Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR043W (WHI2)48647820310.0
Scas_699.4651250712451e-168
Kwal_55.2160044248810071e-133
ACR082C4224779271e-121
KLLA0F15972g4584429181e-119
Scas_615.84474908791e-114
Sklu_1533.11921784731e-56
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR043W
         (478 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in...   786   0.0  
Scas_699.46                                                           484   e-168
Kwal_55.21600                                                         392   e-133
ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH] (503954..50...   361   e-121
KLLA0F15972g complement(1481761..1483137) similar to sp|P12611 S...   358   e-119
Scas_615.8                                                            343   e-114
Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement         186   1e-56

>YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in
           growth regulation and stress response [1461 bp, 486 aa]
          Length = 486

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/478 (81%), Positives = 390/478 (81%)

Query: 1   MDDIITQVSPDNAESAPILXXXXXXXXXXXXXXXXDYGDSLIHLNIQENHYFITRDQXXX 60
           MDDIITQVSPDNAESAPIL                DYGDSLIHLNIQENHYFITRDQ   
Sbjct: 1   MDDIITQVSPDNAESAPILQEQQQQQNSQYEGNEEDYGDSLIHLNIQENHYFITRDQLMS 60

Query: 61  XXXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHP 120
                       GVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHP
Sbjct: 61  LPESLLLCLFPSGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHP 120

Query: 121 VEKFFDRPSSSFVSNAKGFFGLXXXXXXXXXXEQDILHQKPAIIVLREDLDYYCVPQEEF 180
           VEKFFDRPSSSFVSNAKGFFGL          EQDILHQKPAIIVLREDLDYYCVPQEEF
Sbjct: 121 VEKFFDRPSSSFVSNAKGFFGLSSNNSISSNNEQDILHQKPAIIVLREDLDYYCVPQEEF 180

Query: 181 QFDSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKXXXXXXKIEKGXXX 240
           QFDSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLK      KIEKG   
Sbjct: 181 QFDSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKQQQQQQKIEKGSNS 240

Query: 241 XXXXXXXXXXLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLANETTEG 300
                     LGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLANETTEG
Sbjct: 241 SSNTKSTSKKLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLANETTEG 300

Query: 301 FRQKFNEAKAKWEAEHKPSQDNFITPMQXXXXXXXXXXXXXXXXXXTARNLTSGSTAPAT 360
           FRQKFNEAKAKWEAEHKPSQDNFITPMQ                  TARNLTSGSTAPAT
Sbjct: 301 FRQKFNEAKAKWEAEHKPSQDNFITPMQSNISINSLSASKSNSTISTARNLTSGSTAPAT 360

Query: 361 ARDKRKSRLSKLADNVXXXXXXXXXXQTRSKPPELPKLYDLVPKPNINAKLLLFWRKPAR 420
           ARDKRKSRLSKLADNV          QTRSKPPELPKLYDLVPKPNINAKLLLFWRKPAR
Sbjct: 361 ARDKRKSRLSKLADNVRSHSSSRHSSQTRSKPPELPKLYDLVPKPNINAKLLLFWRKPAR 420

Query: 421 KCWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRRVWTL 478
           KCWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRRVWTL
Sbjct: 421 KCWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRRVWTL 478

>Scas_699.46
          Length = 512

 Score =  484 bits (1245), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 275/507 (54%), Positives = 323/507 (63%), Gaps = 32/507 (6%)

Query: 1   MDDIITQVSPDNAESA---PILXXXXXXXXXXXXXXXXDYGDSLIHLNIQENHYFITRDQ 57
           M +IITQV  +N+ +    P+                 + GDSLIHLNIQENHYFITRDQ
Sbjct: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60

Query: 58  XXXXXXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLY 117
                          GVFLDR GQVI+NL+ DDEVYIVNFPPDCFEYIME+YTKA DDL 
Sbjct: 61  LMSLPESLLLCLFPSGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120

