGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYN-- 253
           N+ P+  T      N  D + AG + G    +++ P D + +R  ++D + S+ KKY+  
Sbjct: 145 NNFPLRATDQAFQHNMFDFLRAGFLAGAAQAIVSAPIDAIYTR-ANIDELLSSAKKYDNL 203

Query: 254 WCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293
           W      +  RE G    + GF     R + G +L    F
Sbjct: 204 WLYSRDKI--REIGLIGCFGGFGLSFIRESFGFALYFTTF 241

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,880,007
Number of extensions: 347518
Number of successful extensions: 2539
Number of sequences better than 10.0: 212
Number of HSP's gapped: 1421
Number of HSP's successfully gapped: 614
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)