Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR040W (GLO4)28528115290.0
Scas_699.442822789941e-136
Sklu_1159.12822749841e-135
Kwal_55.215822842759531e-130
KLLA0F16016g2832789191e-125
CAGL0I00924g2742719141e-124
YDR272W (GLO2)2742719101e-124
ACR084C2932809041e-123
ADL298C1476104710.68
CAGL0D05852g86458644.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR040W
         (281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   593   0.0  
Scas_699.44                                                           387   e-136
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            383   e-135
Kwal_55.21582                                                         371   e-130
KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   358   e-125
CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   356   e-124
YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   355   e-124
ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   352   e-123
ADL298C [1443] [Homologous to ScYBL034C (STU1) - SH] (174376..17...    32   0.68 
CAGL0D05852g complement(554761..557355) similar to tr|Q07895 Sac...    29   4.1  

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MKFLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKK 60
           MKFLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKK
Sbjct: 1   MKFLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKK 60

Query: 61  SIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGN 120
           SIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGN
Sbjct: 61  SIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGN 120

Query: 121 LRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIM 180
           LRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIM
Sbjct: 121 LRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIM 180

Query: 181 LRAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFT 240
           LRAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFT
Sbjct: 181 LRAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFT 240

Query: 241 LRDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           LRDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL
Sbjct: 241 LRDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281

>Scas_699.44
          Length = 282

 Score =  387 bits (994), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 175/278 (62%), Positives = 219/278 (78%)

Query: 4   LLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSID 63
           +L+Q+  M+VKPIKMRW TGGVNYSYLLS++D+ +SWLIDPAE  EV P L  +E+ +I 
Sbjct: 1   MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR 60

Query: 64  AIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRV 123
           AIVNTHHHYDHS GN+++ + L Q+ + H +KII GSKSSPGV+E+P +LQ+Y LGNL V
Sbjct: 61  AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEV 120

Query: 124 TCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRA 183
            C+RTPCHT+DSICYY+KD +T EQC+FTGDTLF  GCGRFFEG G++MD ALN+ +L  
Sbjct: 121 VCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEG 180

Query: 184 VGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRD 243
           VGE NWN  ++YPGHEYTK NV FIR  +Y ++G N+  D LE++CKS+E TTG FTL D
Sbjct: 181 VGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDD 240

Query: 244 ELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           EL +NPFMRLDD  VR AVGD    + RS VM+ LRK+
Sbjct: 241 ELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKM 278

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  383 bits (984), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 174/274 (63%), Positives = 217/274 (79%), Gaps = 1/274 (0%)

Query: 8   IRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIVN 67
           IR+MHVK IKMRWLTGGVNYSYLLST+D+  SWLIDPAEPLEV PKL+ +E  SI+A+VN
Sbjct: 6   IRSMHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSIEAVVN 65

Query: 68  THHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIR 127
           THHHYDHSGGN+ + + L ++   + + +I GS +SPG TEVP +LQ+Y LG+L V CIR
Sbjct: 66  THHHYDHSGGNIPVIAAL-KKAGQNAVSVICGSHTSPGATEVPQDLQKYKLGDLEVLCIR 124

Query: 128 TPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGET 187
           TPCHT+DS+CY++KD +TGE+CIFTGDTLF AGCGRFFEGTG +MD ALN+ +L   GE 
Sbjct: 125 TPCHTQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEHTGEE 184

Query: 188 NWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELGY 247
           NW+  K+YPGHEYTK NV F+RA IY   G+NK FD LE +C  NE TTG FTL+DEL +
Sbjct: 185 NWSTTKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLKDELDF 244

Query: 248 NPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           NPFMRL+   VR +VGD  G +P++ VM +LR++
Sbjct: 245 NPFMRLNCPMVRKSVGDAQGAWPKARVMDKLRQM 278

>Kwal_55.21582
          Length = 284

 Score =  371 bits (953), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 207/275 (75%), Gaps = 1/275 (0%)

Query: 7   QIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIV 66
           Q R+MHVK IKMRWLTGGVNY YLLST+D+  SWLIDPAEPLEV   L AEE  ++ A+V
Sbjct: 7   QTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVV 66

Query: 67  NTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCI 126
           NTHHHYDHSGGN A+   L +    H + +I GS +SPG T++P NLQ+Y LG+L++ CI
Sbjct: 67  NTHHHYDHSGGNSAIVGELRKMGVSH-LDVICGSNTSPGATKIPKNLQEYSLGDLKIKCI 125

Query: 127 RTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGE 186
           RTPCHT+DS+CYY+ D  TGE+CIFTGDTLF AGCGRFFEGTG +MD+ALN+ +L  VGE
Sbjct: 126 RTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE 185

Query: 187 TNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELG 246
            NW+  K+YPGHEYTK NV F+R  +Y   G+N   D LE  C  ++ TTG FT+ DEL 
Sbjct: 186 PNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELA 245

Query: 247 YNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           YNPFMRLDD  VR A+ D+ G+  R+ VM +LRK+
Sbjct: 246 YNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKM 280

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  358 bits (919), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/278 (60%), Positives = 209/278 (75%), Gaps = 4/278 (1%)

Query: 6   QQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAI 65
           Q IR MHVK IKMRWLTGGVNYSYLLST+D++ SWLIDPAE LEV   L ++E KSI+A+
Sbjct: 4   QSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEAL 63

Query: 66  VNTHHHYDHSGGNLALYSILCQENSGHDI-KIIGGSKSSPGVTEVPDNLQQYHLGNLRVT 124
           VNTHHHYDH+GGN++  + L ++  G++I ++I GS+ SP   ++PDNL +Y LGNL++ 
Sbjct: 64  VNTHHHYDHAGGNVSTLAALNEK--GNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKIL 121

