Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR039W (CKB2)25825412890.0
CAGL0I00946g25924410841e-151
Sklu_1979.227324110391e-144
ACR087C25724310191e-141
Scas_699.4325622210041e-139
KLLA0E21967g2602229941e-137
Kwal_55.215702412179791e-135
KLLA0A04818g2772054542e-55
Kwal_47.174492502604296e-52
CAGL0A00275g2662164281e-51
Sklu_1768.43292074294e-51
Scas_638.72702214169e-50
YGL019W (CKB1)2782234108e-49
AGR163W2752234039e-48
ADR249W625155760.12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR039W
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   501   0.0  
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   422   e-151
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        404   e-144
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   397   e-141
Scas_699.43                                                           391   e-139
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   387   e-137
Kwal_55.21570                                                         381   e-135
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   179   2e-55
Kwal_47.17449                                                         169   6e-52
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   169   1e-51
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        169   4e-51
Scas_638.7                                                            164   9e-50
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   162   8e-49
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   159   9e-48
ADR249W [1990] [Homologous to ScYMR136W (GAT2) - SH] complement(...    34   0.12 

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  501 bits (1289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/254 (95%), Positives = 242/254 (95%)

Query: 1   MGSRSENVGTVTREGSRVEQXXXXXXXXXXXXEYVDMWIDLFLGRKGHEYFCDVDPEYIT 60
           MGSRSENVGTVTREGSRVEQ            EYVDMWIDLFLGRKGHEYFCDVDPEYIT
Sbjct: 1   MGSRSENVGTVTREGSRVEQDDVLMDDDSDSSEYVDMWIDLFLGRKGHEYFCDVDPEYIT 60

Query: 61  DRFNLMNLQKTVSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIIT 120
           DRFNLMNLQKTVSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIIT
Sbjct: 61  DRFNLMNLQKTVSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIIT 120

Query: 121 IKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSR 180
           IKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSR
Sbjct: 121 IKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSR 180

Query: 181 HSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLV 240
           HSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLV
Sbjct: 181 HSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLV 240

Query: 241 EKLESKDVDLTKSG 254
           EKLESKDVDLTKSG
Sbjct: 241 EKLESKDVDLTKSG 254

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  422 bits (1084), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 216/244 (88%)

Query: 11  VTREGSRVEQXXXXXXXXXXXXEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQK 70
           ++   SRVE             EY  MWIDLFLGRKGHEYFCDVDPEYITDRFNL+NLQK
Sbjct: 12  MSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQK 71

Query: 71  TVSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAK 130
           TVSKFS VVQYIVD+LDDSI+ENM+ ARLEQLE+D+RK YGLIHARYIIT+KGLQKM +K
Sbjct: 72  TVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSK 131

Query: 131 YKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFG 190
           YK+ADFGRC RVYCN Q LLPVGLHD+PGID VKLYCPSCEDLY PKSSRHSSIDGAYFG
Sbjct: 132 YKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFG 191

Query: 191 TSFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDL 250
           TSFPGMFLQAFPDMVPKHPT RYVPKIFGFELHKQAQLTRWQELQRLKLV++L++K+VDL
Sbjct: 192 TSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRLQAKEVDL 251

Query: 251 TKSG 254
           +KSG
Sbjct: 252 SKSG 255

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  404 bits (1039), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 186/241 (77%), Positives = 213/241 (88%), Gaps = 3/241 (1%)

Query: 14  EGSRVEQXXXXXXXXXXXXEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVS 73
           +G+RV++            EYV+ WIDLFLGRKGHEYFCDVD +YITDRFNL+NLQKTVS
Sbjct: 32  QGTRVDEANHDTTDSS---EYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVS 88

Query: 74  KFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKE 133
           +F+ V+QYIVD+LDD+ LE M+ +RLEQLESD+RKLYGLIHARYIIT+KGLQKM  KY++
Sbjct: 89  RFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQKMLQKYRD 148

Query: 134 ADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 193
           ADFGRCPRVYCN Q LLPVGLHD+PGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF
Sbjct: 149 ADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 208

Query: 194 PGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLTKS 253
           PGMFLQAFP+MVPKHP KRYVP+IFGFELHKQAQL RWQELQRLKL  +L+ + V+L+K+
Sbjct: 209 PGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDKEGVELSKN 268

Query: 254 G 254
           G
Sbjct: 269 G 269

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  397 bits (1019), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 184/243 (75%), Positives = 209/243 (86%)

