Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR036W (PEP12)28826813120.0
Scas_699.403112776165e-79
Sklu_1710.22792526121e-78
CAGL0I01012g2822556112e-78
KLLA0E21857g2752485372e-67
Kwal_55.215572712535284e-66
ACR092C2742505206e-65
AFL232W301851204e-07
KLLA0C13233g2621921132e-06
KLLA0A10681g3642231133e-06
Scas_607.2417751063e-05
YOL018C (TLG2)397721044e-05
Sklu_2407.11276821035e-05
Sklu_2256.2377731019e-05
CAGL0G08932g367741001e-04
AEL026C34972964e-04
Kwal_34.1628736272920.001
Kwal_26.8414260119900.002
CAGL0G04807g24587890.002
Scas_697.4428174880.004
YOR106W (VAM3)28369690.72
CAGL0K02431g92453700.89
Scas_544.648982653.3
Sklu_2338.5307115643.4
Scas_720.3231072634.8
KLLA0C14168g16137607.0
YKL003C (MRP17)131102598.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR036W
         (284 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...   509   0.0  
Scas_699.40                                                           241   5e-79
Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement         240   1e-78
CAGL0I01012g complement(82834..83682) similar to sp|P32854 Sacch...   239   2e-78
KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces...   211   2e-67
Kwal_55.21557                                                         207   4e-66
ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...   204   6e-65
AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH] complement(...    51   4e-07
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    48   2e-06
KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces c...    48   3e-06
Scas_607.2                                                             45   3e-05
YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin ...    45   4e-05
Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement      44   5e-05
Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement         44   9e-05
CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces c...    43   1e-04
AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH] (585366..58...    42   4e-04
Kwal_34.16287                                                          40   0.001
Kwal_26.8414                                                           39   0.002
CAGL0G04807g complement(458085..458822) similar to sp|Q12241 Sac...    39   0.002
Scas_697.44                                                            39   0.004
YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog (t...    31   0.72 
CAGL0K02431g complement(219027..221801) highly similar to sp|P30...    32   0.89 
Scas_544.6                                                             30   3.3  
Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement         29   3.4  
Scas_720.32                                                            29   4.8  
KLLA0C14168g 1226143..1226628 no similarity, hypothetical start        28   7.0  
YKL003C (MRP17) [3254] chr11 complement(436740..437135) Mitochon...    27   8.1  

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/268 (95%), Positives = 256/268 (95%)

Query: 1   MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDR 60
           MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDR
Sbjct: 1   MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDR 60

Query: 61  GDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVS 120
           GDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVS
Sbjct: 61  GDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVS 120

Query: 121 YSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIV 180
           YSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIV
Sbjct: 121 YSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIV 180

Query: 181 IERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANI 240
           IERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKD            DNIEANI
Sbjct: 181 IERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANI 240

Query: 241 YTTSDNTQLASDELRKAMRYQKRTSRWR 268
           YTTSDNTQLASDELRKAMRYQKRTSRWR
Sbjct: 241 YTTSDNTQLASDELRKAMRYQKRTSRWR 268

>Scas_699.40
          Length = 311

 Score =  241 bits (616), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 186/277 (67%), Gaps = 12/277 (4%)

Query: 4   DEFFGGD--NEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRG 61
           DE  GGD  + + ++   F DSPEFQ+LKE + A+LFEINGQI TLQQFT++L++ +  G
Sbjct: 19  DEQVGGDPSDPSDFHLKPFKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTG 78

Query: 62  DVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSY 121
            +  KVVE + KR+   I  +  L+K+ N  V+++D+++   LDK QII REKLVRDV Y
Sbjct: 79  QIRTKVVENVIKRASTNIHNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRY 138

Query: 122 SFQEFQGIQRQFTQVMKQVNERAKESL--------EASEMANDAALLDEEQRQNSSKSTR 173
           S  EFQ  Q+++TQ++K +N++ K +L           + +N AAL  E+ RQ   +  +
Sbjct: 139 SINEFQETQKEYTQLVKSINDKNKSALLQDQSVKNYTDDDSNKAALSQEQDRQEQLQQQQ 198

