Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR038C (HIR2)87586045870.0
Scas_699.4288589322650.0
Sklu_1979.384787322180.0
Kwal_55.2156687387320160.0
ACR088W85087319980.0
KLLA0E21945g84787118140.0
CAGL0I00968g99747713601e-173
Scas_702.168162762062e-16
KLLA0A04928g8613932028e-16
AGR168W8253042001e-15
Kwal_47.174658004201841e-13
YBL008W (HIR1)8404221831e-13
CAGL0E02805g8403971803e-13
Kwal_27.103855363331606e-11
KLLA0E11143g4932941364e-08
YML102W (CAC2)4682021008e-04
Scas_512.35342571008e-04
Scas_657.1341163930.006
KLLA0E04741g45985860.042
Sklu_2167.5303107810.11
KLLA0A01650g401122780.29
Scas_720.95515196790.30
AEL250C41762770.38
AFR092W1423101780.42
Sklu_2173.251566770.53
YBR195C (MSI1)422113750.69
CAGL0G09845g50064750.72
CAGL0G03333g186101730.74
KLLA0C08547g51539750.77
Sklu_2364.455559750.77
YCR072C515195740.95
CAGL0H03509g12293691.1
CAGL0L11154g1728130741.2
CAGL0D05588g477121731.2
AER280C510236731.4
CAGL0J03476g51739731.4
Scas_557.6373101721.5
Scas_720.22*12293681.7
Kwal_47.1782752360721.9
KLLA0C16643g30268712.0
YGL070C (RPB9)12293672.2
Kwal_56.2459629468702.5
CAGL0J06512g54576712.7
AEL269C45577702.8
Scas_684.751160703.3
YCL064C (CHA1)360163693.5
ACR199C29568693.5
CAGL0F07337g62169694.2
CAGL0A00605g64059694.2
CAGL0M05291g41956694.4
Scas_661.1947891694.6
Kwal_27.11079613119694.7
Sklu_1880.347151685.4
KLLA0F19096g2923146686.0
AFL014C55745686.1
CAGL0M08646g33768676.7
Kwal_27.1207041860676.8
Sklu_1645.258778677.7
YOL034W (SMC5)109374678.7
KLLA0F27511g623137668.8
Kwal_23.629095883669.4
Scas_610.5138684669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR038C
         (860 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...  1771   0.0  
Scas_699.42                                                           877   0.0  
Sklu_1979.3 YOR038C, Contig c1979 4836-7379                           858   0.0  
Kwal_55.21566                                                         781   0.0  
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...   774   0.0  
KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...   703   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...   528   e-173
Scas_702.16                                                            84   2e-16
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    82   8e-16
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    82   1e-15
Kwal_47.17465                                                          75   1e-13
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    75   1e-13
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    74   3e-13
Kwal_27.10385                                                          66   6e-11
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    57   4e-08
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    43   8e-04
Scas_512.3                                                             43   8e-04
Scas_657.13                                                            40   0.006
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    38   0.042
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            36   0.11 
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    35   0.29 
Scas_720.95                                                            35   0.30 
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    34   0.38 
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    35   0.42 
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            34   0.53 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    33   0.69 
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    33   0.72 
CAGL0G03333g 319139..319699 weakly similar to sp|P40063 Saccharo...    33   0.74 
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    33   0.77 
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         33   0.77 
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    33   0.95 
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    31   1.1  
CAGL0L11154g 1184758..1189944 similar to sp|Q04958 Saccharomyces...    33   1.2  
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    33   1.2  
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    33   1.4  
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    33   1.4  
Scas_557.6                                                             32   1.5  
Scas_720.22*                                                           31   1.7  
Kwal_47.17827                                                          32   1.9  
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    32   2.0  
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    30   2.2  
Kwal_56.24596                                                          32   2.5  
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    32   2.7  
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    32   2.8  
Scas_684.7                                                             32   3.3  
YCL064C (CHA1) [484] chr3 complement(15798..16880) L-serine/L-th...    31   3.5  
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    31   3.5  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    31   4.2  
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    31   4.2  
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    31   4.4  
Scas_661.19                                                            31   4.6  
Kwal_27.11079                                                          31   4.7  
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            31   5.4  
KLLA0F19096g complement(1762215..1770986) weakly similar to sgd|...    31   6.0  
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    31   6.1  
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    30   6.7  
Kwal_27.12070                                                          30   6.8  
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          30   7.7  
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    30   8.7  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    30   8.8  
Kwal_23.6290                                                           30   9.4  
Scas_610.5                                                             30   9.8  

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score = 1771 bits (4587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 860/860 (100%), Positives = 860/860 (100%)

Query: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60
           MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS
Sbjct: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60

Query: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP 120
           FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP
Sbjct: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP 120

Query: 121 STITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFT 180
           STITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFT
Sbjct: 121 STITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFT 180

Query: 181 VMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNA 240
           VMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNA
Sbjct: 181 VMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNA 240

Query: 241 TSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTD 300
           TSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTD
Sbjct: 241 TSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTD 300

Query: 301 GTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVAL 360
           GTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVAL
Sbjct: 301 GTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVAL 360

Query: 361 PQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKPTK 420
           PQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKPTK
Sbjct: 361 PQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKPTK 420

Query: 421 KKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDF 480
           KKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDF
Sbjct: 421 KKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDF 480

Query: 481 LDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVL 540
           LDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVL
Sbjct: 481 LDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVL 540

Query: 541 DQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEAC 600
           DQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEAC
Sbjct: 541 DQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEAC 600

Query: 601 GTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKG 660
           GTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKG
Sbjct: 601 GTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKG 660

Query: 661 VPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESN 720
           VPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESN
Sbjct: 661 VPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESN 720

Query: 721 INEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSH 780
           INEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSH
Sbjct: 721 INEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSH 780

Query: 781 LENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADK 840
           LENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADK
Sbjct: 781 LENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADK 840

Query: 841 DFKRNLLKKILIACGDIRQV 860
           DFKRNLLKKILIACGDIRQV
Sbjct: 841 DFKRNLLKKILIACGDIRQV 860

>Scas_699.42
          Length = 885

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/893 (50%), Positives = 608/893 (68%), Gaps = 60/893 (6%)

Query: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60
           MRLLKYPLD+ ++ V AL A+G ++I+  + GHV  W QQ LV+TAF+++ I+DL+   S
Sbjct: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60

Query: 61  FQVDQ---DTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFEC 117
           FQ+D        ++F + G  + L + +E+R+     WL RD N          + +F+C
Sbjct: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNK-------KFECVFQC 113

Query: 118 K--SPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITID-KAS---KPITGI 171
              S + ITD+K D    I+ V + + ++ILLF  +T   ++ I  + K S   +PIT I
Sbjct: 114 HMGSDNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLI 173

Query: 172 IDPTGQTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVIN 231
           IDP G  FTV+ SDRS+LVYQIN++G  KL+N   Q+VQ++PLHY+I+M PQ D LP+IN
Sbjct: 174 IDPCGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLIN 233

Query: 232 SVKGVPNNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYN 291
           S+KG  +   + T LLD N+NYK+  T+V+PSS+  +VL YSP  YEK N KKGT   YN
Sbjct: 234 SIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYN 293

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAF 351
           L+ATSG+ DGTIL+WNTKRMKPLFNA+  SS  IND+ WSQDG TLFAIS+D+ LYTFAF
Sbjct: 294 LLATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAF 353

Query: 352 QEKDLGVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGR 411
           Q+ DLG  L   ++  L++ NKKLP L     ++  K     +    + S       I +
Sbjct: 354 QDNDLGDQLSIEQVTLLRDQNKKLPILSNLNLDK--KVLQSKLDACLNKSDEKTITKIQK 411

Query: 412 SAVGKKPTKKKT--------ANNQTNGIKTIQSTSMEFNTPSYTVPRDLKR-KPK---EA 459
               KKP+ K+         A +Q + +K  QST+MEFN PSY VP+DLKR KPK    +
Sbjct: 412 EEGTKKPSSKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNVPKDLKRKKPKVKESS 471

Query: 460 TP----SNIAPGSKKQKKELQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPN 515
           TP     N +P +KK K++L+PI FLDTGLLLPN SFSR+RLATPKIR  F Y+P ++PN
Sbjct: 472 TPLNGEQNPSP-TKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPN 530

Query: 516 LILDVKNGSGNEQRPTIVKLTSKVLD------QDQVLFQDFIPKLITICTAGDTFWSFCS 569
           L + +KNGSG+EQ P+IV L  K L       Q +++FQDFIPK +  C AG++FW  C+
Sbjct: 531 LYMTIKNGSGSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCT 590

Query: 570 EDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNT 629
            DG++Y Y+DSGR+L+ P+ LGV I+FL+AC  YLLC+TS+GELYCW++  KKL FP  T
Sbjct: 591 SDGTLYTYTDSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTT 650

Query: 630 IYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWW 689
           +YPLL PS+RYSDD+LTR ENIT+C++T KGVPL TLSNGDGY+FDK+ME+WLLVSDGWW
Sbjct: 651 VYPLLKPSIRYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWW 710

Query: 690 AYGSQYWDTTNTTGLSSSKANTDSFNGSESNINEIVSDIKN--DNQSIINFLECKTNDEL 747
           AYGSQYW               DS N    N +  + ++KN  + +S+IN +E KTN+EL
Sbjct: 711 AYGSQYW---------------DSLNNDYKNDSNTLEELKNAENKKSLINMMERKTNEEL 755

Query: 748 NRKGRIKNLQRFARTILMKEGFENMEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIR 807
           +RKGRIK+LQRFA+T+LMKEGFENMEEIVTLSHLEN+IL+S++LEE  EF  L++ Y  R
Sbjct: 756 DRKGRIKHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSR 815

Query: 808 LSELGYMDRLNDVFQWLYDDLPISGTGSAFADKDFKRNLLKKILIACGDIRQV 860
           L ELGY++RLND+ QW+Y+D  +  +         +  +LK ILIAC D+R V
Sbjct: 816 LGELGYIERLNDMLQWIYNDGKMGKSDLLLGQS--RELILKDILIACADMRHV 866

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/873 (50%), Positives = 616/873 (70%), Gaps = 57/873 (6%)