Query: 118 NHPVEKFFDRPSS-SFVSNAKGFFGL---------------XXXXXXXXXXEQDILHQKP 161
           N+PVEK+FD+ S+   +++AKGFFG                          E D+LHQKP
Sbjct: 121 NYPVEKYFDKASNHKLINSAKGFFGFGSSNSLSNVNSNTSSGTAASTTTTSEHDLLHQKP 180

Query: 162 AIIVLREDLDYYCVPQEEFQFDSTNE--ENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGL 219
           AIIVLREDLDYYCVPQE FQF + NE  ENN+DLL +FMAQVK+AAGSYLT KTSIF+GL
Sbjct: 181 AIIVLREDLDYYCVPQETFQF-AKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGL 239

Query: 220 YSSNRLKXXXXXXKIEKGXXXXXXXXXXXXXLGPAEQHLMDMLCSSGFTKETCWGNRTQE 279
           +SSNRLK      K  +              LGPAEQHLMDMLCSSGF   + WGNRTQE
Sbjct: 240 FSSNRLK--DSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQE 297

Query: 280 TGKTVISSLSLCRLANETTEGFRQKFNEAKAKWEAEHKPSQDNF----ITPMQXXXXXXX 335
           +GKTVISSL+LCRLANE+T+ FR  ++ AK KWE EH  +QD         +Q       
Sbjct: 298 SGKTVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNS 357

Query: 336 XXXXXXXXXXXTARNLTSGSTAPATARDKRKSRLSKLADNVXXXXXXXXXXQTR---SKP 392
                       A N  S S        ++K+RL+ LADNV           TR   SK 
Sbjct: 358 IVPSRSSTSVNIASNSNSSSKQSGPRESRKKNRLATLADNVRSHSTSRNSSLTRLRSSKS 417

Query: 393 PELPKLYDLVPKPNINAKLLLFWRKPARKCWWGEEDIELEVEVFGSWKDESKKIIELILP 452
            ELPKLYDLVPKP+INAKLLLFWRKPARKCWWGEEDIE+E+E++G W D+ KKII+L LP
Sbjct: 418 LELPKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLP 477

Query: 453 -TNVDPEAELHKIIVPVRLHIRRVWTL 478
             + D E +L+KI +PVRLHIRRVWTL
Sbjct: 478 HEDKDIEQQLNKIRIPVRLHIRRVWTL 504

>Kwal_55.21600
          Length = 442

 Score =  392 bits (1007), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/488 (47%), Positives = 283/488 (57%), Gaps = 64/488 (13%)

Query: 1   MDDIITQVSPDNAESAPILXXXXXXXXXXXXXXXXDYGDSLIHLNIQENHYFITRDQXXX 60
           M  +ITQVS D     P++                   DSLIHLNIQENHY+ITRDQ   
Sbjct: 1   MQSVITQVSADQG-PIPVMQEQNQEFLDD---------DSLIHLNIQENHYYITRDQLMS 50

Query: 61  XXXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHP 120
                       GVF++R GQVITNLT  DEVYI NFPP CFEYIME Y +A +DL N P
Sbjct: 51  LPESLLLCLFPSGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFP 110

Query: 121 VEKFFDRPSSSFVSNAKGFFGL---XXXXXXXXXXEQDILHQKPAIIVLREDLDYYCVPQ 177
           V++ FDR  SS    ++ FFG              E +ILH+KP+IIVLREDLDYYCVPQ
Sbjct: 111 VDEIFDRGLSSPKEQSR-FFGFPSSHSSMQNSSGGEAEILHEKPSIIVLREDLDYYCVPQ 169

Query: 178 EEFQF--DSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKXXXXXXKIE 235
            +  +  D+  E  NE LL +FMA+VK+AAGSYL+ +TS+FQGL SSNRLK        E
Sbjct: 170 MKLAYPPDTPQELRNE-LLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGE 228