Query: 174 IPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXX 233
               +I+  R+PINNEEFAYQQNLI++RD+EI+NIE+GITELNE+FKD            
Sbjct: 199 QQHVEII--REPINNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMV 256

Query: 234 DNIEANIYTTSDNTQLASDELRKAMRYQKRTSRWRVY 270
           DNIEAN+Y+  DNTQ+AS EL +A R QK +++W +Y
Sbjct: 257 DNIEANLYSVHDNTQMASKELNRARRSQKVSTKWCLY 293

>Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement
          Length = 279

 Score =  240 bits (612), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 169/252 (67%), Gaps = 3/252 (1%)

Query: 19  RFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAK 78
           RF DSPEF+    E++A+LFE+NG +STLQQF  TL++  ++G V+ K VE INK++V+ 
Sbjct: 13  RFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENINKKAVSY 72

Query: 79  IEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMK 138
              I  L K +N  V K+DAIEE SLD++Q+I+REKL RDV YS Q FQ +Q +F +  K
Sbjct: 73  TNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQSEFAKTTK 132

Query: 139 QVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLI 198
            +N +AK +L   E   D  L +E +        +     +VIER+PINNEEFAYQQNLI
Sbjct: 133 LINNKAKSALVKEEQGLDEVLREELE---DQHQQQQQQKSVVIEREPINNEEFAYQQNLI 189

Query: 199 EQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKAM 258
            +RD+EISNIERGI+ELN +F+D            DNIE NIY+  ++TQ A+ EL KAM
Sbjct: 190 RERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAARELNKAM 249

Query: 259 RYQKRTSRWRVY 270
           + Q+R+S+W +Y
Sbjct: 250 KSQRRSSKWCLY 261

>CAGL0I01012g complement(82834..83682) similar to sp|P32854
           Saccharomyces cerevisiae YOR036w PEP12 syntaxin, start
           by similarity
          Length = 282

 Score =  239 bits (611), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 130/255 (50%), Positives = 178/255 (69%), Gaps = 6/255 (2%)

Query: 20  FSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGD--VSAKVVERINKRSVA 77
           F D P F+ LK+++++ELFE+NG++STL+QFT +L  F+D  D  V+A VV+ INK+++ 
Sbjct: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72

Query: 78  KIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVM 137
            IE +  L+K VN  VK++D IE++ LDK QIIAR+KL+RD  +S QE Q  Q+QF++++
Sbjct: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132

Query: 138 KQVNERAKESLEASEMANDAALL--DEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQ 195
           K +N  A+  L  +E  N  ALL  DEE  Q ++ +T       VIER+PINNEEFAYQQ
Sbjct: 133 KSINAEARGKL--NEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAYQQ 190

Query: 196 NLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELR 255
            LI++RD+EI+NIERGITELN +FKD            DNIEANIY+  +NT  AS EL 
Sbjct: 191 RLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELN 250

Query: 256 KAMRYQKRTSRWRVY 270
           KA R QKR+SR+ +Y
Sbjct: 251 KANRMQKRSSRYCLY 265

>KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces
           cerevisiae YOR036w PEP12 syntaxin (T-SNARE), vacuolar,
           hypothetical start
          Length = 275

 Score =  211 bits (537), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 166/248 (66%), Gaps = 4/248 (1%)

Query: 19  RFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAK 78
           ++ DSPEF+   + ++ +LFE+NG +ST+  F   L++ +  G  + KV++ INK++V  
Sbjct: 10  QYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNINKKTVEL 69

Query: 79  IEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMK 138
           I++   L+  +N ++ K++ +EE++LDK  +I REKL RD  +S QEF+  Q+ F +V K
Sbjct: 70  IDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFLEVTK 129