Query: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60
           M+LLKYP  +H+  + A AA+   ++  GS   V  W  +QL+DTA  +    +L    S
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSE-RVSVWDTKQLLDTAMGKSSANELSELFS 59

Query: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP 120
            + + +     +    D + L++G++H L+    WL        + EKM    ++  + P
Sbjct: 60  SKGNFNNEKLCYVFATD-KKLFVGTDHALFYADSWL-------ETREKMVFHSIYRVEPP 111

Query: 121 STITDVKYDINLGILFVLLS---NENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQ 177
           STITD+KYD    ILF+L+S    +N  +L+  +T  +L+EI +   +KP+TGIIDP GQ
Sbjct: 112 STITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILL--PTKPMTGIIDPMGQ 169

Query: 178 TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVP 237
            FT++ + RSI +YQ N  G++KL+++L Q+VQ+ P+HY ++MSP AD +P+INS++   
Sbjct: 170 IFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLR--- 226

Query: 238 NNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSG 297
            N+T    LLDRNN +KV+ TLV   S  C++L +SP  YEK N K GT TRYNL+A+SG
Sbjct: 227 -NSTPSVVLLDRNNEFKVSTTLVGYDSK-CKILKFSPNLYEKTN-KTGT-TRYNLLASSG 282

Query: 298 STDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLG 357
           + +G++ VWNTKR +PLFNA  ++ T IND+ W+ DG  LFA+S+D  +Y FAFQEK+LG
Sbjct: 283 NENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELG 342

Query: 358 VALPQTEIKSLQEVNKKLPKLEEPL-AEQIPKSFPENIKLEESASAAPIPNDIGRSAVGK 416
             LPQ E   LQ   KKL    EPL  E++  S   +IK + S  ++ +   +  + V K
Sbjct: 343 QVLPQEETVKLQASIKKL----EPLPTEELKPS--HDIKPKTSGGSS-VNLSLNPTTVTK 395

Query: 417 KPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPK-EATPSNIAPGSKKQKKEL 475
              KK           TIQSTSMEFN PSY+VP+DLKRKPK E T  N     KKQKK++
Sbjct: 396 SGKKKVVPT-------TIQSTSMEFNPPSYSVPKDLKRKPKDEETMVN----GKKQKKDV 444

Query: 476 QPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKL 535
            P+DFLDT +L+PN SFS++RLATPKIR +F+YSP++N NLI DVKNG+GNEQ+PT + L
Sbjct: 445 DPMDFLDTNILMPNISFSKLRLATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISL 504

Query: 536 TSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSIS 595
             K  +QD+++FQDFIPK +T+ +AG++FW+ C+EDG++Y+YSD+G++L+ P+++GV  S
Sbjct: 505 LLKEPEQDRMIFQDFIPKFVTLSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCS 564

Query: 596 FLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCS 655
           FLEACG YLLC+TS+G+LYCW+I+ K+L FP NT+YPLLNP LRYSDDILTRAENIT+C+
Sbjct: 565 FLEACGKYLLCVTSMGQLYCWDIDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCT 624

Query: 656 ITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTG-LSSSKANTDSF 714
           ITK GVPL+TLSNGDGY+FD +METWLL+SD WWAYGSQYWD TNT G + ++ ++ D  
Sbjct: 625 ITKNGVPLLTLSNGDGYMFDCDMETWLLISDSWWAYGSQYWDMTNTNGVVVTTGSDKDDK 684

Query: 715 NGSESN--INEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFENM 772
                N     +VS+++++  SI+N+LE KTNDEL+RKGRI+NLQ+FA+TILMKEGFEN+
Sbjct: 685 KNRYWNPEAENLVSNVRSNKSSIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENL 744

Query: 773 EEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDD----- 827
           E+IVTLSHLEN++L+S++L E +EF++L++VYCIRL E+GY +RLNDV QWLY++     
Sbjct: 745 EDIVTLSHLENRVLVSLKLGEDQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKM 804

Query: 828 LPISGTGSAFADKDFKRNLLKKILIACGDIRQV 860
             I+GT         +  LLK+IL+AC DIRQV
Sbjct: 805 EKIAGTT--------REELLKQILVACADIRQV 829

>Kwal_55.21566
          Length = 873

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/873 (46%), Positives = 576/873 (65%), Gaps = 55/873 (6%)

Query: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60
           M+LLKYP  +H+ ++   A +G  ++ AG    V  W   QLV  A   +  K+++ +  
Sbjct: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDS-VCVWSCSQLVGAAMGNISAKEVREKFE 83

Query: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP 120
            +V +     +  + G    LY+G++  +  Y+  L      +   EK + + L+  ++P
Sbjct: 84  IKVLEARLEPLRLVVGSDACLYVGTDRTVL-YADSL------LEKGEKTSFQTLYHVEAP 136

Query: 121 STITDVKYDINLGILFVLLSNENK----ILLFRHKTFDKLSEITIDKASKPITGIIDPTG 176
           + +TDVK+D   G +FVL++  N+     LL       ++ +I++  ASKPITG++DP G
Sbjct: 137 ACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLG-ASKPITGVVDPAG 195

Query: 177 QTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGV 236
           Q FTV+ +DR++ V+Q    G+HKL+++L  ++Q+ PL Y ISMSPQAD LP++NS+ G 
Sbjct: 196 QIFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSG- 254

Query: 237 PNNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATS 296
              +T    LLDR + +K+  TLV    + C++  +SP+ YEK   K GT   YNL ATS
Sbjct: 255 ---STPAILLLDRKSGFKLRATLVG-HFDKCQICQFSPSLYEKVQ-KSGTKVTYNLAATS 309

Query: 297 GSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDL 356
           G   G++++WNTKR+KPL N      + + D+ WS DG TLFA++N+  L+ FAF++++L
Sbjct: 310 GFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEEL 369

Query: 357 GVALPQTEIKSLQE---VNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSA 413
           G  LP++ +  L+        LP  E P   Q  K  PE +      S+  I    G++ 
Sbjct: 370 GKTLPKSHVDKLRSDCATLSPLPPTEVPDLNQTIK--PEIVA---PGSSGVITKVNGKNK 424

Query: 414 VGKKPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKK 473
           V   PT             TI+S SMEF  PSY+VP+DLKR+PK+      A  +KKQK 
Sbjct: 425 VA--PT-------------TIRSLSMEFIAPSYSVPKDLKRRPKDPLQ---ATTNKKQKH 466

Query: 474 ELQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIV 533
           +L+P+DFLDT LL+P  SFS++RLA PK+R +F Y P  + +L + VKNGSGNEQ PT++
Sbjct: 467 DLEPMDFLDTSLLMPTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVI 526

Query: 534 KLTSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVS 593
            L  K   Q++ +F+DF+PKLITICT+GD FWS CS+DG++Y+YSDSGRKL+ P+++GV 
Sbjct: 527 TLKLKESGQEKTIFEDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVP 586

Query: 594 ISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITL 653
            SFLEACG +LLC+TSIG++YCWN++  +L FP  ++YPLL+P+LR+SDD+LTRAENIT+
Sbjct: 587 CSFLEACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITM 646

Query: 654 CSITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLS--SSKANT 711
           C++T  GVP+VTLSNGDGY++DK ME W+L++D WWAYGSQYWDTT TT     +S+ N 
Sbjct: 647 CTLTASGVPIVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPN- 705

Query: 712 DSFNGSESNINE----IVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKE 767
           D  +    N N     +   +K +  SI+N+LE +TNDELNRKGR++NLQ+FA+TILMKE
Sbjct: 706 DKHDKKNQNWNSEAKGLTESLKENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKE 765

Query: 768 GFENMEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDD 827
           G+EN+EE+VTLSHLENK+L+S+RL E EEF+KL+ +YCIRLSE+GY +RL+DV QWLYDD
Sbjct: 766 GYENLEEVVTLSHLENKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDD 825

Query: 828 LPISGTGSAFADKDFKRNLLKKILIACGDIRQV 860
                   A    +    LL+KIL+AC DIR V
Sbjct: 826 GNYKAKSVAGVKAE---ELLRKILVACADIRHV 855

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/873 (45%), Positives = 578/873 (66%), Gaps = 54/873 (6%)

Query: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60
           M+LLKYP  +H+ Q+ A   +   +++      + A+   +L   A   + ++++  EV 
Sbjct: 1   MKLLKYPRQLHDGQLLA-GCVVGGLLVVVGRDRISAYDCGKLQAAARGELAVREVSAEVE 59

Query: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSG-WLC--RDTNNINSVEKMNSKLLFEC 117
            QV+      + ++ G    L +  + ++W     W    R T  +          + + 
Sbjct: 60  LQVEVGEDA-LRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTRFLT---------VAQL 109

Query: 118 KSPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQ 177
              + +TDVK D   G++FV +S ++++ L+    ++++  +T+  A+KP+T ++DP G+
Sbjct: 110 AGGACVTDVKAD-GAGLVFVSVSGKDEVWLYATGAWERVGVVTL--AAKPVTLVVDPLGE 166

Query: 178 TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVP 237
             TV+  +RS+ VYQ N+ G  ++  +L Q+VQ  PL Y I+MSPQ D+LP++NS+K   
Sbjct: 167 LLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIK--- 223

Query: 238 NNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSG 297
            N      LLDR   + V  TLV    + C++L +SP  YEKPN K    T+YNL+A+SG
Sbjct: 224 -NGLPSAQLLDRTAGFSVQSTLVG-YVDKCKILRFSPRLYEKPN-KDKPPTQYNLLASSG 280

Query: 298 STDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLG 357
           + DG+++VWNTKR KPL NA +V+ T IND+ WS+DG  LFAISND  L+ FAF E +LG
Sbjct: 281 NEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELG 340

Query: 358 VALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSA--VG 415
             L   E++ L++    +P+LE PL    PKS  ++    E+        D   SA  V 
Sbjct: 341 RLLDDAELEKLRQ---SVPRLE-PLPPPTPKSLAKS----EAKPQQDTKPDAKSSANSVS 392

Query: 416 KKPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKEL 475
            K  KKK A         I STSMEFN PSYTVP+DLKR+PK+ T     P +K+ K+++
Sbjct: 393 AKTGKKKIAPT------VITSTSMEFNEPSYTVPKDLKRRPKQET-QRTGPPTKRPKRDV 445