Query: 236 KGXXXXXXXXXXXXXLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLAN 295
                          LGPAEQHLMDMLCSSGF   + WGNR QE GKTVISSLSLCRLAN
Sbjct: 229 N-----------KQKLGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLAN 277

Query: 296 ETTEGFRQKFNEAKAKWEAEHKP---SQDNF--ITPMQXXXXXXXXXXXXXXXXXXTARN 350
           ETT+ FR K + AK K E E K    +QD+   +TP                        
Sbjct: 278 ETTQDFRDKVDAAKRKHEDELKSLRGAQDSTYSLTPK----------------------- 314

Query: 351 LTSGSTAPATARDKRKSRLSKLADNVXXXXXXXXXXQTRSKPPELPKLYDLVPKPNINAK 410
             S S+  A    KRKSRLS LADNV           +R +  + P LY+LVP+P+IN+K
Sbjct: 315 -GSRSSPSAQPDPKRKSRLSSLADNVRSRSASRNRSSSRQRVDQAPTLYELVPRPDINSK 373

Query: 411 LLLFWRKPARKCWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRL 470
           LLLFW+KPARKCWWGEED  LE++++G     + +++       +     +  + VPV+L
Sbjct: 374 LLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELV-------LRQSGPVVSLSVPVKL 426

Query: 471 HIRRVWTL 478
           HIRRVWTL
Sbjct: 427 HIRRVWTL 434

>ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH]
           (503954..505222) [1269 bp, 422 aa]
          Length = 422

 Score =  361 bits (927), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/477 (44%), Positives = 263/477 (55%), Gaps = 71/477 (14%)

Query: 4   IITQVSPDNAESAPILXXXXXXXXXXXXXXXXDYGD--SLIHLNIQENHYFITRDQXXXX 61
           IITQVSP+       L                DY D  +LIHLNIQ  HY+ITR+Q    
Sbjct: 7   IITQVSPEQQLGGSQLMTEQIEP---------DYYDENTLIHLNIQGRHYYITREQLMSL 57

Query: 62  XXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHPV 121
                      GVF++R GQVITNLT +DEVYI NFPP CFE IME YT A  DL N PV
Sbjct: 58  PESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPV 117

Query: 122 EKFFDRPSSSFVSNAKGFFGLXXXXXXXXXXEQDILHQKPAIIVLREDLDYYCVPQEEFQ 181
            +F  R   +     KGF GL          E  ILH+KPAIIVLREDLDYYCVP     
Sbjct: 118 GEFGRRAPHA---GPKGFLGLTPSQSQPMS-ESQILHEKPAIIVLREDLDYYCVPSVSLA 173

Query: 182 FDSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKXXXXXXKIEKGXXXX 241
            +  + E  + LL   MAQVK AAGS+L  + S+F+GLYSSNR++      + ++     
Sbjct: 174 LEDGSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPDQ----- 228

Query: 242 XXXXXXXXXLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLANETTEGF 301
                    LGPAEQHLMDMLC+SGF + + WGNR+QE GKTVISSLSLCRL NET + F
Sbjct: 229 ---------LGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEF 279

Query: 302 RQKFNEAKAKWEAEHKPSQDNFITPMQXXXXXXXXXXXXXXXXXXTARNLTSGSTAPATA 361
           R +   A+ +++ +H       +TP                            ++AP + 
Sbjct: 280 RDQVAAARRRYDEDH-------VTP--------------------------DAASAPPSR 306

Query: 362 RDKRKSRLSKLADNVXXXXXXXXXXQTRSKPPELPKLYDLVPKPNINAKLLLFWRKPARK 421
             KRKSRLS   DNV           +R+  P  P LYDLVP+P IN KLLLFW+KPARK
Sbjct: 307 DQKRKSRLSTFTDNVRSRSSSRTRSSSRA--PREPSLYDLVPRPEINTKLLLFWKKPARK 364

