Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR037W (CYC2)36636018440.0
KLLA0E21901g3573518231e-108
ACR090C3663727751e-101
Kwal_55.215613493347731e-101
Scas_699.413183066351e-80
CAGL0I00990g3433505772e-71
ACR054C306292940.001
KLLA0D04488g296286920.002
YIL043C (CBR1)322236850.013
AFR439C31076840.017
Kwal_23.5471312339800.048
Sklu_2260.235062800.050
ADL087W28777770.11
Kwal_47.18159287170770.13
CAGL0B02519g312125770.14
Scas_704.43316195730.39
KLLA0F27621g28177710.67
CAGL0H03487g53563701.1
CAGL0E06424g29838691.2
Scas_692.631465681.6
YML125C31258672.0
Sklu_2184.231061672.2
Kwal_33.1426030861672.4
YML087C31242662.5
KLLA0C16918g31061662.6
Scas_678.629937653.3
Scas_720.2167054645.7
YKL150W (MCR1)30237637.1
YMR247C156254647.4
KLLA0D03256g82351637.4
Scas_690.1453358637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR037W
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...   714   0.0  
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...   321   e-108
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...   303   e-101
Kwal_55.21561                                                         302   e-101
Scas_699.41                                                           249   1e-80
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...   226   2e-71
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...    41   0.001
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    40   0.002
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...    37   0.013
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    37   0.017
Kwal_23.5471                                                           35   0.048
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                            35   0.050
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...    34   0.11 
Kwal_47.18159                                                          34   0.13 
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...    34   0.14 
Scas_704.43                                                            33   0.39 
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...    32   0.67 
CAGL0H03487g 324020..325627 similar to sp|P22149 Saccharomyces c...    32   1.1  
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...    31   1.2  
Scas_692.6                                                             31   1.6  
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...    30   2.0  
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement         30   2.2  
Kwal_33.14260                                                          30   2.4  
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...    30   2.5  
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...    30   2.6  
Scas_678.6                                                             30   3.3  
Scas_720.21                                                            29   5.7  
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...    29   7.1  
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    29   7.4  
KLLA0D03256g complement(271036..273507) some similarities with s...    29   7.4  
Scas_690.14                                                            29   7.9  

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/360 (96%), Positives = 348/360 (96%)

Query: 1   MLWKNYVLSSSRITRRLHKSPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKHEL 60
           MLWKNYVLSSSRITRRLHKSPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKHEL
Sbjct: 1   MLWKNYVLSSSRITRRLHKSPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKHEL 60

Query: 61  SPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNY 120
           SPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNY
Sbjct: 61  SPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNY 120

Query: 121 TPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFID 180
           TPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFID
Sbjct: 121 TPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFID 180

Query: 181 YEFPHLPNELKRSRDCLYMDXXXXXXXXXXXXSQFIYQPYDIMMFTAGTGIVTALQLLLT 240
           YEFPHLPNELKRSRDCLYMD            SQFIYQPYDIMMFTAGTGIVTALQLLLT
Sbjct: 181 YEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTALQLLLT 240

Query: 241 ESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSIQKSIT 300
           ESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSIQKSIT
Sbjct: 241 ESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSIQKSIT 300

Query: 301 KPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLSKEGWNSD 360
           KPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLSKEGWNSD
Sbjct: 301 KPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLSKEGWNSD 360

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score =  321 bits (823), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/351 (45%), Positives = 230/351 (65%), Gaps = 13/351 (3%)

Query: 9   SSSRITRRLHKSPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKHELSPSYFVKY 68
           SSS+ T     + + SS  K   +    + +GA    L++ Y  E   + ELS  YF KY
Sbjct: 13  SSSKTTLPQPSAGKSSSLLKTVLLLSGSVAIGA----LSWNYYKESLYQRELSRDYFSKY 68

Query: 69  KISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFN 128
           KIS K  ID  H+L+E+TPL  QKVN+W  M +  LWSVE+KQPE+MVVR+YTPLPL   
Sbjct: 69  KISKKYSIDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVRSYTPLPLTIE 128