Query: 476 QPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKL 535
           +P+DFLDT LL+PN SFS+ RLATPK+R  F+Y      NL+++VKNG+G+EQ+PT + L
Sbjct: 446 EPMDFLDTNLLIPNISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITL 505

Query: 536 TSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSIS 595
           T K  ++D VLFQDF P+ +TICT G +FW+ C+E+G +Y+YS++G+KL+ P+++GV +S
Sbjct: 506 TLKDKEKDMVLFQDFTPRFVTICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVS 565

Query: 596 FLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCS 655
           FLE CG YLLC+TS+G+L+CWN+++ KL FP NTIYPLLNPS+RYSDD+LTRAENIT+C+
Sbjct: 566 FLEGCGDYLLCVTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCT 625

Query: 656 ITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFN 715
            T+ G+PLVTLSNGDGY+FD +ME WLL++D WWAYGSQYWD TNT+   SS A   + N
Sbjct: 626 TTENGIPLVTLSNGDGYMFDPDMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAA---AGN 682

Query: 716 GSESNINE--------IVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKE 767
             E   N+        ++ ++K + +S++N+LE KTNDE+ RKG I+NLQRFA+TILMKE
Sbjct: 683 DKEDKKNKYWNADAEYLIEEVKKNKKSVVNYLESKTNDEMTRKGLIRNLQRFAKTILMKE 742

Query: 768 GFENMEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDD 827
           GFEN+E+IVTLSHLEN++L++++L E  EF+KL+ VYCI L+E+G+ +RL+DV  WLY+D
Sbjct: 743 GFENLEDIVTLSHLENRLLVALKLNETNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYND 802

Query: 828 LPISGTGSAFADKDFKRNLLKKILIACGDIRQV 860
                 G+   +K  +  LLK+IL+AC DIRQV
Sbjct: 803 GEYK-VGTIANEK--REELLKQILVACADIRQV 832

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/871 (44%), Positives = 550/871 (63%), Gaps = 53/871 (6%)

Query: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60
           M+LLK P  +H+ Q+         + + G G ++  W  Q L++ A  +  +K++K    
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIG-GKYLSIWDSQTLLNAATGKTDVKEVKELEK 59

Query: 61  FQVD---QDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFEC 117
             +D    +     + +  D + L  GS+H L       C D N  +S  +  S+ +   
Sbjct: 60  MSLDLLESNQEDGRWLVVLDNQRLVYGSDHLL------ACLDLNK-DSNSEYKSREIGIF 112

Query: 118 KSPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQ 177
           K    ITD+KYD   G+LFV LS  N + +   KT++  S I +   SKPI+ I DP GQ
Sbjct: 113 KDNEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIEL--KSKPISIITDPLGQ 170

Query: 178 TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVP 237
             TV+  +RS+ +YQ +  GT KL   + Q VQ  PL YR++MSPQ D++P+INS+    
Sbjct: 171 LLTVILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSL---- 226

Query: 238 NNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTR-YNLIATS 296
           +N      LLDR   +K+  +LV   ++ C++L +SP  Y K        T+ +NL+A+S
Sbjct: 227 HNNVPTAVLLDRIQKFKIKLSLVGYVAD-CKILKFSPRIYSKTKSPTSNDTQTFNLLASS 285

Query: 297 GSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDL 356
           G+ DG ++VWNT R+KPLF+A +V ++ I D+ W   G  LFAIS D  L  FAFQE +L
Sbjct: 286 GNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENEL 345

Query: 357 GVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGK 416
           G  +P   ++++ E  K++ KL +PL        P   K EE  +  P PN   +     
Sbjct: 346 GDVMP---VEAVTEAAKEI-KLLDPL--------PFKPKAEEPDTKLP-PNKTAQQTTTN 392

Query: 417 KPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATP--SNIAPGSKKQKKE 474
              + K A      I TI ST+MEF  PSY VP+DLKRKP    P  +   P +KK KKE
Sbjct: 393 SKKQPKAAE-----ITTISSTNMEFIQPSYMVPKDLKRKPVTEDPLLAQNKPANKKAKKE 447

Query: 475 LQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVK 534
           L  IDFLDT L LP+ SFS++RLA PKIR++F+YS  +  N +LD+KNG GN+Q+PT + 
Sbjct: 448 LDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQYS--SQGNFVLDIKNGLGNDQKPTSIT 505

Query: 535 LTSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSI 594
           LT K  +  + LFQ F+PK +T+C+AG +FW++ ++ G IY+ S SG+ L  P++LGV +
Sbjct: 506 LTRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPV 565

Query: 595 SFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLC 654
           SFLE  G YLLC+TSIG++YCWN+   K+AFP N +Y LLNP LRYSDD+L+RAENIT+C
Sbjct: 566 SFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMC 625

Query: 655 SITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGL---SSSKANT 711
           ++T +G+P+VTLSNGDGY+FD  ME W+L++D WW YGSQYW+  ++ G+   S+     
Sbjct: 626 AVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWWPYGSQYWNFMSSAGVDLTSNDDEKK 685

Query: 712 DSFNGSESNINEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFEN 771
           D +  +E++I  +  ++KN+  SIIN+LE KTNDEL RKGR+K+LQRFA+ +LMKEGFEN
Sbjct: 686 DKYWNAEADI--LAKEVKNNKNSIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFEN 743

Query: 772 MEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPIS 831
           +EE++TL+HLENKIL+S RL+E EE  +L+ +YCIR++E+GY DR +    WLYD     
Sbjct: 744 LEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYD----- 798

Query: 832 GTGSAFA--DKDFKRNLLKKILIACGDIRQV 860
            T + F+  D D +RNL+K I+I+C +IRQV
Sbjct: 799 PTNTKFSPLDIDRRRNLIKDIIISCANIRQV 829

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score =  528 bits (1360), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/477 (53%), Positives = 336/477 (70%), Gaps = 25/477 (5%)

Query: 395 KLEESASAAPIPNDIGRSAVGKKPTKKKTANNQTNGIKTI-----------QSTSMEFNT 443
           K+E+S S   +     ++   KK  K +   ++ N  +             +ST+ +F  
Sbjct: 505 KVEDSKSNVSVTATEKKTKPDKKSIKSENGESKVNKAQNTISPKESNTTDNKSTTPDFKN 564

Query: 444 PSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDFLDTGLLLPNTSFSRIRLATPKIR 503
           PSY VP+DLKRKPKE    N    +K+ KK+L+P+DFLDTGLLLPN +FSR+RL+TP IR
Sbjct: 565 PSYQVPKDLKRKPKEDALGNAV--TKRAKKDLEPVDFLDTGLLLPNVAFSRVRLSTPLIR 622

Query: 504 STFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVLDQDQVLFQDFIPKLITICTAGDT 563
                +  N+  ++L+++NGSGNEQ+PTIVKL  K +  ++ LFQDFIPK +++ T+GD 
Sbjct: 623 MNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFVSLATSGDD 682

Query: 564 FWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTYLLCLTSIGELYCWNIEQKKL 623
           FW+  SEDG++YI++D GRK++ PL +GV ISFLEACG YLLC++SIGELYCWNI   KL
Sbjct: 683 FWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASSKL 742

Query: 624 AFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSNGDGYLFDKNMETWLL 683
            FP  TI+PLL+PS+RYSDDILTRAENIT+CS+T  G P+ TLSNGDGY++DKNMETWLL
Sbjct: 743 EFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYDKNMETWLL 802

Query: 684 VSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESNINEIVSDIKNDNQSIINFLECKT 743
           VSDGWWAYGSQYWD+TN + L    +   +   S + I++          SI+  LE KT
Sbjct: 803 VSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEISK---------ASIVTLLEKKT 853

Query: 744 NDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSHLENKILISIRLEEPEEFSKLMMV 803
           N+EL RKGRIKNL+RFARTILMKEGFEN+EEIVTLSHLENK+L+++RLEE  EF KL+ +
Sbjct: 854 NNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLEEQHEFKKLIKL 913

Query: 804 YCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADKDFKRNLLKKILIACGDIRQV 860
           Y ++L ELGY+DRL D+F W+  D   S           ++ L+K +L AC D+R V
Sbjct: 914 YAVKLGELGYVDRLRDLFAWIISD---SNDNGDLIPGINRKELVKTLLTACADLRSV 967

 Score =  383 bits (983), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 272/388 (70%), Gaps = 13/388 (3%)

Query: 1   MRLLKYPLDIHNEQVNALAAL-GPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEV 59
           MRLLKYPL+  +  V +L  +   Y+++ GS G +  W QQQL+DTAFDR  ++ LKP+ 
Sbjct: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60

Query: 60  SFQVD-QDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECK 118
           SF  + +D   ++ F  GD + LY+G+EH ++ YSGWL    +   ++E   +KL++   
Sbjct: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLE---NKLIYTTV 117

Query: 119 SPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDK--LSEITIDKASKPITGIIDPTG 176
           S S ITDVK+D  L ILFVL     KI LF  ++ +K  ++ I +DK SKP+TG++DP+G
Sbjct: 118 SQSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSG 177

Query: 177 Q-TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKG 235
             TFTV+TSDRSI+VY IN+TG +K + KL+QHV +YPLHY+I+M PQAD LP+INS+KG
Sbjct: 178 AGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKG 237

Query: 236 VPNNATS-CTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIA 294
               A S  T LL+RN NYKV  TLV  +S+  +VLV+SP  YEK NLK+GT +RYNL+A
Sbjct: 238 SSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVA 297

Query: 295 TSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEK 354
           TS +TDG+I++WNTKR KPLF  L +S +AINDM WS +G TLFA+SND  LYTFAF + 
Sbjct: 298 TSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQD 357

Query: 355 DLGVALPQTEIKSLQEVNKKLPKLEEPL 382
           DLG  +P  EI+++++ N     ++EPL
Sbjct: 358 DLGKTVPMEEIENIRQSN----IIKEPL 381

>Scas_702.16
          Length = 816

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 136/276 (49%), Gaps = 33/276 (11%)

Query: 135 LFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGII-DPTGQTFTVMTSDRSILVYQI 193
           L V +  +  ++++   TF+KL    + ++   + G+I DP  + F   + DR++ +++ 
Sbjct: 151 LLVSVGLDRAVIIWNGITFEKLKRFDVHQSH--VKGVIFDPANKYFATASDDRTMKIFRY 208