Query: 139 QVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLI 198
           ++N+ AK +LE  E  N  +L+D   R+   +  +   +Q+VIER+PINNEEFAYQQ+LI
Sbjct: 130 RINDMAKVALEDEEQNN--SLMDTVLREEEDEHAK--RTQVVIEREPINNEEFAYQQHLI 185

Query: 199 EQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKAM 258
            +RDQEISNIE+GITELN +FKD            D+IEAN+Y   DNT+ A++EL +AM
Sbjct: 186 RERDQEISNIEQGITELNGIFKDLGGLVQQQGQLVDSIEANLYNVEDNTRNAANELSRAM 245

Query: 259 RYQKRTSR 266
           R  + +S+
Sbjct: 246 RSGRSSSK 253

>Kwal_55.21557
          Length = 271

 Score =  207 bits (528), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 111/253 (43%), Positives = 164/253 (64%), Gaps = 11/253 (4%)

Query: 17  GSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSV 76
              FSD+P+F+   +++   LFE+NG +STLQQF  TL+    +G+  +K++  ++K+SV
Sbjct: 11  APHFSDNPQFEEWVDKIMNNLFEMNGHLSTLQQFIKTLQKNQSQGNTRSKMIANLDKKSV 70

Query: 77  AKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQV 136
             I  I  L+K +N+ V K++ IEE  LD+ Q+I+R+KL RDV YS QEFQ  Q++FT  
Sbjct: 71  YHINAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRDVKYSVQEFQEAQKEFTST 130

Query: 137 MKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQN 196
            K +N +AK++L            DEE R+++  +++    QI IER+ INNEEFAYQQ 
Sbjct: 131 SKVMNAQAKQALAE----------DEETREDNVINSK-SQEQITIEREAINNEEFAYQQR 179

Query: 197 LIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRK 256
           LI++RD+EI++IE GI ELN++F D            DNIE+NIYT ++NTQ  + EL K
Sbjct: 180 LIQERDEEIAHIESGIEELNDIFHDLGTIVQQQGYLVDNIESNIYTVANNTQSGARELTK 239

Query: 257 AMRYQKRTSRWRV 269
           AMR Q+ +S W +
Sbjct: 240 AMRSQRSSSIWCI 252

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score =  204 bits (520), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 153/250 (61%), Gaps = 7/250 (2%)

Query: 18  SRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVA 77
           +R+SD+P+F+    ++ + LFE+NGQ+ T Q F   L+S    G  +  VVE I+ RS+ 
Sbjct: 12  ARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTMVVENISNRSME 71

Query: 78  KIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVM 137
            I ++  L+K +N  V  ++AI +  LD+TQ+  REKL RD+  S QEFQ  Q +F  + 
Sbjct: 72  VIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRCQSEFAGIR 131

Query: 138 KQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNL 197
           KQ+NE+AK SL   +     A           +        IVIER+PINNEEFAYQQ L
Sbjct: 132 KQINEQAKISLSEQQEEAAGA-------AALEEEAAQQQHHIVIEREPINNEEFAYQQEL 184

Query: 198 IEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKA 257
           I +RD+EI+NIERGI ELNEVF+D            D+IE NIYT   +T  AS+EL +A
Sbjct: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244

Query: 258 MRYQKRTSRW 267
           +RYQ+R++RW
Sbjct: 245 LRYQRRSNRW 254

>AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH]
           complement(5332..6237) [906 bp, 301 aa]
          Length = 301

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%)

Query: 178 QIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIE 237
           QI+ +++ +  EE  +   + E R QEISNI   + ++N +FK             D I+
Sbjct: 191 QILRQQEHVPQEELDFHSLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQVDTID 250

Query: 238 ANIYTTSDNTQLASDELRKAMRYQK 262
           +NI   + N Q A+  LRKA RYQ+
Sbjct: 251 SNINGLTSNLQGANQHLRKAERYQR 275

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 23/192 (11%)