Query: 129 PASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPN 188
             +  +E+L+D +NA G L+FYIK+Y+ GEVARW++HLP GH++E+RGPF++YEFP   +
Sbjct: 129 -ENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEYEFPDTAD 187

Query: 189 ELKRSRDCLYMDXXXXXXXXXXXXSQFIYQPYDIMMFTAGTGIVTALQLLLTESPFRGTI 248
           E+ R R  L+ +              + YQP+DI+ FT GTGIV  LQ+ LTESPFRG I
Sbjct: 188 EITRDRSFLWGN-------EDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTESPFRGKI 240

Query: 249 KLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSIQKSITKPYPYKGL 308
             +H+ K++ +LGPL  IL +LQ ++R++L   E++R +         + I  PYPY G 
Sbjct: 241 GAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGIPSPYPYGGN 300

Query: 309 LPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLSKEGWNS 359
            PF+++++K + PVL+LVCGP  +IS++SG KYDL QGP+ G+L+  GW++
Sbjct: 301 EPFTSLDSK-VRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGWDN 350

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/372 (43%), Positives = 231/372 (62%), Gaps = 26/372 (6%)

Query: 1   MLWKN---YVLS---SSRITRRLHKSPRKSSFSKNF-----FITGCLLTVGAVSSYLTYR 49
           MLWK+   +V+    SS + +R + S  K++  +        +   +  +GA  +   Y 
Sbjct: 1   MLWKSNGSFVIQRTISSMLWKRFYNSCSKANVQRRAPGRLPLVLCGVTALGAGCAAAEY- 59

Query: 50  YTSERENKH-ELSPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVE 108
               R N H ELS  YF KYKIS+++DID  H+LLE+TPL +Q+ NIW+L  A NLW+VE
Sbjct: 60  ---HRRNYHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVE 116

Query: 109 IKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPK 168
           IKQPE+MVVR YTPLPL  +   +++  L+DGDN  GKL  YIK+Y +GEVARWL  LPK
Sbjct: 117 IKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPK 176

Query: 169 GHIIEIRGPFIDYEFPHLPNELKRSRDCLYMDXXXXXXXXXXXXSQFIYQPYDIMMFTAG 228
           GHI+E+RGP+ ++EFP L  + KR R+                 +     P+DI +F AG
Sbjct: 177 GHIVEVRGPYPEFEFPELDADTKRDRE-------FSGRGRACVAAAARAGPFDIALFAAG 229

Query: 229 TGIVTALQLLLTESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDR-QT 287
           TGIVTALQLL TE PF+G I+LF++ K+  QLGPL  +L R    +RV L +FE+++ ++
Sbjct: 230 TGIVTALQLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGES 289

Query: 288 KQDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGP 347
            +  L  I   ++ P+P+    PF         PVL+LVCGP+ YI+ I+G ++ L+QGP
Sbjct: 290 LRLGLSKISDLVSGPFPFSENAPFE--QRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGP 347

Query: 348 VGGLLSKEGWNS 359
           V GLL  +GW++
Sbjct: 348 VTGLLGTKGWDN 359

>Kwal_55.21561
          Length = 349

 Score =  302 bits (773), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 215/334 (64%), Gaps = 20/334 (5%)

Query: 31  FITGCLLTVGAVSSYLTYRYTSERENKHELSPSYFVKYKISHKRDIDSSHFLLEVTPLFK 90
           F   CLL    ++ +    Y  +  +  ELS  YF +Y+IS+ + IDS HF+LE+TP+  
Sbjct: 24  FYAKCLLGGTIITGFGGVWYYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRP 83

Query: 91  QKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFY 150
           Q  N+W+LM ++ LWSV++KQPE+MVVRNYTPLPL+ +  S E ++L DGDN  GKLSFY
Sbjct: 84  QSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQ-HVGSGEFKVLADGDNGQGKLSFY 142

Query: 151 IKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNELKRSRDCLYMDXXXXXXXXXX 210
           +KKY+ GEVARWL  LP+GHI+E+RGP+IDYEFP + N  K  R  L+            
Sbjct: 143 LKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSFLW--------GAKP 194