Query: 194 NKTG--THKLINKLTQHVQMYPL---HYRISMSPQADILPVINSVKGVPNNATSCTALLD 248
           +K G  +  + + +T+  +  PL     R+S SP    +   N+     N   S  A+++
Sbjct: 209 HKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHIAAPNAT----NGPVSSVAIIN 264

Query: 249 RNNNYKVTKTLVTPSSNGCRVLVYSPAFYE-----KPNLKKGTS----TRYNLIATSGST 299
           R   +    +L+   +    V+ ++P  +E      P  +K  S    +  ++IAT+G  
Sbjct: 265 RGT-WDSNISLIGHDAP-TEVVRFNPRLFEVNDGMTPAKRKQDSGPNDSMESIIATAGQ- 321

Query: 300 DGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVA 359
           D T++VW+T R +P+F A  +++ +I DM W+ DG  LF  S D+++    F++ +LG  
Sbjct: 322 DKTVVVWSTTRARPIFIAFDIANKSITDMQWTPDGTMLFLTSLDSSITILVFEDNELGKI 381

Query: 360 LPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIK 395
           +P         + K + +L     ++    FPE+++
Sbjct: 382 IP---------LEKNIEQLHRYGVDKDSLDFPESVE 408

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 542 QDQVLFQDFIPKLITICTAGDTF---WSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLE 598
           Q ++    F+P+++ I   G +    W   + +GS+YI   +G+     + +G  I  + 
Sbjct: 667 QGKICLTAFLPEVV-ITAVGSSHCQCWCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMI 725

Query: 599 ACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLN 635
               YL+ LT  G  Y W+IE  KL      I P+LN
Sbjct: 726 NRERYLIALTERGLFYIWDIEDLKLVSKNIPILPILN 762

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 92/393 (23%), Positives = 177/393 (45%), Gaps = 38/393 (9%)

Query: 135 LFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGII-DPTGQTFTVMTSDRSILVYQI 193
           + V +  +  I+++   TF+K+    + ++   + G++ DP  + F   + DR+I +++ 
Sbjct: 148 IMVSVGLDRAIIIWNGSTFEKVKRFDVHQSH--VKGVVFDPANKYFATASDDRTIKMFRY 205

Query: 194 NKTG--THKLINKLTQHVQMYPL---HYRISMSPQADILPVINSVKGVPNNATSCTALLD 248
           +KTG  +  + + +T+  +  PL     R+S SP    +   N++ G      S  A+++
Sbjct: 206 HKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNG----PVSTVAIIE 261

Query: 249 RNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKP----------NLKKGTSTRYNLIATSGS 298
           R   ++   +LV        V  ++P  +++             K G S   + I  S  
Sbjct: 262 RGT-WESPVSLVG-HDQPTEVASFNPRIFKRQKDDSTTDTIDGKKTGISDEVDCIVASSG 319

Query: 299 TDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGV 358
            D T+ VW+T + +PL  A  +   +I DMSW+ DG  LF  S D+++    F++ + G 
Sbjct: 320 QDKTLAVWSTSKARPLIVAQDICGKSITDMSWTPDGKILFITSLDSSIVVLTFEDNEFGE 379

Query: 359 ALP-QTEIKSLQE--VNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVG 415
           A+P +  I+ L    V+K      E + + I +   +N+K + +     + N +G+    
Sbjct: 380 AIPLEQNIEYLHRYGVDKDSLVFPETVEQLILEDQAKNLK-KSNVDMNLLENRLGKPGTI 438

Query: 416 KKPT-----KKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGS-- 468
            +P       KK A     G  T  +T+ +   P   + + +KRK K    + +   +  
Sbjct: 439 AEPNILQVRSKKRAQLTGTGNHTDNNTTSKAEPPHVNILQ-VKRKNKVTGVTEVLHDTVV 497

Query: 469 KKQKKELQPIDFLDTGLLLPNTSFSRIRLATPK 501
           K  KK + P   L T    P+ S  R+ L+T +
Sbjct: 498 KNGKKRVAPT--LITMGHSPDKSRKRVILSTAQ 528

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/154 (18%), Positives = 58/154 (37%), Gaps = 7/154 (4%)

Query: 488 PNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNG---SGNEQRPTIVKLTSKVL--DQ 542
           PNT +       P   +  +     +   +L+V+NG   S       +   +++VL    
Sbjct: 633 PNTRYLEFNSILPDADAVLREMGTIDDLYVLEVRNGVERSIQFDTEALYDNSTRVLGYHA 692

Query: 543 DQVLFQDFIPKLITICTA--GDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEAC 600
            Q  F+ F P ++  C        W   +  G ++     G+     + +G  I  L   
Sbjct: 693 GQRSFELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRISIGHKIIKLCTS 752

Query: 601 GTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLL 634
            ++++ +T    +Y W++    L      + PLL
Sbjct: 753 QSHVIAITETALIYVWDLVSMSLTLKNIPLLPLL 786

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 142/304 (46%), Gaps = 60/304 (19%)

Query: 135 LFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGII-DPTGQTFTVMTSDRSILVYQI 193
           + V +  +  I+++   TF+K+    + ++   + G++ DP  + F   + DR++ V++ 
Sbjct: 148 ILVTVGLDRSIIVWNGSTFEKIKRFDVHQSH--VKGVVFDPANKYFATASDDRTVKVFRY 205

Query: 194 NKTGTH---KLINKLTQHVQMYPL---HYRISMSPQADILPVINSVKGVPNNATSCTALL 247
           +K GT     + + +T+  Q  PL     R+S SP    + V N+     N   S  A++
Sbjct: 206 HK-GTDLSFTIEHIITEPFQGSPLTTYFRRLSWSPDGQHIAVPNAT----NGPVSTVAII 260

Query: 248 DRNNNYKVTKTLV---TPSSNGCRVLVYSPAFYEK-PNLKKG---------------TST 288
            R  N+  + +LV    P+   C    ++P  +E   N ++G               +S 
Sbjct: 261 SR-GNWDTSVSLVGHDQPTEVAC----FNPRLFEHNDNHERGEEVDGASKDNSAASESSG 315

Query: 289 RYNL---------IATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFA 339
           +  L         IAT+G  D T+ VW+T R +P+F A  ++S ++ D++W+ DG  LF 
Sbjct: 316 KRRLKDDDRVDSVIATAGQ-DKTLAVWSTSRARPIFVAYDLTSKSVTDIAWTCDGTALFL 374

Query: 340 ISNDATLYTFAFQEKDLGVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIK---L 396
            S D  +    F+E +LG A+P         + + + +L     ++    FPE++K   L
Sbjct: 375 TSLDGRIIVITFEEGELGKAIP---------LEQNVEQLHRYGVDKDSLVFPESVKQLIL 425

Query: 397 EESA 400
           E+ A
Sbjct: 426 EDKA 429

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 76/172 (44%), Gaps = 7/172 (4%)

Query: 517 ILDVKNG---SGNEQRPTIVKLTSKVL--DQDQVLFQDFIPKLITICTAGDTF--WSFCS 569
           IL+++NG   S    R  + +  +K+L   Q +   + F+P+++  C        W+  +
Sbjct: 642 ILEIRNGVERSIQFDREALFENPTKILGYHQGERTLEAFLPEVVISCVGSKACQCWALAT 701

Query: 570 EDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNT 629
             GS+YIY + G+ L+  + +G  +  L A   +++  T     + W+I   KL     +
Sbjct: 702 ASGSLYIYGNHGQLLVPKISIGHKVIKLIAWQHFVIAFTETCLFWIWDIRAMKLVEKEIS 761

Query: 630 IYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSNGDGYLFDKNMETW 681
           + P+L       + +      +    +      LV +S+G  Y++ K +  W
Sbjct: 762 VLPVLVQDQPQCNRVRISRRILDFRMLADSHELLVEMSDGASYVWKKALGCW 813

>Kwal_47.17465
          Length = 800

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 91/420 (21%), Positives = 166/420 (39%), Gaps = 103/420 (24%)

Query: 135 LFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGII-DPTGQTFTVMTSDRSILVYQI 193
           + V +  +  ++++   TF+K+    + ++   + G+I DP  + F   + DR++ +++ 
Sbjct: 93  ILVTVGLDRSVIVWNGSTFEKIKRFDVHQSL--VKGVIFDPANKYFATASDDRTVRIFRY 150

Query: 194 NKTGTHKLINKLTQHVQMYPLH--------YRISMSPQADILPVINSVKGVPNNATSCTA 245
           +K G    ++   +HV   P           R+S SP    +   N+  G P ++ S  A
Sbjct: 151 HKAGD---MSFSIEHVVSEPFKGSPITTYFRRLSWSPDGQHIAAPNATNG-PVSSVSIIA 206

Query: 246 LLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYE------------------KPNLKKGTS 287
                 ++  + TL+   S    V+ ++P  ++                   P  + G  
Sbjct: 207 ----RGSWDTSVTLIGHDS-PTEVVRFNPRLFQVLEKKTEKNKPEVESPLVSPETQNGVK 261

Query: 288 TRYN------------------------LIATSGSTDGTILVWNTKRMKPLFNALQVSST 323
              +                        +IAT+G  D T++VW+T + +P+F A  ++S 
Sbjct: 262 DSQDEAGQRKDGQEEQEQEESVEEKVDSVIATAGQ-DKTLVVWSTGKARPIFVAYDIASK 320

Query: 324 AINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVALPQTEIKSLQEVNKKLPKLEEPLA 383
           +I DM W+ +G  LF  S D ++ TF F EK+LG A+P         + + + +L     
Sbjct: 321 SITDMVWNPNGDLLFLTSLDGSIITFHFGEKELGEAIP---------LERNVEQLHRYGV 371

Query: 384 EQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKPTKKKTANNQTNGIKTIQSTSMEFNT 443
           ++    FPE++K  +    A    D  R     KP ++             Q     F T
Sbjct: 372 DKDSFDFPESVKQLQLEDEAHKLQDESRKVT--KPQQE-------------QEVIASFAT 416

Query: 444 P--SYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDFLDTGLLLPNTSFSRIRLATPK 501
           P    +VP    +KP         P SK +  + QP                ++ LATPK
Sbjct: 417 PLDGNSVPLGTTQKPNILAVKRKEPPSKNEDLKQQPT--------------KKMELATPK 462