Query: 422 CWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRRVWTL 478
           CWWG E I ++V++ G +  ES     L+L  N    + L  + +PV LHIRRVWTL
Sbjct: 365 CWWGLETITVDVQLNGHYDSESGT---LVLSRN----SPLCVLTIPVNLHIRRVWTL 414

>KLLA0F15972g complement(1481761..1483137) similar to sp|P12611
           Saccharomyces cerevisiae YOR043w WHI2 growth regulation
           protein singleton, start by similarity
          Length = 458

 Score =  358 bits (918), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/442 (45%), Positives = 261/442 (59%), Gaps = 36/442 (8%)

Query: 39  DSLIHLNIQENHYFITRDQXXXXXXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFP 98
           D+LIHLNIQE HY+ITR Q               GVF+DR GQ+ITNLT DDEVYI NF 
Sbjct: 43  DTLIHLNIQEKHYYITRTQLMSLPESLLLCLFPSGVFMDRDGQIITNLTPDDEVYIPNFS 102

Query: 99  PDCFEYIMEIYTKAHDDLYNHPVEKFFDRPSS-SFVSNAKGFFGLXXXXXXXXXXEQDIL 157
            +CFEYIM++Y +AH D  N PV + F+R  +    S    FF            E +IL
Sbjct: 103 TECFEYIMDVYNQAHTDYLNFPVNEIFNRKGTNGSSSGGNNFFNFGSSNNSSSSQESEIL 162

Query: 158 HQKPAIIVLREDLDYYCVPQEEFQF-DSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIF 216
           H+KP IIVLREDLDYYCVPQ   ++ + +++   E+LL + M Q+K+AAGS+L  +TS+F
Sbjct: 163 HEKPGIIVLREDLDYYCVPQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVF 222

Query: 217 QGLYSSNRLKXXXXXXKIEKGXXXXXXXXXXXXXLGPAEQHLMDMLCSSGFTKETCWGNR 276
            GL SSNR K      +++               LG AEQHLMDMLCSSGF  E+ WGNR
Sbjct: 223 LGLKSSNRAKKPTKSNQVDG-----TKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNR 277

Query: 277 TQETGKTVISSLSLCRLANETTEGFRQKFNEAKAKWEAEHKPSQDNFITPMQXXXXXXXX 336
           +QE  KTVISSLSLCRLANETT+ FR     AKAK++ + K                   
Sbjct: 278 SQEMDKTVISSLSLCRLANETTQEFRDAVAVAKAKYDDDQK------------------- 318

Query: 337 XXXXXXXXXXTARNLTSGSTAPATARDKRKSRLSKLADNVXXXXXXXXXXQTRSKPPELP 396
                     T+ N+    T P+    KRKSRLS  ++NV           +R +  E P
Sbjct: 319 -SIASTMTNDTSSNMKLTPT-PSRTDVKRKSRLSVFSENVRSRSRSRNRSASRQRANESP 376

Query: 397 KLYDLVPKPNINAKLLLFWRKPARKCWWGEEDIELEVEVFGSWKDESKKIIELILPTNVD 456
            LY+LVPKP+IN KLLLFW+KPARKCWWG+E ++LEV+    +++++      I P N  
Sbjct: 377 TLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFENDTLT----IFPDN-- 430

Query: 457 PEAELHKIIVPVRLHIRRVWTL 478
             +++ K+ VPV++HIRRVWTL
Sbjct: 431 --SKIQKLKVPVKIHIRRVWTL 450

>Scas_615.8
          Length = 447

 Score =  343 bits (879), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/490 (43%), Positives = 260/490 (53%), Gaps = 63/490 (12%)

Query: 1   MDDIITQVSPDNAESAPILXXXXXXXXXXXXXXXXDYGDSLIHLNIQENHYFITRDQXXX 60
           M++IITQV  + A     +                D G+SL+HLNIQENHYF+TRDQ   
Sbjct: 1   MENIITQVPQNGAVPNGFINQSGLEQEDLSNY---DNGNSLVHLNIQENHYFLTRDQLMT 57

