Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR044W1571427541e-104
CAGL0L09999g134591566e-14
Scas_699.46d1881441389e-11
Kwal_33.13628116048660.93
ACR081C9628611.4
YJR054W49782622.2
Kwal_55.2160316418594.1
YDR275W (BSC2)23523594.7
ADL089C97487605.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR044W
         (155 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unkno...   295   e-104
CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416 S...    65   6e-14
Scas_699.46d                                                           58   9e-11
Kwal_33.13628                                                          30   0.93 
ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678) [...    28   1.4  
YJR054W (YJR054W) [2948] chr10 (535970..537463) Protein of unkno...    28   2.2  
Kwal_55.21603                                                          27   4.1  
YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown...    27   4.7  
ADL089C [1652] [Homologous to ScYIL031W (ULP2) - SH] (527344..53...    28   5.6  

>YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unknown
           function [474 bp, 157 aa]
          Length = 157

 Score =  295 bits (754), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/142 (100%), Positives = 142/142 (100%)

Query: 14  QSLQYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKRKLGRSKTNNRPHSPR 73
           QSLQYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKRKLGRSKTNNRPHSPR
Sbjct: 14  QSLQYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKRKLGRSKTNNRPHSPR 73

Query: 74  LHKIYSSGDCMDTLIGQVRDLRVFLLSTIHSHSKRFFSTRFQTKSGINSAIDANDVETTS 133
           LHKIYSSGDCMDTLIGQVRDLRVFLLSTIHSHSKRFFSTRFQTKSGINSAIDANDVETTS
Sbjct: 74  LHKIYSSGDCMDTLIGQVRDLRVFLLSTIHSHSKRFFSTRFQTKSGINSAIDANDVETTS 133

Query: 134 DVSSFTNLHLTRSSEEGYYIAG 155
           DVSSFTNLHLTRSSEEGYYIAG
Sbjct: 134 DVSSFTNLHLTRSSEEGYYIAG 155

>CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416
          Saccharomyces cerevisiae YOR044w, start by similarity
          Length = 134

 Score = 64.7 bits (156), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%), Gaps = 4/59 (6%)

Query: 16 LQYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKRKL----GRSKTNNRPH 70
          +QY C   +A LLIPFLGLYAFDLFLYVYR++ Y  ++  Y++KL     ++ T++R H
Sbjct: 17 VQYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKKLTNREQQASTSSREH 75

>Scas_699.46d
          Length = 188

 Score = 57.8 bits (138), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 64/144 (44%), Gaps = 28/144 (19%)

Query: 17  QYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNYKR----KLGRSKT------- 65
           QY C   I  LLIPF+G Y+FDLFLY+YR++ Y  +   YKR    +LG+ +T       
Sbjct: 21  QYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIYKRNQNKRLGKEETPMPLEKT 80

Query: 66  -NNRPHSPRLHKIYSS---------------GDCMDTLIGQVRDLRVFLLSTIHSHSKRF 109
            +  PH  R   I  S                +     +G        +LS + ++  RF
Sbjct: 81  SSENPHPFRELLIKKSETNQQQQQRSSSNQDKNSSKDGVGNSLHFNSVMLSKLRANLTRF 140

Query: 110 FSTRFQTKSGINSAIDANDVETTS 133
            S R     G++S+ID   +E  S
Sbjct: 141 ISERL-VDLGLDSSIDHYGIEKHS 163

>Kwal_33.13628
          Length = 1160

 Score = 30.0 bits (66), Expect = 0.93,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 92  RDLRVFLLSTIHSHSKRFFSTRFQTKSGINSAIDANDVETTSDVSSFT 139
           ++L  FLL  +H    R     F  K  + S+ D ND++   +++S T
Sbjct: 394 QELLAFLLDGLHEDLNRIMKKPFVEKPELASSDDVNDIDVIRNLASLT 441

>ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678)
          [291 bp, 96 aa]
          Length = 96

 Score = 28.1 bits (61), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 19 ICRTCIAFLLIPFLGLYAFDLFLYVYRM 46
          +C+     LL P + +YA+D  LYV R+
Sbjct: 25 VCKVLAWLLLGPLVAVYAYDFCLYVLRL 52

>YJR054W (YJR054W) [2948] chr10 (535970..537463) Protein of unknown
           function [1494 bp, 497 aa]
          Length = 497

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 16/82 (19%)

Query: 58  RKLGRSKTNNRPHSPRLHKIYSSGDC-----------MDTLIGQVRDLRVFLLSTIHSHS 106
           R +   K  +   S   +KI+S+G             +D++     ++R F     +S+S
Sbjct: 388 RSVNTPKYEDLSSSDIFNKIHSAGQLKSTTSMEFHGPLDSMPNTTNNIRNF-----NSNS 442

Query: 107 KRFFSTRFQTKSGINSAIDAND 128
            R      QTKS INS  D+ND
Sbjct: 443 SRPRPPPLQTKSSINSKADSND 464

>Kwal_55.21603
          Length = 164

 Score = 27.3 bits (59), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 14/18 (77%)

Query: 30 PFLGLYAFDLFLYVYRMI 47
          P + LYA+D  LY++R++
Sbjct: 36 PVIALYAYDFGLYMWRVV 53

>YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown
           function [708 bp, 235 aa]
          Length = 235

 Score = 27.3 bits (59), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 36  AFDLFLYVYRMILYLSQMFNYKR 58
           A DLFLY+ R++ Y  ++F+Y R
Sbjct: 91  AIDLFLYMCRLLDYGCKLFHYNR 113

>ADL089C [1652] [Homologous to ScYIL031W (ULP2) - SH]
           (527344..530268) [2925 bp, 974 aa]
          Length = 974

 Score = 27.7 bits (60), Expect = 5.6,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 64  KTNNRPHSPRLHKIYSSGDCMDTLIGQVRDLRVFLLSTIHSHSKRFFSTRFQTKSGINSA 123
           ++++R  SPR+ +  SS    DTL+ +     +F +S+    S    S + +++ G N  
Sbjct: 709 RSSSRDVSPRVRRHLSSSPVGDTLVNETGTKSIFFVSSSCKESDLVPSAQ-KSEEGYNKV 767

Query: 124 IDANDVETTSDVSSFTNLHLTRSSEEG 150
             A     TS ++S    HL  + +E 
Sbjct: 768 TAA-----TSLLASEEGQHLKTTEDEA 789

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,464,804
Number of extensions: 175215
Number of successful extensions: 672
Number of sequences better than 10.0: 11
Number of HSP's gapped: 671
Number of HSP's successfully gapped: 11
Length of query: 155
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 62
Effective length of database: 13,376,635
Effective search space: 829351370
Effective search space used: 829351370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 57 (26.6 bits)