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 10/177 (5%)

Query: 517 ILDVKNGSGNE---QRPTIVKLTSKVL--DQDQVLFQDFIPKLITICTAGD---TFWSFC 568
           +++V+NG        R  + +  +++L   + + +    IP +I IC  G      W   
Sbjct: 625 VMEVRNGVERALQFDREALFEHPTRILAYHKGERIIDLLIPDVI-ICVVGSLKCKCWVLA 683

Query: 569 SEDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTN 628
           + DG IYIY+  G++ M  + LG  +  + A   Y++ LT  G LY WNIE +       
Sbjct: 684 TADGCIYIYTKYGQQKMPKIALGHKVVKMVAVDKYVVILTETGLLYAWNIEAEICIHKKV 743

Query: 629 TIYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSN-GDGYLFDKNMETWLLV 684
            I P+L  +   S+ +  + + + +     K   L+TL N  + Y +  N+  W LV
Sbjct: 744 PIMPILCNNSVDSNRVRIQKKVVRIGLDLCKLDLLITLINPREAYSWSSNLGCWTLV 800

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 98/422 (23%), Positives = 182/422 (43%), Gaps = 59/422 (13%)

Query: 135 LFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGII-DPTGQTFTVMTSDRSILVYQI 193
           + V +  +  ++++   TF+KL    + ++   + G++ DP  + F   + DR++ +++ 
Sbjct: 151 ILVTVGLDRSVIVWNGSTFEKLKRFDVHQSL--VKGVVFDPANKYFATTSDDRTMKIFRY 208

Query: 194 NKTG--THKLINKLTQHVQMYPL---HYRISMSPQADILPVINSVKGVPNNATSCTALLD 248
           +KTG  +  + + +T+  +  PL     R S SP    + V N+  G      S  A+++
Sbjct: 209 HKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVPNATNG----PVSSMAIVN 264

Query: 249 RNNNYKVTKTLVTPSSNGCRVLVYSPAFYEK------------------PNLKKGTSTRY 290
           R   +    +L+   +    V  ++P  +E+                   N  K      
Sbjct: 265 RGT-WDTNVSLIGHDA-PTEVARFNPRLFERNAGVKQKKDDDPENALVGQNDDKVHHFDK 322

Query: 291 NL---IATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLY 347
           N+   +AT+G  D ++ VW+T R +P+  A  +++ +I DMSW+ DG  LF  S D+++ 
Sbjct: 323 NIDSVVATAGQ-DKSLAVWSTSRPRPILVAFDIANKSITDMSWNPDGSLLFVASLDSSIT 381

Query: 348 TFAFQEKDLGVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIK--LEESASAAPI 405
            F F+  +LG  +P         + K + +L     ++    FPE+I   L E  + +  
Sbjct: 382 LFKFENNELGKPIP---------LEKNMEQLYRYGVDKDSLDFPESINQLLLEDQTKSFK 432

Query: 406 PNDIGRSAVGK-KPT-KKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSN 463
              I  S +G+  PT    +A+NQ +      S S   N         L  K K+    N
Sbjct: 433 HTKISTSKLGENHPTLATNSASNQKDNNDASVSRSEHINI--------LIPKRKKDAILN 484

Query: 464 IAPGSKKQKKELQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYS--PINNPNLILDVK 521
            A   K  KK + P     +     +    +  L + +I +  K S   IN+ N +L+V 
Sbjct: 485 KAVTLKSGKKRVAPTLISTSSSSPFSNGIKKPTLDSKRIENNVKSSTKTINSKNTLLNVP 544

Query: 522 NG 523
            G
Sbjct: 545 EG 546

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 547 FQDFIPKLITICTAGDT---FWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTY 603
            + FIP++I IC  G      W   S +GSIYI S +G++ +  + LG  +  +     Y
Sbjct: 699 IETFIPEVI-ICAIGSKDCKCWCLASANGSIYILSYNGQQRIPKICLGHKVIKMVTSSKY 757

Query: 604 LLCLTSIGELYCWNIEQKKLAFPTNTIYPLLN 635
           LL LT  G  + W++   KL      I P+LN
Sbjct: 758 LLVLTERGLFFAWDLLDLKLVLRNVPILPILN 789

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 86/397 (21%), Positives = 170/397 (42%), Gaps = 52/397 (13%)

Query: 1   MRLLKYPLDIHNEQVNA-------LAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMI- 52
           MR++K+P   H+E+          ++  G  +   G  G +  W    LV  A     + 
Sbjct: 1   MRIVKFPWFSHHEESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVD 60

Query: 53  KDL-KPEVSFQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNS 111
           +D  +P  S      +   + F + D   L  GS+ R+     W   + N+  S      
Sbjct: 61  RDTHRPLASMSRHTGSVTCVKF-SPDGNYLASGSDDRILLI--WAMDEENHGGSFGSEGE 117

Query: 112 KLLFECK-----SPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASK 166
           K  +  +       + I D+ +  +  IL V +  +  ++++    F++L    + ++  
Sbjct: 118 KEHWTVRKRLVAHDNDIQDICWAPDSSIL-VTVGLDRSVIVWNGLNFERLKRFDVHQSL- 175

Query: 167 PITGII-DPTGQTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPL--------HYR 217
            + G+I DP  + F   + DR++ V++ +KTG    ++   + V + P           R
Sbjct: 176 -VKGVIFDPANKYFATASDDRTMRVFRYHKTGE---VSFTIEQVIVEPFIASPLTTYFRR 231

Query: 218 ISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFY 277
           +S SP    + V N+  G      S  A+++R   +  + +L+   +    V  ++P  +
Sbjct: 232 LSWSPDGQHIAVPNATNG----PVSSVAIINRGT-WDSSISLIGHDA-PTEVARFNPRLF 285

Query: 278 EKPNLKKGTSTRYNL-------------IATSGSTDGTILVWNTKRMKPLFNALQVSSTA 324
           +    KK  + +  L             IAT+G  D ++ +W T R +P+F A  ++  +
Sbjct: 286 KSDVEKKAKNAKDELSKDTKNNKKLESIIATAGQ-DKSLALWITSRPRPIFVAYDIAQKS 344

Query: 325 INDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVALP 361
           I DM+W+ +G  LF  S D+++    F   +LG+ +P
Sbjct: 345 ITDMAWNPNGNILFVTSLDSSIVMLMFDANELGMPIP 381

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 542 QDQVLFQDFIPKLIT--ICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEA 599
           + Q   + FIP +I   + +    +WS  + DG IYI S +G+ L+  + LG  +     
Sbjct: 669 EGQRTIEAFIPNVIISGVGSPVSKYWSLATADGFIYIISYNGQLLIPKINLGQKVVKQVV 728

Query: 600 CGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLN 635
           C  YLL LT  G  Y W+I  K+      +I P++N
Sbjct: 729 CSNYLLVLTERGLFYAWDISAKRSVIKNVSILPIIN 764

>Kwal_27.10385
          Length = 536

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 140/333 (42%), Gaps = 72/333 (21%)

Query: 168 ITGII-DPTGQTFTVMTSDRSILVYQINKTGTH-----KLINKLTQ-------------- 207
           + G++ DP  +     ++DRS+ VY+I KT +      KL NK+T+              
Sbjct: 181 VQGVVWDPQNEFIFSQSADRSVHVYRIEKTPSGSISGLKLTNKITRGDLPCRKSKDSTEL 240

Query: 208 -----------HVQMYPLHYR-ISMSPQADILPVINSVKGVPNNATSCTALLDRNNN--- 252
                      H +  P  +R ++MSP   +L V     G+  N  S +   + N+    
Sbjct: 241 ELDNVKSVFLFHNETLPSFFRRLAMSPCGSLLCV---PAGIFKNCDSESESGNGNDELAN 297

Query: 253 --YKVTKTLVTPSSNG-----------CRVLVYSPAFYEKPNLKKGTSTR------YNLI 293
             Y  T++ +  +SN            C V+ ++P +Y     K  T T+      Y L+
Sbjct: 298 AVYVFTRSYLEKNSNRPAMVIPFLKKPCLVISFNPLYY-----KLATKTQPYINLPYKLV 352

Query: 294 ATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQE 353
               ++D  +LV++++   P+     +  T I D+SWSQDG  L   S D      +F+E
Sbjct: 353 FAVATSD-EVLVFDSETTSPICVIGNLHYTPITDLSWSQDGLMLMVSSTDGFCSYISFKE 411

Query: 354 KDLGVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIK--LEESASAAPIPNDIGR 411
             LG  + ++ +K+  +V  K P++   +  ++P     ++   L     A  +P     
Sbjct: 412 GTLGSQIGESVVKTANDV--KAPEVPPEVLPEVPAKKSASVVNILPVKQKAPEVPAKKSA 469

Query: 412 SAVGKKPTKKKTANNQT-----NGIKTIQSTSM 439
           S V   P K+K  ++       N I+T  S S+
Sbjct: 470 SVVNVLPVKRKVPDSHQSSSNENSIQTANSESV 502

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 118/294 (40%), Gaps = 65/294 (22%)

Query: 128 YDINL---GILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGII-DPTGQTFTVMT 183
           YDI+    G    + S +N + +F       +  IT  + +  + GI+ DP G+     +
Sbjct: 139 YDISWNPQGTCIAIASLDNTVRVFNVDQGKVVGHIT--EHNHYVQGIVWDPQGEFIVSQS 196

Query: 184 SDRSI----LVYQINKTGTHKLINKLTQ-------------------------HVQMYPL 214
           +DRS+    ++Y+ N+    +L+NK+ +                         H +  P 
Sbjct: 197 ADRSLAICKMIYEDNEVKGLQLVNKILKSELPRRKNPGEKELDFDKSKVTFLFHNETLPS 256

Query: 215 HYR-ISMSPQADILPVINSVKGVPNNATSCTALLDRNNN-------YKVTKTLVTPSSNG 266
            +R +SMSP   +L V     GV  N     A    NNN       Y  T+  +T +SN 
Sbjct: 257 FFRRLSMSPCGSLLCV---PAGVFRNDEQTDA---SNNNPEYANAVYIYTRASLTSNSNK 310