Query: 211 XXSQFIYQPYDIMMFTAGTGIVTALQLLLTESPFRGTIKLFHTDKNIKQLGPLYPILLRL 270
              + + QP+DI  FTAGTGI   +QLLLTE PFRG I LFH+ +   +LGPL PIL  L
Sbjct: 195 SSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFPFRGRIHLFHSCRQKSELGPLGPILDVL 254

Query: 271 QASNRVQLKIFETD-----RQTKQDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLAL 325
           + +NRV+L  FE+      RQ   +VL  I      P  Y    PF+      I PVL+L
Sbjct: 255 RENNRVELNFFESSKGRDIRQISNEVLNLID----SPSQYLK-RPFTGFEGP-IKPVLSL 308

Query: 326 VCGPESYISSISGRKYDLNQGPVGGLLSKEGWNS 359
           +CGP+SYI++ISG KYD  QGP+ GLL ++GW++
Sbjct: 309 ICGPDSYITTISGPKYDHFQGPIEGLLGQKGWSN 342

>Scas_699.41
          Length = 318

 Score =  249 bits (635), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 187/306 (61%), Gaps = 41/306 (13%)

Query: 56  NKHELSPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVM 115
           ++ ELSP++F  YKIS+++DID+SH+LLE+TP   QK NIW  +    +WSVEIKQPE+M
Sbjct: 41  SRTELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIM 100

Query: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175
           VVRNYTP+PL F     ++  + D  N  GKL FY+K+Y NGEVARWLH LP    +EIR
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTD-KNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIR 159

Query: 176 GPFIDYEFPHLPNELKRSRDCLYMDXXXXXXXXXXXXSQFIYQPYDIMMFTAGTGIVTAL 235
           GPFIDY+F    N                               +D+ MFTAG G+VTA 
Sbjct: 160 GPFIDYKFQETDNT-----------------------------KFDVSMFTAGAGVVTAF 190

Query: 236 QLLLTESP---FRGTIKLFHTDKNIKQLGPLYPILLRLQASNR-VQLKIFETDRQTKQDV 291
           QLLL+ S    FRG+++LFH+  ++ +LGPL  I+  LQ  N  + +K FE++   K D 
Sbjct: 191 QLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESE---KGDD 247

Query: 292 LKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGL 351
           +++  KS+++ +P       S +   N+   LALVCGPE +I +++G   DL QGPVGG+
Sbjct: 248 IRTQLKSVSQLFPQ---FKPSQLGRSNLRQ-LALVCGPEGFIDTVAGASVDLEQGPVGGI 303

Query: 352 LSKEGW 357
           L + GW
Sbjct: 304 LKQNGW 309

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score =  226 bits (577), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 200/350 (57%), Gaps = 41/350 (11%)

Query: 20  SPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKH--------ELSPSYFVKYKIS 71
           SP K SFSK   I   ++   + S+++T+ Y    + K+        ELSP+ F +YKI+
Sbjct: 18  SPIKRSFSKRSIIGYSIIL--SASAFVTWTYKDLIKQKYVETFTKTKELSPNDFTEYKIT 75

Query: 72  HKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPAS 131
            + DID+ H+L+E+TPL +Q VN+W  +    LWS+E+KQPE+MVVRNYTPLPL+     
Sbjct: 76  RRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVRNYTPLPLQLKSNG 135

Query: 132 KEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNEL- 190
             + +  +      KL FYIK Y NGEVARW+  LP G  +E+RGPFIDY+F    N+L 
Sbjct: 136 NIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKF---RNDLS 192

Query: 191 KRSRDCLYMDXXXXXXXXXXXXSQFIYQPYDIMMFTAGTGIVTALQLLLTE-SPFRGTIK 249
           K  RD                 +Q    P+    F  GTGIVTALQ +L     F   + 
Sbjct: 193 KHHRDA--------NGSTLINKTQLSNVPF----FAGGTGIVTALQPILNPYGQFNYNMT 240

Query: 250 LFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSIQKSITKPYPYKGLL 309
           LFH+ K+I++LG LY ++  L   N++   +FET   +K D +            +K L+
Sbjct: 241 LFHSCKSIQELGCLYHLVNGLAQQNKITYHLFET---SKGDNI----------IDFKQLI 287