Query: 90  NTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLE 149
           N  + ++  I     D T +  ++K  RD       FQ + +Q+  V      RA ++  
Sbjct: 59  NRVIPEIQKISRKLADLTSLDTQDKFARD-------FQALSKQYNSVKTDYENRAVQNPI 111

Query: 150 ASEMAND---AALL----------DEEQRQNSSKSTRIPGSQIVIERDPI-NNEEFAYQQ 195
             E + D     L+          D E+R +SS+ T +  S    +++P+ N +E  +  
Sbjct: 112 PDEESKDNESEHLVSQYESMPIQDDIERRDHSSEDTPLLLS--TQQQEPLLNQDELDFHT 169

Query: 196 NLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELR 255
            +  +R Q+IS I   + E+N +FK             D I  N+   S+N Q A+ EL 
Sbjct: 170 IIQHERSQDISKIHSAVQEVNAIFKQLGSLVQEQGEQVDTIGENVTGLSNNLQKANKELH 229

Query: 256 KAMRYQKRTSRW 267
           KA  YQ++ +R 
Sbjct: 230 KANEYQRKKNRC 241

>KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 364

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 99/223 (44%), Gaps = 44/223 (19%)

Query: 68  VERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKL-------VRDVS 120
           +E+I+ + + + +E  G+IK + T +K         L K ++   + L       V+D S
Sbjct: 107 IEQISFQVIKRFQECFGVIKTL-TRIKDSQYSNGKQLSKDELRILDNLEKNYALKVQDKS 165

Query: 121 YSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIV 180
             F+  Q    +F      +N+   + L  ++ +ND  +L EE+                
Sbjct: 166 QKFRILQNNHLKF------LNKDDFKPLPTTKSSNDTLMLLEEE---------------- 203

Query: 181 IERDPINN-EEFAYQ-------------QNLIEQRDQEISNIERGITELNEVFKDXXXXX 226
           +E D +NN + ++ Q             Q  ++QRD+EI+ + +G+ E++ +F++     
Sbjct: 204 VEGDEVNNIDSYSKQTLQKQNQKLQDNNQQFLQQRDEEITQLAKGVLEVSTIFREMQSLI 263

Query: 227 XXXXXXXDNIEANIYTTSDNTQLASDELRKAMRYQKRTSRWRV 269
                  D I+ N+  T    + A  EL KA  YQKR+ + ++
Sbjct: 264 IDQGTVVDRIDYNLENTVIELKQAQKELDKATHYQKRSQKCKI 306

>Scas_607.2
          Length = 417

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%)

Query: 195 QNLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDEL 254
           Q  ++QRD+EI+ + +G+ E++ +F++            D I+ N+  T+   + A+ EL
Sbjct: 242 QQFLQQRDEEITQLAKGVLEVSTIFREMQGLIIDQGTVVDRIDYNLQNTTIQLKEANKEL 301

Query: 255 RKAMRYQKRTSRWRV 269
            +A  YQKRT + ++
Sbjct: 302 GQATVYQKRTQKCKI 316

>YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [1194 bp, 397 aa]
          Length = 397

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%)

Query: 198 IEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKA 257
           + +RD+EI+ + RG+ E++ +F++            D I+ N+  T    + A  EL KA
Sbjct: 247 LRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKA 306

Query: 258 MRYQKRTSRWRV 269
             YQKRT + +V
Sbjct: 307 THYQKRTQKCKV 318

>Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement
          Length = 276

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%)

Query: 186 INNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSD 245
           ++ +E  +   + ++R QEIS I   + E+N +F              D I+ NI    +
Sbjct: 174 LSQDELDFHSIIQQERSQEISRIHSAVQEVNAIFHQLGTLVQEQGEQVDTIDNNISGLGN 233

Query: 246 NTQLASDELRKAMRYQKRTSRW 267
           N Q A+D+L  A RYQ++ +R 
Sbjct: 234 NLQKANDQLANAERYQRKKNRC 255

>Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement
          Length = 377

