Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR042W (CUE5)41140416540.0
Scas_699.454503486413e-79
CAGL0L09933g4083435722e-69
Kwal_55.215874643744568e-52
KLLA0F15994g4272974171e-46
ACR083C3753232978e-30
YDR273W (DON1)365541732e-13
CAGL0M08580g197591071e-05
Scas_615.8d581541031e-04
CAGL0C05093g70460691.8
AGR016W23833653.5
ADL349W41252655.0
YML097C (VPS9)45139646.3
Scas_626.847539647.1
YKL075C45038637.7
Kwal_56.2418465440638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR042W
         (404 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...   641   0.0  
Scas_699.45                                                           251   3e-79
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...   224   2e-69
Kwal_55.21587                                                         180   8e-52
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...   165   1e-46
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...   119   8e-30
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    71   2e-13
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    46   1e-05
Scas_615.8d                                                            44   1e-04
CAGL0C05093g complement(482106..484220) highly similar to sp|Q08...    31   1.8  
AGR016W [4326] [Homologous to NOHBY] complement(744233..744949) ...    30   3.5  
ADL349W [1391] [Homologous to ScYML097C (VPS9) - SH] complement(...    30   5.0  
YML097C (VPS9) [3874] chr13 complement(78335..79690) Protein inv...    29   6.3  
Scas_626.8                                                             29   7.1  
YKL075C (YKL075C) [3185] chr11 complement(292601..293953) Protei...    29   7.7  
Kwal_56.24184                                                          29   8.8  

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/404 (81%), Positives = 330/404 (81%)

Query: 1   MEEKEGIKDSSLLEKSNVPESINEDISKTTDVDLNSDGKKDNDTSAKDGTPKVEEKVNKS 60
           MEEKEGIKDSSLLEKSNVPESINEDISKTTDVDLNSDGKKDNDTSAKDGTPKVEEKVNKS
Sbjct: 1   MEEKEGIKDSSLLEKSNVPESINEDISKTTDVDLNSDGKKDNDTSAKDGTPKVEEKVNKS 60

Query: 61  SGIDEDEVVTXXXXXXXXXXXXXXXXXRRKSEEEPSKENPILQELKDAFPNLEEKYIKAV 120
           SGIDEDEVVT                 RRKSEEEPSKENPILQELKDAFPNLEEKYIKAV
Sbjct: 61  SGIDEDEVVTPAEDAKEEEEEHPPLPARRKSEEEPSKENPILQELKDAFPNLEEKYIKAV 120

Query: 121 IIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKNPEAPARRRQTQLEQDELLARQLD 180
           IIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKNPEAPARRRQTQLEQDELLARQLD
Sbjct: 121 IIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKNPEAPARRRQTQLEQDELLARQLD 180

Query: 181 EQFNXXXXXXXXXXXXXXXMHEQRRRRHNPNXXXXXXXXXXXXXXWSQFVEKDLPELTDR 240
           EQFN               MHEQRRRRHNPN              WSQFVEKDLPELTDR
Sbjct: 181 EQFNSSHSRRRNRDRATRSMHEQRRRRHNPNEREQHHEDSEEEDSWSQFVEKDLPELTDR 240

Query: 241 AGRSLQDTANKVSNWISDAYRRNFASXXXXXXXXXXXXXXXXWEPEIVDLSQGGKNSRPQ 300
           AGRSLQDTANKVSNWISDAYRRNFAS                WEPEIVDLSQGGKNSRPQ
Sbjct: 241 AGRSLQDTANKVSNWISDAYRRNFASGNEQNDNQHGHQDQQEWEPEIVDLSQGGKNSRPQ 300

Query: 301 QPERRRFNSFGVQVGDDSLESHGITLHNEDGFEDDEDVPPQLPTRTKSGESTGKVVAETT 360
           QPERRRFNSFGVQVGDDSLESHGITLHNEDGFEDDEDVPPQLPTRTKSGESTGKVVAETT
Sbjct: 301 QPERRRFNSFGVQVGDDSLESHGITLHNEDGFEDDEDVPPQLPTRTKSGESTGKVVAETT 360

Query: 361 YIDTPDTETKKKWQXXXXXXXXXXXXKVNAVSRNKKNPDEDEFL 404
           YIDTPDTETKKKWQ            KVNAVSRNKKNPDEDEFL
Sbjct: 361 YIDTPDTETKKKWQPLPPEPLDTTPTKVNAVSRNKKNPDEDEFL 404

>Scas_699.45
          Length = 450

 Score =  251 bits (641), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 160/348 (45%), Positives = 196/348 (56%), Gaps = 35/348 (10%)