Query: 125 CIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAV 184
           CIRTPCHT+DS CYY++D ET EQ IFTGDTLF  GCGRFFEGT  +MD ALN  +L   
Sbjct: 122 CIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNT 181

Query: 185 GET-NWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRD 243
           G+T NW  VK+YPGHEYT GNVSFIR  IY     N  F+ LE + K +E TTGHFT+ D
Sbjct: 182 GDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIAD 241

Query: 244 ELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           EL +NPFMRLDD  VR  VGD+ G + R+ VM +LR +
Sbjct: 242 ELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  356 bits (914), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 163/271 (60%), Positives = 204/271 (75%), Gaps = 1/271 (0%)

Query: 11  MHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIVNTHH 70
           MHVKPIKMRW TGGVNYSYL+S +D+  SWLIDPAEP EV P+LS  E++S+ A+VNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 71  HYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPC 130
           HYDH+GGN +L     +E  G  +++IGGS+    VT +P + Q+  +GNL VTCIRTPC
Sbjct: 61  HYDHAGGNTSLLKQF-KETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPC 119

Query: 131 HTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGETNWN 190
           HT+DS+CYYI+D ET E+CIFTGDTLF AGCGRFFEGTG +MD ALN+ +L  VG+ NW+
Sbjct: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179

Query: 191 KVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELGYNPF 250
              +YPGHEYTK NV F+R+KIY     N  FD LE++C  +E TTG FTL DEL +NPF
Sbjct: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239

Query: 251 MRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           M+LDD  VR AVGD+   +  + VM +LRK+
Sbjct: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  355 bits (910), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 159/271 (58%), Positives = 204/271 (75%), Gaps = 1/271 (0%)

Query: 11  MHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIVNTHH 70
           M VK IKMRW +GGVNY YLLS    + SWLIDPAEP EV P+L+ +EK S++AIVNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 71  HYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPC 130
           HYDH+ GN  +   L ++N    +++IGGSK  P VT +P+NL++ HLG+L +TCIRTPC
Sbjct: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120

Query: 131 HTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGETNWN 190
           HT+DSICYY+KD  T E+CIFTGDTLF AGCGRFFEGTG +MD+ALN  +L  VG  NW+
Sbjct: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180

Query: 191 KVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELGYNPF 250
           K ++YPGHEYT  NV F+R KIY  +G+NK  D LEQ+C  +E T G FTL+DE+ +NPF
Sbjct: 181 KTRVYPGHEYTSDNVKFVR-KIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239

Query: 251 MRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           MRL+D  V+ A GDT  ++ R+ +M +LR +
Sbjct: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  352 bits (904), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 167/280 (59%), Positives = 210/280 (75%), Gaps = 5/280 (1%)

Query: 3   FLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSI 62
           F+ +Q+R MHVK IKMRWLTGGVNYSYL+ST+D++ SWLIDPAE LEV P LS +EK+SI
Sbjct: 14  FMYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSI 73

Query: 63  DAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGN-L 121
            AIVNTHHHYDH+GGNLA+ + L +E  G  + +I GS +SP  T++P++LQ+Y LG+ +
Sbjct: 74  RAIVNTHHHYDHAGGNLAIRAALKRE--GVAVPVIAGSTTSPVSTDIPEHLQKYTLGDSV 131

Query: 122 RVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIML 181
            V CIRTPCHT+DSICY+++D +TG+Q +FTGDTLF AGCGRFFEGT  +MD ALN  +L
Sbjct: 132 EVLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLL 191

Query: 182 RAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTL 241
             V   +    K+YPGHEYTKGNV FIR+ IY   G N  FD LE +  +N  TTG FTL
Sbjct: 192 EHV--QDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTL 249

Query: 242 RDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281
           +DE  YNPFMRLDD  +R  VGD   T+ R+ VM +LR +
Sbjct: 250 QDETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRSM 289

>ADL298C [1443] [Homologous to ScYBL034C (STU1) - SH]
           (174376..178806) [4431 bp, 1476 aa]
          Length = 1476

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 40/104 (38%), Gaps = 25/104 (24%)

Query: 105 GVTEVPDN--LQQYHLGNLRVTCIRT-----PCHTKDSICYYIK--------------DL 143
            + ++P N  L ++   +L  T I +     P H      YY+K              DL
Sbjct: 728 AINDLPTNVLLDEFSSTDLLETVIHSFQTFFPDHHDQLFLYYVKYRSVIFNYCFGIMIDL 787

Query: 144 ETGEQCIFTGDTLFIAGCGRFFEGTGRDMDM----ALNQIMLRA 183
            +G+     G TLF   C R  E  G D +M     L  I+ RA
Sbjct: 788 LSGDFAFSEGSTLFREVCTRIIEACGNDFNMEKYYTLISILYRA 831

>CAGL0D05852g complement(554761..557355) similar to tr|Q07895
           Saccharomyces cerevisiae YLR001c, hypothetical start
          Length = 864

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 176 LNQIMLRAVGETNWNKVKIYPGHEYTKGNVSFIRA-----KIYSDIGQNKEFDALEQY 228
           LN  M+R    +N N+VKI    E TKGN+ + R      + +S +    EF+A E+Y
Sbjct: 267 LNNKMIRVDSISNGNQVKINDTIESTKGNLLYNRGVSHIFRDFSGLNSTVEFNA-EKY 323

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,659,432
Number of extensions: 419416
Number of successful extensions: 968
Number of sequences better than 10.0: 13
Number of HSP's gapped: 959
Number of HSP's successfully gapped: 13
Length of query: 281
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 181
Effective length of database: 13,134,309
Effective search space: 2377309929
Effective search space used: 2377309929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)