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%)

Query: 197 LIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRK 256
            ++QR++EI+ + RG+ E++ +F++            D I+ N+  T    + A  EL +
Sbjct: 244 FLQQREEEITELARGVLEVSTIFREMQNLIIDQGTVVDRIDYNLENTVIELKQAQKELDR 303

Query: 257 AMRYQKRTSRWRV 269
           A  YQKRT + +V
Sbjct: 304 ATHYQKRTQKCKV 316

>CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 367

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%)

Query: 196 NLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELR 255
           N +  RD+EI+ + +G+ E++ +F++            D I+ N+  T    + A +EL 
Sbjct: 236 NYLHVRDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRIDYNLENTVIELKSAQNELN 295

Query: 256 KAMRYQKRTSRWRV 269
           KA  YQKRT + ++
Sbjct: 296 KATTYQKRTQKCKI 309

>AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH]
           (585366..586415) [1050 bp, 349 aa]
          Length = 349

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%)

Query: 198 IEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKA 257
           +E RD EI+ + +G+ +++ +F++            D I+ N+  T+ + + A  EL +A
Sbjct: 236 LEDRDAEITQLAKGVLKVSTIFREMQTLILDQGTVVDRIDYNLENTNIDLKQAQRELDQA 295

Query: 258 MRYQKRTSRWRV 269
           + YQKRT + +V
Sbjct: 296 VGYQKRTQKCKV 307

>Kwal_34.16287
          Length = 362

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%)

Query: 198 IEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKA 257
           ++QR+QEI+ + RG+ E++ +F++            D I+ N+  T    + A  EL +A
Sbjct: 230 LQQREQEITQLARGVLEVSSIFREMQDLVVDQGTIIDRIDYNLENTVLELKGAQRELDRA 289

Query: 258 MRYQKRTSRWRV 269
             YQ R+ + +V
Sbjct: 290 TVYQTRSQKCKV 301

>Kwal_26.8414
          Length = 260

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 14/119 (11%)

Query: 149 EASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNI 208
           EA+ +  + A L + QRQ  ++ST             ++ +E  +   + ++R +EIS I
Sbjct: 135 EATPLLQERAQL-QAQRQEQTQST-------------VSQDELNFHTLVQQERSEEISRI 180

Query: 209 ERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKAMRYQKRTSRW 267
              + E+N +F              DNI+ NI   + N Q A+++L KA + Q++ +R 
Sbjct: 181 HSAVQEVNAIFHQLGTLVREQGDDVDNIDNNISGLAGNLQRANEQLGKADQSQRKKNRC 239

>CAGL0G04807g complement(458085..458822) similar to sp|Q12241
           Saccharomyces cerevisiae YOR106w VAM3 syntaxin,
           hypothetical start
          Length = 245

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%)

Query: 181 IERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANI 240
           +E+  IN++E  +   + E R ++IS I   + E+N +FK             D ++ NI
Sbjct: 139 MEQGLINDDELDFHTIVQEDRSRQISRIHSSVQEVNAIFKQLGTLVREQGTQVDTVDENI 198

Query: 241 YTTSDNTQLASDELRKAMRYQKRTSRW 267
               +N   A+++L +A  +Q++ +R 
Sbjct: 199 ANFDNNMHRANEQLNRADEHQRQRNRC 225

>Scas_697.44
          Length = 281

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 195 QNLIEQ-RDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDE 253
           Q +I+Q R Q+IS I   + E+N +F              D I+ NI   S N Q A ++
Sbjct: 187 QTIIQQERSQQISRIHTAVKEVNAIFHQLGSLVQEQGEQVDTIDGNISQLSGNMQKADEQ 246

Query: 254 LRKAMRYQKRTSRW 267
           LR+A   Q++ +R 
Sbjct: 247 LRRADENQRQRNRC 260

>YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog
           (t-SNARE), required for vacuolar assembly [852 bp, 283
           aa]
          Length = 283