Query: 310 PFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLSKEGWNS 359
           P  N +N   +   ++VCGPE YI++++G KYD +QGP+ GLL ++GW++
Sbjct: 288 PGPNTSNAGNLDT-SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDN 336

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 109/292 (37%), Gaps = 71/292 (24%)

Query: 79  SHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILK 138
           SH     T     + ++  L TA  L +  +      V+R YTP+               
Sbjct: 71  SHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPV--------------- 115

Query: 139 DGDN-ADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNELKRSRDCL 197
             DN A G     IK Y+ G+    L  L +   +E +GP   + +   PN         
Sbjct: 116 -SDNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWD--PNMFDS----- 167

Query: 198 YMDXXXXXXXXXXXXSQFIYQPYDIMMFTAGTGIVTALQLL--LTESPFRGT-IKLFHTD 254
                                   I++  AGTGI    Q++  + E+P   T + L + +
Sbjct: 168 ------------------------IVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGN 203

Query: 255 KNIKQLGPLYPILLR-----LQASNRVQLKIFETDRQTKQDVLKSIQKSITKPYPYKGLL 309
           K  +       ILLR     L +    Q+K+     + + D  K  +  ITK +  K  L
Sbjct: 204 KTPQD------ILLRKELEELASKYPDQVKVTYFVDKPEGD-YKGEKGFITKDF-LKQNL 255

Query: 310 PFSNVNNKNIMPVLALVCGPESYISSISGRKYD-LNQGPVGGLLSKEGWNSD 360
           P    N+         VCGP  ++ + SG K    +QG V G+LS+ G+  D
Sbjct: 256 PTPGSNSH------IFVCGPPPFMDAFSGNKVSPSDQGQVTGVLSELGYTKD 301

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 110/286 (38%), Gaps = 63/286 (22%)

Query: 79  SHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILK 138
           SH     T    +K  +  L+TA  + +  +      V+R YTP+               
Sbjct: 61  SHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNVIRPYTPV--------------- 105

Query: 139 DGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNELKRSRDCLY 198
             +   GK+   +K YENG+    L  L +   +  +GP   +E+   PN          
Sbjct: 106 SDNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWK--PNS--------- 154

Query: 199 MDXXXXXXXXXXXXSQFIYQPYD-IMMFTAGTGIVTALQLL--LTESPFRGT-IKLFHTD 254
                                YD I +  AGTGI    QL+  + E+P   T I L++ +
Sbjct: 155 ---------------------YDSITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGN 193

Query: 255 KNIKQLGPLYPILLRLQASNRVQLKI-FETDRQTKQDVLKSIQKSITKPYPYKGLLPFSN 313
           K  + +  L   L  LQ     Q+KI +  D+   +   +     ITK Y        S+
Sbjct: 194 KTPEDI-LLKSELDNLQKKYPDQVKITYFVDKA--EGNFEGETGFITKDY-------LSH 243

Query: 314 VNNKNIMPVLALVCGPESYISSISGRKYD-LNQGPVGGLLSKEGWN 358
              K        VCGP  ++ + SG K    +QG + G+L++ G++
Sbjct: 244 QAPKPSEKNQVFVCGPPPFMKAYSGPKVSPQDQGELTGILAELGYS 289

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 85/236 (36%), Gaps = 63/236 (26%)

Query: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175
           + R+YTP  L             DGD   G     +K Y  G V++ +  L  G  I+I+
Sbjct: 126 ITRSYTPTSL-------------DGDTK-GNFELLVKSYPTGNVSKMIGELKIGDSIQIK 171

Query: 176 GPFIDYEFPHLPNELKRSRDCLYMDXXXXXXXXXXXXSQFIYQPYDIMMFTAGTGIVTAL 235
           GP  +Y +          R+C                         + M   GTGI    
Sbjct: 172 GPRGNYHY---------ERNCR----------------------SHLGMIAGGTGIAPMY 200

Query: 236 QLL--LTESPFRGTIKLFHTDKNIKQLGPLYPILLR-LQASNRVQLKIF----ETDRQTK 288
           Q++  +   P   T K+     N+ +   L    L  L A    Q KI       DR+  
Sbjct: 201 QIMKAIAMDP-HDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDW 259