Query: 12  TREGSRVEQXXXXXXXXXXXXEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKT 71
           T E + VE             +YV++WIDLFLG+KGHEYFCDVD EYITDRFNL+NLQKT
Sbjct: 11  TAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKT 70

Query: 72  VSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKY 131
           VSKF+ V+QY+VD+LDD+ LE M+  +L QLE+D+RKLYGLIHARYIITIKGLQKM  KY
Sbjct: 71  VSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKMLQKY 130

Query: 132 KEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT 191
           ++ADF RCPRV+CN Q LLPVGLHD+PGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT
Sbjct: 131 RDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGT 190

Query: 192 SFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLT 251
           SFPGMFLQAFP++VPKHPTKRYVPK+FGF+LHKQAQL RWQELQRLKL  +L  K VDLT
Sbjct: 191 SFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRLKLERELIKKGVDLT 250

Query: 252 KSG 254
           K+G
Sbjct: 251 KNG 253

>Scas_699.43
          Length = 256

 Score =  391 bits (1004), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/222 (83%), Positives = 206/222 (92%)

Query: 33  EYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILE 92
           EYVD WIDLFLG+KGHEYFCD+DP+YITDRFNL+NLQKTVSKFS VVQYIVD+LD+SILE
Sbjct: 31  EYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVDELDESILE 90

Query: 93  NMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPV 152
            M++ARLEQLE+D+RK YGLIHARYIIT+KGLQKM  K+K+ADFGRCPRVYCN Q LLPV
Sbjct: 91  TMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPRVYCNYQPLLPV 150

Query: 153 GLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKR 212
           GLHD PG+DCVKLYC SCEDLYIPKS RHS IDGA+FGTSFPGMFLQAFP+MVPKHPTK+
Sbjct: 151 GLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAFPEMVPKHPTKK 210

Query: 213 YVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLTKSG 254
           YVPKIFGFELHKQAQL RWQE QRLKL +KL++ DVDLTK+G
Sbjct: 211 YVPKIFGFELHKQAQLARWQEFQRLKLEKKLKTLDVDLTKNG 252

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  387 bits (994), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 179/222 (80%), Positives = 202/222 (90%)

Query: 33  EYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILE 92
           EYV+ WIDLFLG+KGHEYFCD+D EYITDRFNL+NLQKTVSKF+ VVQY+VDDL++ I+E
Sbjct: 35  EYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIE 94

Query: 93  NMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPV 152
           +M+ ARLEQLE+D+RKLYGLIHARYIIT KGLQKM  KYK ADFGRCPR +CN Q LLPV
Sbjct: 95  SMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPV 154

Query: 153 GLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKR 212
           GLHDIPGIDCVKLYCPSCEDLY PKSSRHS+IDGAYFGTSFPGMFLQ FP+M PKHPTKR
Sbjct: 155 GLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKR 214

Query: 213 YVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLTKSG 254
           YVPK+FGF+LHKQAQLTRWQELQRLKL + L +K ++L +SG
Sbjct: 215 YVPKVFGFDLHKQAQLTRWQELQRLKLEKLLITKGINLNESG 256

>Kwal_55.21570
          Length = 241

 Score =  381 bits (979), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 193/217 (88%)

Query: 33  EYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILE 92
           EY + WIDLFLGRKGHEYFCD+D EYITDRFNL+NLQK+V+KF+ V+QY+VD+LDD ILE
Sbjct: 21  EYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVDELDDGILE 80

Query: 93  NMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPV 152
            M+  RLEQLE D+RKLYGLIHARY+ITIKGLQKM  KYKEADFGRCPRVYCN Q LLPV
Sbjct: 81  QMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPV 140

Query: 153 GLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKR 212
           GLHD+PG DCVKLYC  CEDLYIPKSSRHS+IDGAYFGTSFPGMFLQAFP+MVPKHP KR
Sbjct: 141 GLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEMVPKHPVKR 200

Query: 213 YVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVD 249
           YVPKIFGFELHKQAQ+ RWQELQR+KL   L  + +D
Sbjct: 201 YVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  179 bits (454), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 121/205 (59%), Gaps = 16/205 (7%)

Query: 38  WIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD------------- 84
           WI  F  R GHEYFC V  ++I D FNL  L + V+ +   +  I+D             
Sbjct: 19  WIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTILDLESTSDEEEEKND 78

Query: 85  DLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYC 144
              +S  +N  H     +E  + +LYGLIHAR+I+T  GLQ M  K+   +FG CPR +C
Sbjct: 79  ASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMAEKFDRKEFGTCPRYHC 138

Query: 145 NLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAF--- 201
              QLLP GL D  G   V+LYCPSC+DLYIP+SSRH S++GAY+GTSFPG+FL+ F   
Sbjct: 139 GSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAYWGTSFPGVFLKHFKEL 198

Query: 202 PDMVPKHPTKRYVPKIFGFELHKQA 226
            D V K   + Y  KIFGF + K+A
Sbjct: 199 EDYVEKKNKETYELKIFGFSIAKEA 223

>Kwal_47.17449
          Length = 250

 Score =  169 bits (429), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 136/260 (52%), Gaps = 41/260 (15%)

Query: 5   SENVGTVTREGSRVEQXXXXXXXXXXXXEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFN 64
           SE VG  +R GS  E                D WI  F  R GHEYFC V  E+I D FN
Sbjct: 2   SEYVGDNSRSGSSDESGT------------FDEWIPSFCARFGHEYFCQVPTEFIEDDFN 49

Query: 65  LMNLQKTVSKFSYVVQYIVDDLDDSILENMTHARLEQ---------LESDSRKLYGLIHA 115
           +  L + V  +   +  ++D      LE M+    +          +E  + +LYGL+HA
Sbjct: 50  MTGLGQEVPHYRKALDLVLD------LEAMSDEEGQDSEEPVSRSIVEHAAEQLYGLVHA 103

Query: 116 RYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYI 175
           RYI+T  GLQ M  K+   +FG CPR YC   Q+LP GL D  G   V+LYCPSC+DLY+
Sbjct: 104 RYILTKPGLQAMAEKFDHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYL 163

Query: 176 PKSSRHSSIDGAYFGTSFPGMFLQAF---PDMVPKHPTKRYVPKIFGFELHKQA---QLT 229
           P+SSRH  ++GA++GTSFPG+FL+ F    D V +     Y  ++FGF +  +A      
Sbjct: 164 PQSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARM 223

Query: 230 RW--------QELQRLKLVE 241
           RW        QEL+ L+  E
Sbjct: 224 RWLRQHPKTPQELRELQECE 243

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  169 bits (428), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 126/216 (58%), Gaps = 25/216 (11%)

Query: 36  DMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD--------DLD 87
           D WI  F  R GHEYFC V  ++I D FN+ +L + V  +   +  I+D        D+D
Sbjct: 18  DEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDLILDLEMVSDEEDMD 77

Query: 88  D--SILENMTHARLEQ------------LESDSRKLYGLIHARYIITIKGLQKMYAKYKE 133
           +  S  E+ + A                +   + +LYGLIHARYI+T  GLQ M  K+  
Sbjct: 78  EKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHARYILTKPGLQAMAEKFDH 137

Query: 134 ADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 193
            DFG CPR +C+  QLLP GL D  G   V+LYCPSC+DLY+P+SSRH  ++GAY+GTSF
Sbjct: 138 KDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSSRHLCLEGAYWGTSF 197

Query: 194 PGMFLQAFPDM---VPKHPTKRYVPKIFGFELHKQA 226
           PG+FL+ F ++   V +   + Y  K+FGF ++ QA
Sbjct: 198 PGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  169 bits (429), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 89/207 (42%), Positives = 121/207 (58%), Gaps = 16/207 (7%)

Query: 36  DMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD--DLDDSILEN 93
           D WI  F  R GHEYFC V  E+I D FN+  L + +  +   +  I+D   + D   E+
Sbjct: 90  DEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKALDLILDLEAMSDEDDED 149

Query: 94  MTHARLEQ-----------LESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRV 142
                 E+           +E  + +LYGLIHARYI+T  GLQ M  K+   +FG CPR 
Sbjct: 150 DNDGAAEEDGSGEPVNRSIMEHAAEQLYGLIHARYILTKPGLQSMAEKFDHKEFGTCPRY 209

Query: 143 YCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFP 202
           YC   Q+LP GL D  G   V+LYCPSC+DLY+P+SSRH  +DGA++GTSFPG+FL+ F 
Sbjct: 210 YCGGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGVFLKHFK 269

Query: 203 ---DMVPKHPTKRYVPKIFGFELHKQA 226
              D V +     Y  K+FGF+++ +A
Sbjct: 270 ELEDYVERKSKDVYELKVFGFKINGEA 296