Query: 88  RRKSEEEPSK-ENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKD 146
           RRK+E E  + ENPIL++LK+AFPN+EEKY+K V+IASQG L PAF ALLFLSDP S KD
Sbjct: 100 RRKTEPEAEESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKD 159

Query: 147 IELPTQPVRKN--PEAPARRRQTQLEQDELLARQLDEQFNXXXXXXXXXXXXXXXMHEQR 204
           IELPT+P+  N  P  P RR+ TQLEQD LLARQL+E++N                   +
Sbjct: 160 IELPTKPIAANATPALPQRRKLTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGRRTRPQ 219

Query: 205 RRRHNPNXXXXXXXXXXXXXXWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDAYRRNF 264
           ++R                  W+QFVEKDLP++T RA  SLQ+TA KV +W S    +N 
Sbjct: 220 QQRRQRTANDDDLDFSQEDDSWAQFVEKDLPDITARAKGSLQETAMKVGSWFS----KNV 275

Query: 265 ASXXXXXXXXXXXXXXXXWEPEIVD--LSQGGK--------NSRPQQPERRRFNSFGVQV 314
                                +  D  + Q  K           P+ PERRRFNSFG QV
Sbjct: 276 IGEEDPNQPQPQGMNNRNGNSDFTDEQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQV 335

Query: 315 GDDSLESHGITLH-NEDGFEDDEDVPPQLPTRTKSGEST---------------GKVVAE 358
           G+DSLESHGI LH NE+  ++DEDVPPQLPTR KS +S                 KVVA+
Sbjct: 336 GEDSLESHGIALHDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQ 395

Query: 359 TTYIDTPDTETKKKWQXXXXXXXXXXXXKVNAVSRNK-KNPDEDE-FL 404
           TT+IDTP+   K KWQ            K+NA  + K KNPDEDE FL
Sbjct: 396 TTFIDTPEGSAKPKWQPVAPEPLNGTPTKINASGQAKIKNPDEDEDFL 443

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score =  224 bits (572), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/343 (43%), Positives = 186/343 (54%), Gaps = 53/343 (15%)

Query: 98  ENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKN 157
           ENP+L +LK+AFPN+EE+Y+KAVIIASQG L PAFNALLFLSDPESGKDIELP +PV++N
Sbjct: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135

Query: 158 PEAPARRRQTQLEQDELLARQLDEQFNXXXXXXXXXXXXXXXMHEQRRRRHNPNXXXXXX 217
           P  P RR+QTQLEQDE+LARQLD+++N                    RR HN        
Sbjct: 136 PSLPPRRKQTQLEQDEMLARQLDKEYNRKRRGE--------------RRHHNEREAGRNY 181

Query: 218 XXXX----XXXXWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDAYRRNFASXXXXXXX 273
                       WSQFVEKDLPE+T RA  SLQ+TA KV  W  +  ++NF         
Sbjct: 182 ERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWF-NGVKKNFIGEGEENDS 240

Query: 274 XXXXXXXXXWEPE-----IVDLSQGGKNSRPQQP-----------ERRRFNSFGVQVGDD 317
                     + +      V+  +  +    Q P            R RFNSFG    DD
Sbjct: 241 AYYQDDSHGRDLDEDYGTYVEQQERRQRRGVQDPGYRRGDEQRLNARHRFNSFGASATDD 300

Query: 318 SLESHGITLH-NEDGFEDDEDVPPQLPTRTKSGESTG-------------KVVAETTYID 363
                GI+L   E G ++DE+VPPQLP+R +S +S               KVVAETTYID
Sbjct: 301 V--EGGISLRDEEFGEDEDEEVPPQLPSRARSNDSKKDSEEVKPQEGKKDKVVAETTYID 358

Query: 364 TPDT--ETKKKWQXXXXXXXXXXXXKVNAVSRNKKNPDEDEFL 404
           TP+   +TK+KWQ            KVNA ++  KN  EDEFL
Sbjct: 359 TPENKEKTKRKWQPLPPEPLNATPTKVNASTKKNKNESEDEFL 401

>Kwal_55.21587
          Length = 464

 Score =  180 bits (456), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 136/374 (36%), Positives = 184/374 (49%), Gaps = 76/374 (20%)

Query: 88  RRKSEEEPSKENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDI 147
           +RK+  +   ENPIL +L +AFP ++ KY+KAV+IASQG L PAFNALLFLSDP    + 
Sbjct: 103 KRKTSTQNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEA 162

Query: 148 ELPTQPVRKNPEAPARRRQT---QLEQDELLARQLDEQFNXXXXXXXX------------ 192
            +PT  V ++ ++   R  T   QL+QDE+LARQLD QFN                    
Sbjct: 163 TVPTA-VPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDERRARE 221