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 195 QNLIEQ-RDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDE 253
           Q +I Q R Q+I  I   + E+N +F                I+ NI    DN Q A+ +
Sbjct: 189 QTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQ 248

Query: 254 LRKAMRYQK 262
           L +A ++Q+
Sbjct: 249 LTRADQHQR 257

>CAGL0K02431g complement(219027..221801) highly similar to sp|P30665
           Saccharomyces cerevisiae YPR019w Cell division control
           protein, start by similarity
          Length = 924

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%)

Query: 113 EKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQR 165
           E L R++    +E+      F +++KQ+NE+A++ +E S++++  + L +E +
Sbjct: 854 EDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSRLQQEDK 906

>Scas_544.6
          Length = 489

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 129 IQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINN 188
           +QR   +   Q+ +  K S+E ++  N   + DE+ R  SS    +    I++ +DP+ N
Sbjct: 385 LQRIVNEPSPQLPKTDKFSVEMTDFVNRCCVKDEKDR--SSIHELLVHDFILMYKDPLYN 442

Query: 189 EEFAYQQNLIEQRDQEISNIER 210
            EF +   +I+   ++   I+R
Sbjct: 443 REFRHWCKMIKSYIKQDKQIKR 464

>Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement
          Length = 307

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 51/115 (44%), Gaps = 14/115 (12%)

Query: 157 AALLDEEQ--RQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITE 214
           ++L+DE+Q  RQN + S     S +++E    NN         +++R++ +  IE  I E
Sbjct: 183 SSLVDEDQQPRQNGTLSLPQESSMLLLEEQAANN-------TYLQERNRAVETIESTIQE 235

Query: 215 LNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKAMRYQKRTS--RW 267
           +  +F+               I+AN+     N   A  EL   ++Y  R S  RW
Sbjct: 236 VGNLFQQLAHMVQEQGETIQRIDANVEDIDLNISGAQREL---IKYFDRVSSNRW 287

>Scas_720.32
          Length = 310

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 33/72 (45%)

Query: 198 IEQRDQEISNIERGITELNEVFKDXXXXXXXXXXXXDNIEANIYTTSDNTQLASDELRKA 257
           ++QR QE+  +E+ + ELN++F D            D I+ N+     + +       KA
Sbjct: 212 VQQRHQELLQLEKSMAELNQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGYTNKA 271

Query: 258 MRYQKRTSRWRV 269
           +   +R  R ++
Sbjct: 272 VDSARRARRNKI 283

>KLLA0C14168g 1226143..1226628 no similarity, hypothetical start
          Length = 161

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 162 EEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLI 198
           EEQR N    T I  S + + RD     +F+Y+QN++
Sbjct: 104 EEQRTNKVNYTAISFSILSLNRDYCLQAQFSYRQNIL 140

>YKL003C (MRP17) [3254] chr11 complement(436740..437135)
           Mitochondrial ribosomal protein of the small subunit
           [396 bp, 131 aa]
          Length = 131

 Score = 27.3 bits (59), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 79  IEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMK 138
           + E+ GL++  N++  K++A E +S     II    +VRD+        GI R   ++MK
Sbjct: 2   LYELIGLVRITNSNAPKLEAKELSSTIGKLIIQNRGVVRDIVP-----MGI-RYLPKIMK 55

Query: 139 QVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIV 180
           +  E+   +     + + +A +  E  +   K  R+  S IV
Sbjct: 56  KDQEKHFRAYHFLMLFDSSAAVQSEILRTLKKDPRVIRSSIV 97

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,597,368
Number of extensions: 289177
Number of successful extensions: 1310
Number of sequences better than 10.0: 127
Number of HSP's gapped: 1301
Number of HSP's successfully gapped: 130
Length of query: 284
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 184
Effective length of database: 13,134,309
Effective search space: 2416712856
Effective search space used: 2416712856
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)