Query: 289 QDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLN 344
              +  I K + K +     LP + ++N  I     L+CGP + ++S+     DL 
Sbjct: 260 TGGVGYITKDVIKEH-----LPAATMDNVQI-----LICGPPAMVASVRRSTVDLG 305

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 17/76 (22%)

Query: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176
           VR YTP+  KF               A+G     +K Y +G+V++W   L  G  +E +G
Sbjct: 119 VRYYTPISNKF---------------AEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKG 163

Query: 177 PFIDYEFPHLPNELKR 192
           P     F ++ N  K+
Sbjct: 164 PV--GRFSYVTNAYKK 177

>Kwal_23.5471
          Length = 312

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 76/339 (22%), Positives = 130/339 (38%), Gaps = 72/339 (21%)

Query: 33  TGCLLTVGAVSSYLTYRYTSEREN---KHELSPSYFVKYKISHKRDI--DSSHFLLEVTP 87
           T   L VG+ +    Y ++    N   K       +V+  I+   D+  D+  F+  +  
Sbjct: 30  TALPLAVGSAALAAAYLHSRPLHNEPLKTFTGDDSWVELPIAKIEDVSHDTRRFVFSLP- 88

Query: 88  LFKQKVNIWSLMTAENLWSVEIKQPE-VMVVRNYTPLPLKFNPASKEIEILKDGDNADGK 146
              Q+  +  L+TA  L + +++ P+   V+R YTP+                  +  G 
Sbjct: 89  ---QEDQVSGLITASALLA-KLQTPKGSNVIRPYTPV---------------SDVSTKGH 129

Query: 147 LSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNELKRSRDCLYMDXXXXXX 206
           + F IK Y+ G++   L        +  +GP I +E+   PN                  
Sbjct: 130 IEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWK--PNSFD--------------- 172

Query: 207 XXXXXXSQFIYQPYDIMMFTAGTGIVTALQLL--LTESPFRGT-IKLFHTDKNIKQLGPL 263
                          I +  AG+GI    QLL  ++++P   T I L + +K    +  L
Sbjct: 173 --------------SITLIGAGSGITPLYQLLHHISQNPEDKTKIHLLYGNKTPNDIL-L 217

Query: 264 YPILLRLQASNRVQLKI-FETDRQTKQDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPV 322
              L  +QA    Q+KI F  D+   +         ITK +  K +   S  N       
Sbjct: 218 KKELEEVQAKYADQVKIHFFVDKA--EGPFDGEIGFITKEFLEKNVPKASEKNQ------ 269

Query: 323 LALVCGPESYISSISGRKYD-LNQGPVGGLLSKEGWNSD 360
              VCGP  ++ + SG K    +QG + G+L   G++ +
Sbjct: 270 -VFVCGPPPFMQAYSGPKVSPKDQGELTGILKDLGFSKE 307

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 14/62 (22%)

Query: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175
           +VR+YTP  L             D D A G     IK YE G +++ +  L  G  I++R
Sbjct: 91  IVRSYTPTSL-------------DSD-ATGHFELLIKSYEKGNISKMIGELKIGDRIKVR 136

Query: 176 GP 177
           GP
Sbjct: 137 GP 138

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 17/77 (22%)

Query: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175
           ++R+YTP  L                +A G     +K YE G +++ L  L  G  I++R
Sbjct: 91  MLRSYTPTSLD--------------SDATGYFELLVKSYEKGNISKMLAELAIGDRIKVR 136

Query: 176 GP--FIDYEFPHLPNEL 190
           GP  F  YE P++  E+
Sbjct: 137 GPKGFYHYE-PNMYKEI 152

>Kwal_47.18159
          Length = 287

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 72/170 (42%), Gaps = 27/170 (15%)

Query: 26  FSKNFFITGCLLTVGAVSSYLTYRYTSERENKHELSPSYFVKYKISHKRDIDSSHFLLEV 85
           FS    + G L+ +GAV  Y   +  S + +K  L    F ++ +  K        L   
Sbjct: 6   FSLKTILIGGLIALGAV--YFVSQLLSSKASKPILLKDEFQEFPLVSKT------VLTHN 57