Query: 193 -------------XXXXXXXMHEQRRRRHNPNXXXXXXXXXXXXXXWSQFVEKDLPELTD 239
                               +  + +RR+                  SQ V+KDLPEL +
Sbjct: 222 RRIRERQREFERRTAHGAGPLSPEEQRRY----ERMEAEDQEDNDFLSQLVDKDLPELRE 277

Query: 240 RAGRSLQDTANKVSNWISDAYRRNFASXXXXXXXXXXXXXXXXWEPEIVDLSQGGKNSRP 299
           + GR +Q+T  KV++W+S  +R+N+A                   PE  D  Q  +    
Sbjct: 278 KVGRQVQETGRKVNDWLS-GFRKNWAQDQSSQQQSSQY-------PEFSDRQQSQRRDTS 329

Query: 300 Q------------QPERR--RFNSFGVQVGDDS------LESHGITLHN------EDGFE 333
                        +PE R  RFNSFG +VGDDS      L SHGI+L+N      ED  E
Sbjct: 330 SRRSSDSEFEDYTRPEHRTARFNSFGAKVGDDSTTSSAKLASHGISLYNKGDKDVED--E 387

Query: 334 DDEDVPPQLPTRTKSGESTGKVVAETTYIDTPDTETKKKWQXXXXXXXXXXXXKVNA-VS 392
            D D+ PQLP+R K+ +    +  ETTYIDTP+  T+KKWQ            KVNA  S
Sbjct: 388 SDADIAPQLPSRNKAKD----IQPETTYIDTPEAGTRKKWQPLPPEPINVTPSKVNATAS 443

Query: 393 RNKKNPD--EDEFL 404
           +NK+N D  +D+FL
Sbjct: 444 KNKRNSDVNDDDFL 457

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score =  165 bits (417), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 157/297 (52%), Gaps = 53/297 (17%)

Query: 92  EEEPSKENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPT 151
           EE+  KENP+L++LK+AFPN+EEKY+KAV+IASQG L PAFNALLF+SDP+  K+  LPT
Sbjct: 85  EEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPT 144

Query: 152 QPVRKNPEAPARRRQTQLEQDELLARQLDEQFNXXXXXXXXXXXXXXXMHEQR---RRRH 208
           +PV+       R  +TQLEQDE LARQLD++FN               + ++     RR+
Sbjct: 145 RPVQAPTRGVRREPKTQLEQDEELARQLDKKFNKHGNSASERTARERRIRQRERDYERRY 204

Query: 209 NPNXXXXXXXXXX----------XXXXWSQFVEKDLPELTDRAGRSLQDTANKVSNWISD 258
                                      +S FV+K+LP++ +   R++Q+T  K+S W S 
Sbjct: 205 GAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSG 264

Query: 259 AYRRNFASXXXXXXXXXXXXXXXXWEPEIVDLSQGGKNSRPQQPERRRFNSFGVQV---- 314
             +                         +VD       SRP+   + RFNSFG +     
Sbjct: 265 ITKN------------------------LVDDDPNYSESRPKY-SQSRFNSFGDRYRDGN 299

Query: 315 ----GDDSLESHGITLHN-EDGFEDDEDVPPQLPTRTKSGESTGKVVAETTYIDTPD 366
               G   L++ GI+LHN +  F  D+D+PPQLP+R K      KVVAETTYIDTP+
Sbjct: 300 DNVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAK------KVVAETTYIDTPE 350

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score =  119 bits (297), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 109/323 (33%), Positives = 149/323 (46%), Gaps = 67/323 (20%)

Query: 97  KENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIEL-PTQPVR 155
           KEN IL ELK AFPN+EEK +KAVIIASQG+L PAF+ALLFLSDP   ++  L       
Sbjct: 98  KENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAALPTQAAPA 157

Query: 156 KNPEAPARRRQTQLEQDELLARQLDEQFNXXXXXXXXXXXXXXXMHE----QRRRRHNPN 211
                P     +QL+QDE+LARQLDEQFN                      QR+++    
Sbjct: 158 AQATVPI----SQLQQDEMLARQLDEQFNKKDLRAERAARERRIREREEEFQRKQQR--- 210

Query: 212 XXXXXXXXXXXXXXWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDAYRRNFASXXXXX 271
                         +  +  +D  +  D   R LQ+T+ KV  W  D  ++NF       
Sbjct: 211 ----------LRSEYGGYGSEDDEDFIDVLNRGLQETSKKVGKWW-DGIKKNFN------ 253

Query: 272 XXXXXXXXXXXWEPEIVDLSQGGKNSRPQQPERRRFNSFGVQVGDDSL-----ESHGITL 326
                         E +D      ++ P +  ++RFNSFG +  DD       +  G++L
Sbjct: 254 --------------EELDGPDARASAGPPRARQQRFNSFGAR--DDETYPTEQQLRGVSL 297