Query: 267 CRVLVYSPAFYEKPNL------------KKGTSTRYNLIATSGSTDGTILVWNTKRMKPL 314
               V+S  F +KP L             +     Y L+    +T+  +LV++T+   P+
Sbjct: 311 P---VFSLPFLQKPALVVKFNPIMYETASEWVKAPYTLVFAVATTN-EVLVYDTQNTSPI 366

Query: 315 FNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVALPQTEIKSL 368
             A  +  T I D++WSQDG  L   S D       F + D G  L    I  L
Sbjct: 367 AIAGNLHYTPITDLAWSQDGTLLMISSTDGFCSYIHFTDNDFGTPLKDQSIPIL 420

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 84/202 (41%), Gaps = 32/202 (15%)

Query: 173 DPTGQTFTVMTSDRSILVYQINKTGTH-----KLINKLTQ----------------HVQM 211
           DP  Q     ++DRS+ VY +  +        KL +K+ +                H + 
Sbjct: 196 DPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPCPGDVLRTNYLFHNET 255

Query: 212 YPLHYR-ISMSPQADILPVINSVKGVPNNATS-C------TALLDRNNNYKVTKTLVTPS 263
            P  +R  S+SP   ++ + + V  V  +  + C      + +L+     K    +  PS
Sbjct: 256 LPSFFRRCSISPCGGLVVIPSGVYKVAGDEVANCVYVYTRSGILNSAGGVKNRPAIRIPS 315

Query: 264 -SNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTDGTILVWNTKRMKPLFNALQVSS 322
                 +  +SP FYE    K      Y L+    +T+  +LV++T  ++PL     +  
Sbjct: 316 LKKPALMAAFSPVFYETCQ-KSVLKLPYKLVFAIATTN-EVLVYDTDVLEPLCVVGNIHY 373

Query: 323 TAINDMSWSQDGFTLFAISNDA 344
           + I D++WS+DG TL   S D 
Sbjct: 374 SPITDLAWSEDGSTLLISSTDG 395

>Scas_512.3
          Length = 534

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 96/257 (37%), Gaps = 61/257 (23%)

Query: 173 DPTGQTFTVMTSDRSILVYQI------NKTGTHKLINKLTQ------------------- 207
           DP  +     ++DRS+ +YQI      N     KL N++ +                   
Sbjct: 197 DPLNEFILSQSADRSVNIYQIIWDSDSNTIDKLKLKNRIMKGELPQRDDENDKTKLDYKN 256

Query: 208 -------HVQMYPLHYR-ISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYKVTKTL 259
                  H +  P  +R +++SP   I  +   +      + S       N  Y  T+ +
Sbjct: 257 LKTSFLFHNESLPSFFRRLTISPCGSIFCIPAGIFKNHTTSNSNDQGEISNAVYIYTRAI 316

Query: 260 VTPSSNGCR-------------VLVYSPAFYE----------KPNLKKGTSTRYNLIATS 296
           +  +SN  R             V+ ++P FY+          KP LK      Y LI  +
Sbjct: 317 IKQNSNNNRPVMILPFLKKPALVVSFNPNFYKLTHEEQEGTKKPYLK----LPYRLIY-A 371

Query: 297 GSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDL 356
            +T   +L+++T  +KP+     +  TA+ D+SWSQDG  L   S D        +E   
Sbjct: 372 VATSNEVLIYDTVNVKPISIIGNLHYTALTDLSWSQDGNMLMVSSTDGFCSYITIEENLF 431

Query: 357 GVALPQTEIKSLQEVNK 373
           G  L   E +     NK
Sbjct: 432 GEKLTIEEREQYINANK 448

>Scas_657.13
          Length = 411

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 296 SGSTDGTILVWNT--KRMKPLFNALQVSSTAINDMSWSQDGFTLF-AISNDATLYTFAFQ 352
           SGS DGTI +WN       P++    V S  +ND  WS     +F ++S D+TL     +
Sbjct: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249

Query: 353 EKD 355
           EKD
Sbjct: 250 EKD 252

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 291 NLIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFA 350
           +L++T+G  D   L+W+ +  K +  +LQ  S  I  + WSQ+G+ L + S D T+  + 
Sbjct: 318 SLVSTAG-LDAIALIWDIRSGKNIM-SLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWD 375

Query: 351 FQEK-DLGVALPQTEIKSLQEVNKK 374
            ++K ++   L    I S  + NK+
Sbjct: 376 IRKKGNVETILAHNSIVSQVKFNKQ 400

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 52/107 (48%), Gaps = 18/107 (16%)

Query: 279 KPNLKKGTSTRYNLIATSGSTDGTILVWNTKRMKPLFN-------ALQVSSTAINDMSWS 331
           +PN         N +  +G +DG+++V   + ++P++N        ++ +S+ + D+ +S
Sbjct: 89  EPNFATSVDVSSNGLIATGFSDGSVVVAQLRTLRPIYNFEGFGIQGIEENSSTVRDVKFS 148

Query: 332 QDGFTLFAISNDA------TLYTFAFQEKDLGVALP----QTEIKSL 368
             G  L A++ND+      TLY   + E+   + +P    QT + S 
Sbjct: 149 PLG-GLLAVANDSGSYGCVTLYETEYGERVGNLTVPTHSAQTSVGSF 194

>KLLA0A01650g complement(146030..147235) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin (WD-40) repeat family singleton,
           start by similarity
          Length = 401

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 25/122 (20%)

Query: 270 LVYSPAF-------YEKPNLKKGTSTRYNLIATSGSTDGTILVWNTKRMKPLFN------ 316
           LVY P F        + P            +  +G +DG+++V     ++P++N      
Sbjct: 171 LVYEPHFNFQGKINSQTPRFATAVDVSSTQLIATGFSDGSVVVSQLSTLRPVYNFEGFGL 230

Query: 317 -ALQVSSTAINDMSWSQDGFTLFAISNDA------TLYTFAFQEKDLGVALP----QTEI 365
             ++ SS+ I D+ +S  G +L A+++D+      +LY   F E+     +P    QT I
Sbjct: 231 KGVEESSSTIRDIKFSPAG-SLLAVAHDSGSYGCVSLYETEFGERIGNFTVPTHGNQTTI 289

Query: 366 KS 367
            S
Sbjct: 290 AS 291

>Scas_720.95
          Length = 515

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 78/196 (39%), Gaps = 25/196 (12%)

Query: 183 TSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNATS 242
           + D+++ V+ +N  G  K IN L  H      H+   +S   D    + +         S
Sbjct: 296 SHDKTVRVWDMNADG--KCINILKSHA-----HWVNHLSLSTDYALRVGAFDHTGAQPAS 348

Query: 243 CTALLDRN--NNYKVTKT------LVTPSSNGCRVLVYSPAFYEKPNLK-KGTSTRYNLI 293
                D+   N  KV K       L+  +S+   + +++P    KP  +  G     N +
Sbjct: 349 AKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHV 408

Query: 294 A--------TSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDAT 345
           A         S S D +I +W+ +  K   +  +    ++  ++WS D   L + S D T
Sbjct: 409 AFSPDGRYIVSASFDNSIKLWDGRDGK-FISTFRGHVASVYQVAWSADCRLLVSCSKDTT 467

Query: 346 LYTFAFQEKDLGVALP 361
           L  +  + + L V LP
Sbjct: 468 LKVWDVRTRKLSVDLP 483

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSW 330
           +IAT GS D TI +W++K  KPL +AL+     I  ++W
Sbjct: 200 VIAT-GSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAW 237

>AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH]
           (168010..169263) [1254 bp, 417 aa]
          Length = 417

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 38/62 (61%), Gaps = 5/62 (8%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSST---AINDMSWS-QDGFTLFAISNDATLY 347
           ++AT+G  DG I +W+T R +P  + L V       +ND++W+  D + + +++ND +++
Sbjct: 347 IVATAGQGDGLIKIWDTSR-EPEDSLLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVH 405

Query: 348 TF 349
            +
Sbjct: 406 VW 407

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
           complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 15/101 (14%)

Query: 696 WDTTNTTGLSSSKAN-TDSFNGSESNIN-----EIVSDIKNDNQ----SIINFLECKTND 745
           W TTNTT L +SK + +DS  G +SN +     E+ S IKND +    SI++ ++ + + 
Sbjct: 903 WSTTNTTSLDASKISVSDSTTGDDSNFSVASSVELQSSIKNDAKTSEDSIVDSIKEEGDS 962

Query: 746 ELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSHLENKIL 786
             N  GR   L+     +     ++N+E     + L+  IL
Sbjct: 963 VCNLVGRKMTLRPTTEVV-----YQNLEMFFPGTDLDKPIL 998

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 296 SGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKD 355
           S S D +I +WN +  K   +  +    ++  ++WS D   L + S D TL  +  + K 
Sbjct: 419 SASFDNSIKLWNGRDGK-FISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKK 477

Query: 356 LGVALP 361
           L V LP
Sbjct: 478 LAVDLP 483

>YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin
           assembly complex, subunit 3, involved in both nucleosome
           assembly linked with DNA replication and negative
           regulation of the RAS pathway, has WD (WD-40) repeats
           [1269 bp, 422 aa]
          Length = 422

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 53/113 (46%), Gaps = 20/113 (17%)

Query: 252 NYKVTKTLVTPSSNG------CRVLVYSPAFYEKPNLKKGTSTRY--------NLIATSG 297
           NYK +  L +  SNG       R +  SP       ++ GTS            ++AT+G
Sbjct: 305 NYKNSLILASADSNGRLNLWDIRNMNKSPI----ATMEHGTSVSTLEWSPNFDTVLATAG 360

Query: 298 STDGTILVWNTKRMKPLFNALQVSSTAINDMSW-SQDGFTLFAISNDATLYTF 349
             DG + +W+T   + +F         +ND+SW + D + + +++ND +++ +
Sbjct: 361 QEDGLVKLWDTSCEETIFTH-GGHMLGVNDISWDAHDPWLMCSVANDNSVHIW 412

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAF 351
           L++T+G TD T ++W+ +  K + + LQ  +  I  M WS DG TL     D  +  +  
Sbjct: 354 LVSTAG-TDKTAIIWDLRSGKAV-SQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDL 411