>Scas_638.7
          Length = 270

 Score =  164 bits (416), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 88/221 (39%), Positives = 122/221 (55%), Gaps = 27/221 (12%)

Query: 38  WIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD------------- 84
           WI  F  R GHEYFC+V  E+I D FNL +L + V  +   +  I+D             
Sbjct: 25  WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKALDLILDLEAISEEEEEEDE 84

Query: 85  --------DLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADF 136
                     D+ + +         +E  + +LYGLIHARYI+T  GLQ M  K+   +F
Sbjct: 85  DMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMAEKFDHKEF 144

Query: 137 GRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGM 196
           G CPR +C   QLLP GL D  G   V+LYCPSC+DLY+P+SSR   ++GA++GTSFPG+
Sbjct: 145 GTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGV 204

Query: 197 FLQAF---PDMVPKHPTKRYVPKIFGFELHKQA---QLTRW 231
           FL+ F    D V +     Y  K+FGF+++ +A   Q  +W
Sbjct: 205 FLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  162 bits (410), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 125/223 (56%), Gaps = 32/223 (14%)

Query: 36  DMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD----------- 84
           D WI  F  R GHEYFC V  E+I D FN+ +L + V  +   +  I+D           
Sbjct: 24  DEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLEAMSDEEEDE 83

Query: 85  -------DLDDSILENMTHARLEQ-----------LESDSRKLYGLIHARYIITIKGLQK 126
                  ++D  +  N  H   ++           +E  + +LYGLIHAR+I+T  GLQ 
Sbjct: 84  DDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQA 143

Query: 127 MYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDG 186
           M  K+   +FG CPR YCN  QLLP GL D  G   V+LYCPSC+DLY+P+SSR   ++G
Sbjct: 144 MAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEG 203

Query: 187 AYFGTSFPGMFLQAFPDM---VPKHPTKRYVPKIFGFELHKQA 226
           A++GTSFPG+FL+ F ++   V +   + Y  K+FGF ++ +A
Sbjct: 204 AFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  159 bits (403), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 118/223 (52%), Gaps = 32/223 (14%)

Query: 36  DMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVD----------- 84
           D WI  F  R GHE+FC V  E+I D FNL  L   V  +   +  I+D           
Sbjct: 17  DEWITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLILDLESLSEEDEDG 76

Query: 85  -------------DLDDSILENMTHARLEQLESD-----SRKLYGLIHARYIITIKGLQK 126
                          + + +    HA  + +        + +LYGLIHARYI+T +GLQ 
Sbjct: 77  VAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLIHARYILTKQGLQA 136

Query: 127 MYAKYKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDG 186
           M  K+   +FG CPR YC   QLLP GL D  G + V+LYC SC+DLY+P SSRH  ++G
Sbjct: 137 MAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDLYLPHSSRHLCLEG 196

Query: 187 AYFGTSFPGMFLQAF---PDMVPKHPTKRYVPKIFGFELHKQA 226
           A++GTSFPG+FL+ F    D V +     Y  +IFGF + K++
Sbjct: 197 AFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKES 239

>ADR249W [1990] [Homologous to ScYMR136W (GAT2) - SH]
           complement(1135917..1137794) [1878 bp, 625 aa]
          Length = 625

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 74/155 (47%), Gaps = 15/155 (9%)

Query: 52  CDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSIL-ENMTHARLEQLESDSRKLY 110
            + +P+Y+     ++ L+ ++  F  ++++ + +   S L +++  + L+QL ++SRKL 
Sbjct: 193 TNENPQYLELIAQILVLKNSM--FRNMIRWPIGETGSSALIDSIPKSELQQLLAESRKLT 250

Query: 111 GLIHARYIITIKGLQKMYAKYKEADFG-----RCPRVYCNLQQLLPVGLHDIPGIDCVKL 165
            +   R ++ +K  ++     ++ + G     R P    NLQ +LP GL  +  ++    
Sbjct: 251 TVT--RDLLHLKTKREPQGSEQQDENGQKREVRSPEEKKNLQTVLP-GLSQVTKLEAKGS 307

Query: 166 YCPSCEDLYIPKSSRHSSI----DGAYFGTSFPGM 196
             P  + L +P  S  + +    DG +    FP +
Sbjct: 308 ALPPIQRLPMPPPSSTARVAPQWDGDFRQFRFPSV 342

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,108,898
Number of extensions: 348538
Number of successful extensions: 861
Number of sequences better than 10.0: 16
Number of HSP's gapped: 852
Number of HSP's successfully gapped: 17
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)