Query: 86  TPLFK----QKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGD 141
           T +++    +  ++  L   +++      +    ++R+YTP  L             D D
Sbjct: 58  TAVYRFGLPKHTDVLGLPIGQHISIQGTLKDGKEIMRSYTPTSL-------------DSD 104

Query: 142 NADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEF-PHLPNEL 190
           +  G     IK YE G V++ +  L  G  I++RGP   Y + P++ +E+
Sbjct: 105 SV-GFFELLIKSYEQGNVSKMIGELQIGDKIKVRGPKGFYTYTPNMNSEI 153

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 44/125 (35%), Gaps = 52/125 (41%)

Query: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176
           VRNY P+  +F                 G +   +K Y++G+V+++   +  G  ++ RG
Sbjct: 121 VRNYNPISTRFE---------------KGHIDLLVKSYKDGKVSKYFASMKPGETVDFRG 165

Query: 177 PFIDYEFPHLPNELKRSRDCLYMDXXXXXXXXXXXXSQFIYQP---YDIMMFTAGTGIVT 233
           P                                      +Y+P    +I M   G+GI  
Sbjct: 166 PV----------------------------------GSLVYKPNTYKNIGMVCGGSGITP 191

Query: 234 ALQLL 238
           ALQ+L
Sbjct: 192 ALQML 196

>Scas_704.43
          Length = 316

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 36/195 (18%)

Query: 5   NYVLSSSRITRRLHKSPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKHELSPSY 64
           N   + S  T  +  +   ++F+++  I    +        L  RY S R   H  +   
Sbjct: 14  NTATADSAPTENIRPTGEANAFNRSTLIPVVFILA------LAIRYISMRRRIH--ANKA 65

Query: 65  FVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVM--------V 116
            +K    HK  + S   L   T ++      + L  A+++  + I Q   +        +
Sbjct: 66  VLKKGTFHKFCLVSKTVLTHNTAIYN-----FGLPNADDVLGLPIGQHISIKENIDGKDI 120

Query: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176
           +R+YTP  L                   G     +K Y NG +++++ +L  G  I + G
Sbjct: 121 MRSYTPTSLD--------------SETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCG 166

Query: 177 PFIDYEF-PHLPNEL 190
           P  +Y + P+  N+L
Sbjct: 167 PAGNYHYEPNCRNKL 181

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 17/77 (22%)

Query: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175
           ++R+YTP  L             D D A G     IK YE G +++    L  G  I++R
Sbjct: 87  ILRSYTPTSL-------------DSD-AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVR 132

Query: 176 GP--FIDYEFPHLPNEL 190
           GP  F  Y+ P++  E+
Sbjct: 133 GPKGFYHYQ-PNMNEEI 148

>CAGL0H03487g 324020..325627 similar to sp|P22149 Saccharomyces
           cerevisiae YGL071w RCS1 iron-regulated transcriptional
           repressor, start by similarity
          Length = 535

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 105 WSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLH 164
           +S++ K+  V+V+ N    PLKFNP S+E +  K+   AD  +   IK ++  E  R  H
Sbjct: 105 YSLKRKKWSVVVLNNTHTHPLKFNPLSEEYKKFKEKLRADNDVD-AIKMFDELEY-RTQH 162

Query: 165 HLP 167
           +LP
Sbjct: 163 NLP 165

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 324 ALVCGPESYISSISGRKYD-LNQGPVGGLLSKEGWNSD 360
             VCGP  ++ S+SG+K   + QG + G L   G++ D
Sbjct: 256 VFVCGPPPFMDSLSGQKKSPMEQGDLTGALKDLGYSQD 293

>Scas_692.6
          Length = 314

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 127 FNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHL 186
           +NP S +++         G     IK Y +G+V+++   L  G  +E +GP    E  + 
Sbjct: 126 YNPISSKLDT--------GHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPI--GELHYA 175

Query: 187 PNELK 191
           PN  K
Sbjct: 176 PNSSK 180

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 10/58 (17%)