Query: 352 QEKD 355
           ++ D
Sbjct: 412 RKSD 415

>CAGL0G03333g 319139..319699 weakly similar to sp|P40063
           Saccharomyces cerevisiae YER104w RTT105, hypothetical
           start
          Length = 186

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 685 SDGWWAY-GSQYWDTTNTTGLSSSKANTDSFNGSESNINEIVSDIKNDNQSIINFL-ECK 742
           S+GW +Y  ++  D+TN     SS  N     G+ES +N+I+S  +N +    N L +  
Sbjct: 32  SNGWVSYPTNEGKDSTN-----SSSPNL----GNESIVNDIISRRRNASSGPANNLSQSA 82

Query: 743 TNDELNRK-GRIKNLQRFARTILMKEGFENMEEIVTLSHLE 782
             D  N+K   ++ L+R  +TI  + G +NM + V  S ++
Sbjct: 83  RRDTENKKLKELRRLKRLQKTIKNRGGLDNMRDFVLNSEID 123

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSW 330
           LIAT GS D TI +W + + KP  +AL+  S  I  +SW
Sbjct: 200 LIAT-GSMDNTIRLWESSKGKPYGDALRGHSKWITSLSW 237

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 296 SGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKD 355
           S S D +I +W+ +  K   +  +    ++  ++WS D   L + S D TL  +  + + 
Sbjct: 419 SASFDNSIKLWDGRDGK-FLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 477

Query: 356 LGVALP 361
           L V LP
Sbjct: 478 LSVDLP 483

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 291 NLIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTF 349
           N I TSGS D  IL  + +  +P F  ++  +  +  + W+ D   L +  ND  +Y +
Sbjct: 343 NHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVY 401

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 81/195 (41%), Gaps = 23/195 (11%)

Query: 183 TSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVK--GVPNNA 240
           + DR++ V+ IN  G  + IN L  H   +  H  +S      I    ++ K    P  A
Sbjct: 296 SHDRTVRVWDINSQG--RCINILKSHAH-WVNHLSLSTDYALRIGAFDHTGKKPSTPEEA 352

Query: 241 T-----SCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLK-KGTSTRYNLIA 294
                 +   +  +N N   ++ ++  +S+   + +++P    KP  +  G     N +A
Sbjct: 353 QKKALENYEKICKKNGN---SEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVA 409

Query: 295 --------TSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATL 346
                    S S D +I +W+ +  K   +  +    ++  ++WS D   L + S D TL
Sbjct: 410 FSPDGRYIVSASFDNSIKLWDGRDGK-FISTFRGHVASVYQVAWSSDCRLLVSCSKDTTL 468

Query: 347 YTFAFQEKDLGVALP 361
             +  + + L V LP
Sbjct: 469 KVWDVRTRKLSVDLP 483

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 27/93 (29%)

Query: 96  LCRDTNNI--NSVEKMNSKLLFECKSPSTITDVKYDINLGILFVLLSNENKILLFRHKTF 153
            CRD NN+     +K N++LLFEC++ S I +                    L++RH+  
Sbjct: 6   FCRDCNNMLYPREDKENNRLLFECRTCSYIEEA----------------GSPLVYRHELI 49

Query: 154 DKLSEITIDKASKPITGIIDPTGQTFTVMTSDR 186
             + E           G++   G   T+  SDR
Sbjct: 50  TNIGE---------TAGVVQDIGSDPTLPRSDR 73

>CAGL0L11154g 1184758..1189944 similar to sp|Q04958 Saccharomyces
           cerevisiae YML059c, start by similarity
          Length = 1728

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 416 KKPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKR-KPKEATPSNI----APGSKK 470
           + PT  +  +N  NG    Q T+   N+ +    RDL++ +P+ +  S++     P +  
Sbjct: 602 QSPTSSRLTSN-FNGNSNNQRTNSR-NSQALMSTRDLRKTRPELSQQSSMIHSPTPITGS 659

Query: 471 QKKELQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPI---NNPNLILDVKNGSGNE 527
           +   L+  D  + G LL N   SRI LA+P  R  F YS +   ++P   ++ +  S   
Sbjct: 660 RHVVLESRDKYNPGDLLSNVPLSRINLASPSSRG-FDYSSMKKESSPQSSVNSRKRSTTG 718

Query: 528 QRPTIVKLTS 537
           +RP ++K  S
Sbjct: 719 ERPRLLKRPS 728

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 53/121 (43%), Gaps = 10/121 (8%)

Query: 99  DTNNINSVEKMNSKLLFECKSPSTITDVKYDINLGIL---------FVLLSNENKILLFR 149
           D N + S    NS +L++ ++ S    +   + +  +         FV+ S ++    + 
Sbjct: 228 DANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYD 287

Query: 150 HKTFDKLSEITIDKASKPITGIIDPTGQTFTVMTSDRSILVYQINKTGTHKLIN-KLTQH 208
            +   +   +  D  S  +   I PTG+     + D++I ++ INK  + ++ + K  QH
Sbjct: 288 MRNMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKGHSREIYHTKRMQH 347

Query: 209 V 209
           V
Sbjct: 348 V 348

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 91/236 (38%), Gaps = 50/236 (21%)

Query: 168 ITGII-DPTGQTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQM--------------- 211
           + G++ DP  +     ++DRS+ +Y+I +T T   I  L  H ++               
Sbjct: 181 VQGVVWDPQNEYIISQSADRSVHIYKI-ETSTEGHITGLKLHHKIMKGDLPRREEHDPRF 239

Query: 212 ---------YPLH--------YRISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYK 254
                    Y  H         R++ SP   IL V   V    N+   CT     N  Y 
Sbjct: 240 LVRSEAKSAYLFHNETLPSFFRRLTTSPCGSILCVPTGVFKA-NSEGECTNQELSNAVYI 298

Query: 255 VTKTLV-----TPS------SNGCRVLVYSPAFYE-KPNLKKGTSTRYNLI-ATSGSTDG 301
            T++ +     TP            V+ +SP  Y+ +  ++      Y L+ A + ST+ 
Sbjct: 299 YTRSSLKLRNSTPIVALPFLRKPALVVRFSPILYKIETGVEPWIQLPYKLVFAVATSTE- 357

Query: 302 TILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLG 357
            +++++T   KP+     +  T + D+SWS  G  L   S D      + ++   G
Sbjct: 358 -VVIYDTVTTKPIAVVGNLHYTPLTDLSWSDSGHLLVVSSTDGFCSYISMEDSLFG 412

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSW 330
           +IAT GS D TI +W+ +  KPL +AL+  S  I  ++W
Sbjct: 202 VIAT-GSMDNTIRLWDAESGKPLGDALRGHSKWITSLTW 239

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 296 SGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKD 355
           S S D +I +W+ K      +  +    ++  ++WS D   L + S D TL  +  + + 
Sbjct: 421 SASFDNSIKLWDGKE-GTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 479

Query: 356 LGVALP 361
           L V LP
Sbjct: 480 LSVDLP 485

>Scas_557.6
          Length = 373

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 18/101 (17%)

Query: 354 KDLGVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSA 413
           KDL   +PQ    ++Q+   K+  +EEP+ E+   S         + + A   ND G S+
Sbjct: 176 KDL---IPQQPPTTVQKAPSKVQSIEEPVEEEASNS---------NGTDASDVNDNGESS 223

Query: 414 VGKKPTKKKTANNQTN------GIKTIQSTSMEFNTPSYTV 448
           +   P      NN+++      GI+       EF+   YT+
Sbjct: 224 IAAPPPSNSANNNESHPVKLDIGIENCLHIEFEFSKARYTL 264

>Scas_720.22*
          Length = 122

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 27/93 (29%)

Query: 96  LCRDTNNI--NSVEKMNSKLLFECKSPSTITDVKYDINLGILFVLLSNENKILLFRHKTF 153
            CRD NN+     +K N++LLFEC++ S + +                    L++RH+  
Sbjct: 6   FCRDCNNMLYPREDKENNRLLFECRTCSYVEEA----------------GAPLVYRHELI 49

Query: 154 DKLSEITIDKASKPITGIIDPTGQTFTVMTSDR 186
             + E           G++   G   T+  SDR
Sbjct: 50  TNIGE---------TAGVVQDIGSDPTLPRSDR 73

>Kwal_47.17827
          Length = 523

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 286 TSTRYNLIATSGSTDGTILVWNT--KRMKPLFNALQVSSTAINDMSWSQDGFTLFAISND 343
           + T   + AT G  DG I +W+T  K+ KP   +++ SST +N +SW++    L A  +D
Sbjct: 342 SRTEATVFATCG-CDGYIRIWDTRSKKHKPAI-SVKASSTDVNVISWNEKIGYLLASGDD 399

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 289 RYNLIATSGSTDGTILVWNTKRMK-PLFNALQVSSTAINDMSWS--QDGFTLFAISNDAT 345
           ++ +I  S S DG +L+W     +     A +V S ++N + W+  + G  L A S+D  
Sbjct: 65  KFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGK 124

Query: 346 LYTFAFQE 353
           +    F+E
Sbjct: 125 VSVVEFKE 132

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 27/93 (29%)

Query: 96  LCRDTNNI--NSVEKMNSKLLFECKSPSTITDVKYDINLGILFVLLSNENKILLFRHKTF 153
            CRD NN+     +K N++LLFEC++ S + +                    L++RH+  
Sbjct: 6   FCRDCNNMLYPREDKENNRLLFECRTCSYVEEA----------------GSPLVYRHELI 49

Query: 154 DKLSEITIDKASKPITGIIDPTGQTFTVMTSDR 186
             + E           G++   G   T+  SDR
Sbjct: 50  TNIGE---------TAGVVQDIGSDPTLPRSDR 73

>Kwal_56.24596
          Length = 294

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 289 RYNLIATSGSTDGTILVWNTKRMKPLFNALQ-VSSTAINDMSWS--QDGFTLFAISNDAT 345
           ++ +I  S S DG +L+W  +  +    A+  V S ++N + W+  + G  L A S+D  
Sbjct: 65  KFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGK 124

Query: 346 LYTFAFQE 353
           +    F+E
Sbjct: 125 VSVVEFKE 132

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 269 VLVYSPAFYEKPNLKKGTSTRYNLIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDM 328
            + +SP FYE+ + K      Y L+  + +T   ++ ++T+ ++P+     +  T + D+
Sbjct: 370 AVAFSPIFYERTSNKPYVDLPYKLVF-AIATINQVIFYDTENIEPISIVSNLHYTPLTDL 428