Query: 61  XXXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHP 120
                       GVFLDR  QVITNLT +DEV+I NFP  CFEYIME Y KA+DDL N P
Sbjct: 58  LPESLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFP 117

Query: 121 VEKFFDRPSSSFVSNAKGFFGLXXXXXXXXXXEQDILHQKPAIIVLREDLDYYCVPQEEF 180
           V + F  PS   + NA                +  ILH+ P+IIVLREDLDYYCVPQ EF
Sbjct: 118 VLEQF--PS---IRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQLEF 172

Query: 181 QFDSTNEEN-------NEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKXXXXXXK 233
           +F+   E          +DLL+H M+Q+K+AAGSYL ++TSIFQGLY SN++        
Sbjct: 173 EFEPLPEGRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQV 232

Query: 234 IEKGXXXXXXXXXXXXXLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRL 293
              G             LGPAEQHLMDMLCSSGF  E+ WGNRTQE GKT+ISSLSLCRL
Sbjct: 233 PLHG-------SGKSSTLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRL 285

Query: 294 ANETTEGFRQKFNEAKAKWEAEHKPSQDNFITPMQXXXXXXXXXXXXXXXXXXTARNLTS 353
            NE+TE FR         W+ ++K S D                              T 
Sbjct: 286 YNESTEDFRNAVTREMKNWK-KNKDSNDG-----------------------------TK 315

Query: 354 GSTAPATARDKRKSRLSKLADNVXXXXXXXXXXQTRSKPPELPKLYDLVPKPNINAKLLL 413
             + P    D    R   + DNV             S P +   +Y LVPKP IN KLLL
Sbjct: 316 RFSMP-IMEDGNSGR--NIDDNVRNSVMIADDININSMPDD---VYKLVPKPTINNKLLL 369

Query: 414 FWRKPARKCWWGEEDIELEVEVFGS-WKDESKKIIELILP----TNVDPEAELHKIIVPV 468
           FWRKPARK WW  E++ELEVE++GS         + L +P       D E   + + +P+
Sbjct: 370 FWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENANANDNEFVTNTVKIPI 429

Query: 469 RLHIRRVWTL 478
           +LHIRRVWTL
Sbjct: 430 KLHIRRVWTL 439

>Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement
          Length = 192

 Score =  186 bits (473), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 116/178 (65%), Gaps = 4/178 (2%)

Query: 39  DSLIHLNIQENHYFITRDQXXXXXXXXXXXXXXXGVFLDRCGQVITNLTRDDEVYIVNFP 98
           DSLIHLNIQENHY+ITRD                GVF+DR GQVITNLT DDEVYI NFP
Sbjct: 12  DSLIHLNIQENHYYITRDHLMSLPESLLLCLFPSGVFMDRMGQVITNLTSDDEVYIGNFP 71

Query: 99  PDCFEYIMEIYTKAHDDLYNHPVEKFFDRPSSSFVSNAKGFFGLXXXXXXXXXXEQDILH 158
           PDCFEYIME Y+ A +DL  +  ++ F++  +        FFG           E DILH
Sbjct: 72  PDCFEYIMETYSAAQEDLVKYTFDETFNKNPND--KEHGRFFGFSCSSAPSSSNEADILH 129

Query: 159 QKPAIIVLREDLDYYCVPQEEFQFDSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIF 216
           +KP+IIVLREDLDYYCV Q E  F S  EE  + LL H MA+VK+AAGSYL+++ SIF
Sbjct: 130 EKPSIIVLREDLDYYCVRQPEVTFAS--EEEKDTLLTHLMAEVKIAAGSYLSNQCSIF 185

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,593,986
Number of extensions: 520958
Number of successful extensions: 1113
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1094
Number of HSP's successfully gapped: 10
Length of query: 478
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 373
Effective length of database: 12,961,219
Effective search space: 4834534687
Effective search space used: 4834534687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)