Query: 127 FNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPF--IDYE 182
           +NP S ++E         G L   +K Y +G+V+++   L  G  ++ +GP   ++YE
Sbjct: 124 YNPISSKLE--------SGYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNYE 173

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 15/61 (24%)

Query: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176
           +R YTP+  +++                G     +K Y +G+V+++   L  G ++E +G
Sbjct: 119 IRYYTPITQRYD---------------TGHFDIIVKSYTDGKVSKYFASLKPGQLVEFQG 163

Query: 177 P 177
           P
Sbjct: 164 P 164

>Kwal_33.14260
          Length = 308

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 15/61 (24%)

Query: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176
           +R YTP+  ++ P               G     +K Y +G+V+++   L  G  ++ +G
Sbjct: 117 IRYYTPVSPQYQP---------------GYFDIIVKSYADGQVSKYFAGLKAGSAVDFKG 161

Query: 177 P 177
           P
Sbjct: 162 P 162

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 23/42 (54%)

Query: 142 NADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEF 183
           N +G L   +K Y++G V+++   L     +E +GP  + E+
Sbjct: 131 NTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEY 172

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 26/61 (42%), Gaps = 15/61 (24%)

Query: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176
           +R YTP+  KF                 G     +K Y +G+V+++   L  G  ++ +G
Sbjct: 119 IRYYTPISNKFET---------------GHFDIMVKSYADGQVSKYFASLRPGQTVDFKG 163

Query: 177 P 177
           P
Sbjct: 164 P 164

>Scas_678.6
          Length = 299

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 325 LVCGPESYISSISGRKYD-LNQGPVGGLLSKEGWNSD 360
            +CGP  ++ + SG K    +QG + GLL + G++ D
Sbjct: 258 FICGPPPFMKAYSGEKAKPTDQGELTGLLQELGYSKD 294

>Scas_720.21
          Length = 670

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 105 WSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGE 158
           +S++ K+  ++V+ N    PLKFNP S+E +  K     DG L   IKK++  E
Sbjct: 229 YSLKRKKWNIVVINNTHSHPLKFNPDSEEYKKFKLKLREDGDLE-AIKKFDELE 281

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 325 LVCGPESYISSISG-RKYDLNQGPVGGLLSKEGWNSD 360
            VCGP  ++++ SG +K   +QG + G+L+  G++ D
Sbjct: 261 FVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGYSKD 297

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein
           of unknown function, has weak similarity to
           uncharacterized C. albicans Orf6.3079p [4689 bp, 1562
           aa]
          Length = 1562

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 253 TDKNIKQLGPLYPILLRLQAS--NRVQLKIFETDRQTKQDVLKSIQKSITKPYP 304
           T KNI ++ P+ P +L L A+  +     I+  D+ +K+ VLK +  S T P P
Sbjct: 299 TSKNILKVCPVLPSILNLLATLDDYEDGTIWSYDKSSKEKVLKFLSVSRTSPSP 352

>KLLA0D03256g complement(271036..273507) some similarities with
           sp|P22149 Saccharomyces cerevisiae YGL071w RCS1
           iron-regulated transcriptional repressor, hypothetical
           start
          Length = 823

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 105 WSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYE 155
           +S++ K+  ++VV N    PLKFNP S++ +  K+     G L   +KK++
Sbjct: 237 FSLKRKKWNIVVVNNVHTHPLKFNPDSEDYKKFKNALKESGDLE-TVKKFD 286

>Scas_690.14
          Length = 533

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 9/58 (15%)

Query: 105 WSVEIKQPEVMVVRNYTPLPLKFNPASKEI----EILKDGDNADGKLSFYIKKYENGE 158
           +S+++K+  ++VV N     LKFNP S E     + LK+ D+ D      IKK+E  E
Sbjct: 190 FSIKLKKWNIVVVNNSHSHDLKFNPNSDEYKKFKDYLKNSDDFD-----TIKKFEELE 242

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,072,112
Number of extensions: 521227
Number of successful extensions: 1337
Number of sequences better than 10.0: 39
Number of HSP's gapped: 1336
Number of HSP's successfully gapped: 43
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)