Query: 329 SWSQDGFTLFAISNDA 344
           +WS  G  +   S D 
Sbjct: 429 TWSPRGDMVMVSSTDG 444

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAF 351
           L+A++G  D    +W+ +  +P+   L+  + AI+ + WS +G+ L     D T+  +  
Sbjct: 312 LLASAG-LDAVCAIWDLRSGEPIMK-LEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI 369

Query: 352 QEKDLGVALPQTEIKSL 368
           +      AL   ++ +L
Sbjct: 370 RNVGTESALLAHQVAAL 386

>Scas_684.7
          Length = 511

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 286 TSTRYNLIATSGSTDGTILVWNT--KRMKPLFNALQVSSTAINDMSWSQDGFTLFAISND 343
           + T   + A++G  DG I +W+T  K+ KP   +++ S+T +N +SWS+    L A  +D
Sbjct: 330 SRTESTVFASAG-CDGYIRIWDTRSKKHKPAI-SVKASNTDVNVISWSEKLGYLLASGDD 387

>YCL064C (CHA1) [484] chr3 complement(15798..16880)
           L-serine/L-threonine deaminase (catabolic
           L-serine/L-threonine dehydratase) [1083 bp, 360 aa]
          Length = 360

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 65/163 (39%), Gaps = 30/163 (18%)

Query: 676 KNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKA---------NTDSFNGSESNINEIVS 726
           +N    ++VS  +W     +  T     + S            N D + G  S I+EIV 
Sbjct: 102 RNTGAQVIVSGAYWKEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQ 161

Query: 727 DIKNDNQSI--INFLECKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLS----H 780
           D+K+ + S+  +  + C         G I+ L+R+        G  +   IV +     H
Sbjct: 162 DLKSQHISVNKVKGIVCSVGGGGLYNGIIQGLERY--------GLADRIPIVGVETNGCH 213

Query: 781 LENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQW 823
           + N    S+++ +P +F K+  +     + LG     N  F++
Sbjct: 214 VFNT---SLKIGQPVQFKKITSI----ATSLGTAVISNQTFEY 249

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 289 RYNLIATSGSTDGTILVWNTKRMK-PLFNALQVSSTAINDMSWS--QDGFTLFAISNDAT 345
           ++ +I  S S DG +L+W  +  +     A +V S ++N + W+  + G  L   S+D  
Sbjct: 65  KFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLCSSSDGK 124

Query: 346 LYTFAFQE 353
                F+E
Sbjct: 125 FSVVEFKE 132

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 1/69 (1%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAF 351
           L   SG  D T+++W+T+   P F   +  S A+  ++WS     L A     T     F
Sbjct: 390 LQLASGGNDNTMMIWDTRTSMPQF-VKKDHSAAVKALAWSPTNAGLLASGGGQTDQQIHF 448

Query: 352 QEKDLGVAL 360
                G  L
Sbjct: 449 WNSTTGAKL 457

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 291 NLIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTF 349
           N I +SGS D TIL  + +   P F  ++     I  + W+ +   L +  ND  ++ +
Sbjct: 428 NHILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVY 486

>CAGL0M05291g complement(566250..567509) similar to sp|P13712
           Saccharomyces cerevisiae YBR195c MSI1, hypothetical
           start
          Length = 419

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWS-QDGFTLFAISNDATL 346
           + A++G  DG + +W+    K +F         +ND+SW   D + + ++SND T+
Sbjct: 351 VFASAGQEDGLVKLWDASVGKEIF-VHGGHMLGVNDISWDMHDPWLMASVSNDNTI 405

>Scas_661.19
          Length = 478

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 18/91 (19%)

Query: 289 RYNLIATSGSTDGTILVWNTKRMKPLFNALQVSSTAIN--------------DMSWSQDG 334
           R N+I  SG  DG+I +W+ +    L   L+  S A N              D+ WS  G
Sbjct: 285 RGNVIC-SGDADGSIKLWDLRMTNRLLIELRRFSKASNGYGNGTRAHLQSCTDLCWSNTG 343

Query: 335 FTLFAISNDATLYTFA--FQEKDLGVALPQT 363
             L ++  D   Y +     +K+L ++ PQT
Sbjct: 344 DELCSVGTDGKCYIWRPFLSDKEL-ISNPQT 373

>Kwal_27.11079
          Length = 613

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 48/119 (40%), Gaps = 13/119 (10%)

Query: 201 LINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYK------ 254
           L+ K       + L   IS  P A+   VI ++       T    +L +N +Y+      
Sbjct: 299 LVKKERMADAAHSLSRLISGLPPAEKATVIGTMLKRIQLTTQKEDILTKNASYRDCLIGS 358

Query: 255 -------VTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTDGTILVW 306
                   + T VT ++ G  ++ YS  FY K  L +  +  +++I       GTIL W
Sbjct: 359 DGRRTRIASLTWVTQNACGVAMMTYSTYFYTKAGLSESYAFTFSIIQYCFGLIGTILSW 417

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 296 SGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATL 346
           SG  D  I +W+    + L    +    A+ D++++ DG    ++S D TL
Sbjct: 196 SGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTL 246

>KLLA0F19096g complement(1762215..1770986) weakly similar to
           sgd|S0004077 Saccharomyces cerevisiae YLR087c, start by
           similarity
          Length = 2923

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 141 NENKILLFR-HKTFDKLSEITIDKASKPITGIIDPT-GQTF----TVMTSDRSILVYQIN 194
           N+N I  F   KT DK+ + T+ K    I+ ++ P  G+T       + S + + +Y   
Sbjct: 282 NDNPIKTFVVEKTMDKIWQ-TVKKQCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHT 340

Query: 195 KTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNATSCTALLDRNNNYK 254
           K    + ++    H Q Y  + R+  + +  +    +    VP N++S  +  DR+ +  
Sbjct: 341 KAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLN 400

Query: 255 VTKTLVTPSSNGCRVLVYSPAFYEKP 280
             +   TP+  G  + +Y+ A Y  P
Sbjct: 401 CNQDDDTPAF-GTDIHIYTAAVYYGP 425

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 295 TSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFA 339
            SG  D T+++W+T++ +PL+   +  + A+  ++W  D   L A
Sbjct: 363 ASGGNDNTVMIWDTRQDEPLW-VKRNHNAAVKAITWHPDVVNLLA 406

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 28/68 (41%), Gaps = 9/68 (13%)

Query: 295 TSGSTDGTILVW---------NTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDAT 345
            +GS D TI +W           K    L   ++     +  +SWSQDG  L   S D +
Sbjct: 75  AAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKS 134

Query: 346 LYTFAFQE 353
           ++ +   E
Sbjct: 135 VWIWETDE 142

>Kwal_27.12070
          Length = 418

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 292 LIATSGSTDGTILVWNTKRMKPLFNALQVSST----AINDMSWS-QDGFTLFAISNDATL 346
           ++AT+G  DG + +W+    +P+   L+ +       +ND+SW   D + + ++SND ++
Sbjct: 348 ILATAGQDDGLVKIWDLS--QPVDQELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSI 405

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 296 SGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKD 355
           SGS D ++++W+T+   P F   +  + A+  +SW  D   L A     T     F    
Sbjct: 392 SGSNDNSVMIWDTRTSMPQF-VKRNHTAAVKAISWCPDVPNLLATGGGQTDKYIHFWNTT 450

Query: 356 LGVALPQ----TEIKSLQ 369
            G  +      +++ SLQ
Sbjct: 451 TGARVSSINTGSQVSSLQ 468

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 711 TDSFNGSESNINEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFE 770
           TD F  ++  INEI   +      +I     K N     +GR K LQ  A  I  KE F 
Sbjct: 328 TDEFLKAKEKINEIFEKLNTIRDEVIK----KKNQNEYYRGRTKKLQ--ATIISTKEDFL 381

Query: 771 NMEEIVTLSHLENK 784
             +EI+  +HL  K
Sbjct: 382 RSQEILAQTHLPEK 395

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 55/137 (40%), Gaps = 19/137 (13%)

Query: 290 YNLIATSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTF 349
           Y  I  S S D T+ VW+ +        L+  +  +N +      FT ++ S+D TL  +
Sbjct: 401 YKKIIVSASADKTVKVWHVESRTCY--TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458

Query: 350 AFQ---------------EKDLGVALPQTEIKSLQEVNKKLP--KLEEPLAEQIPKSFPE 392
             +               +K + + +  TE   + E  +K+P  +LEE  A+     F  
Sbjct: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP 518

Query: 393 NIKLEESASAAPIPNDI 409
           N+K      +  + N I
Sbjct: 519 NLKYPTHLLSCSLDNTI 535

>Kwal_23.6290
          Length = 958

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 10/83 (12%)

Query: 172 IDPTGQTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVIN 231
           +DPTGQ   +  +D S+ + ++      K I    + V  + +  +++ SP + IL  ++
Sbjct: 269 VDPTGQLAALAGNDNSVALVRLKNLTVAKFI----KQVHSFAI-TKVAFSPDSKILASVS 323

Query: 232 SVKG-----VPNNATSCTALLDR 249
           +        +P+N  S ++LL++
Sbjct: 324 AANTIHAILIPDNLGSSSSLLEK 346

>Scas_610.5
          Length = 1386

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 33  HVMAWRQQQLVDTAFDRVMIKDLK--PEVSFQVDQDTTGDIFFITGD-LETLYIGSEHRL 89
           H++  ++    +  FD  +  D +  P +  QVD +  G +F +T + L+ L +  +++ 
Sbjct: 896 HMIQLKKDCYENERFDIKITHDGRCAPIIDLQVDAEN-GRLFILTSNGLQILNL--KYQT 952

Query: 90  WGYSGWLCRDTNNINSVEKMNSKL 113
           W YS +L + T ++N V +   K+
Sbjct: 953 WNYSNYLLKSTRSVNKVFRFIDKI 976

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,940,369
Number of extensions: 1415959
Number of successful extensions: 5707
Number of sequences better than 10.0: 122
Number of HSP's gapped: 5882
Number of HSP's successfully gapped: 135
Length of query: 860
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 750
Effective length of database: 12,788,129
Effective search space: 9591096750
Effective search space used: 9591096750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)