Query: 327 HNEDGFEDDEDVPPQLPTRTKSGESTGKVVAETTYIDTPDTETKKKWQXXXXXXXXXXXX 386
           H+E    DDE  P   P RT    STG + A     D P+ E +K+WQ            
Sbjct: 298 HDE---HDDEPAPRLPPRRT----STGPLPARP---DGPNVE-RKRWQ-PLPPEPVSAPT 345

Query: 387 KVNAVSRN-----KKNPDEDEFL 404
           KV A  RN     K++PD+D++L
Sbjct: 346 KVTAGGRNHAQNKKRDPDQDDYL 368

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%)

Query: 101 ILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPV 154
           +L+ELK AFP +++  IKA++IASQGVL PAFN+LL+ S PE   D  LP +P+
Sbjct: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPI 139

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 42/59 (71%), Gaps = 5/59 (8%)

Query: 98  ENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRK 156
           +N   ++L  AFP +++  I+A+++A++G L+PAFNALL L    +G+DI+L   P+R+
Sbjct: 27  QNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSL----TGEDIQLGL-PMRR 80

>Scas_615.8d
          Length = 581

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 37/54 (68%)

Query: 104 ELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDPESGKDIELPTQPVRKN 157
           EL  AFP+++   IK+++ AS+G + PAF+ALLFL++ ++ + I +     +KN
Sbjct: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPKKN 339

>CAGL0C05093g complement(482106..484220) highly similar to sp|Q08225
           Saccharomyces cerevisiae YOL057w, hypothetical start
          Length = 704

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 303 ERRRFNSFGVQVGDDSLESHG---ITLHNEDGFEDDEDVPPQ------LPTRTKSGESTG 353
           E+ + +SF VQVG   L  HG   +    EDGF  D + PP       + T  K GE+ G
Sbjct: 439 EKYQSDSFEVQVGIHELLGHGSGKLLCQIEDGFNFDIENPPTGLDGKPVSTYYKLGETWG 498

>AGR016W [4326] [Homologous to NOHBY] complement(744233..744949)
           [717 bp, 238 aa]
          Length = 238

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 321 SHGITLHNEDGFEDDEDVPPQLPTRTKSGESTG 353
            H +T+  ED +  DED P QL      GESTG
Sbjct: 169 CHSLTIFVEDTWSGDEDEPTQLCYLELRGESTG 201

>ADL349W [1391] [Homologous to ScYML097C (VPS9) - SH]
           complement(91800..93038) [1239 bp, 412 aa]
          Length = 412

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 89  RKSEEEPSKENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSD 140
           RK E +  +E  +LQ L+  FP+L+   I  V IA++  +    ++LL +SD
Sbjct: 363 RKLEHQEHRE--MLQNLQGMFPDLDPGLIHDVCIATRYRMGACVDSLLSISD 412

>YML097C (VPS9) [3874] chr13 complement(78335..79690) Protein
           involved in vacuolar sorting [1356 bp, 451 aa]
          Length = 451

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 102 LQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSD 140
           L  L++ FP+++   I+ V IA +  + P  +ALL LS+
Sbjct: 413 LNTLQNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE 451

>Scas_626.8
          Length = 475

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 102 LQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSD 140
           L  L+  FP ++++ I+ V IA +  + P  + LL LSD
Sbjct: 437 LDTLQSMFPGMDKELIEDVCIAKKYRIGPCVDILLTLSD 475

>YKL075C (YKL075C) [3185] chr11 complement(292601..293953) Protein
           of unknown function [1353 bp, 450 aa]
          Length = 450

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 1   MEEKEGIKDSSLLEK--SNVPESINEDISKTTDVDLNS 36
           + EK G+K S  +EK    +   IN D+SK TD  +NS
Sbjct: 79  LNEKYGLKKSHYIEKFIKCIHRKINIDVSKITDAYVNS 116

>Kwal_56.24184
          Length = 654

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 5/40 (12%)

Query: 301 QPERRRFNSFGVQVGDDSLESHGITL---HNEDGFEDDED 337
           +P R R  +  +Q+G D +E HG+      +EDG+++D++
Sbjct: 401 KPSRHR--NIDIQIGSDHIEPHGLNFDSSEDEDGYQEDDE 438

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.127    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,550,170
Number of extensions: 538342
Number of successful extensions: 1640
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1609
Number of HSP's successfully gapped: 52
Length of query: 404
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 300
Effective length of database: 12,995,837
Effective search space: 3898751100
Effective search space used: 3898751100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 63 (28.9 bits)