Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR035C (SHE4)78977540700.0
Scas_699.3776876917920.0
CAGL0I01034g78379115930.0
KLLA0E16742g66163310171e-128
AER389C75870910211e-127
Kwal_55.199912752846174e-74
KLLA0A07997g57593694.0
KLLA0E05137g817173668.9
Scas_705.38105170669.1
YBR133C (HSL7)82747669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR035C
         (775 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein r...  1572   0.0  
Scas_699.37                                                           694   0.0  
CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces cer...   618   0.0  
KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534 Saccha...   396   e-128
AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH] (1367924..1...   397   e-127
Kwal_55.19991                                                         242   4e-74
KLLA0A07997g 711231..712958 similar to sp|P06779 Saccharomyces c...    31   4.0  
KLLA0E05137g complement(456708..459161) similar to sp|Q06708 Sac...    30   8.9  
Scas_705.38                                                            30   9.1  
YBR133C (HSL7) [320] chr2 complement(501760..504243) Protein met...    30   9.4  

>YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein
           required for mother cell-specific expression of HO and
           receptor mediated as well as membrane lipid endocytosis
           [2370 bp, 789 aa]
          Length = 789

 Score = 1572 bits (4070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/775 (100%), Positives = 775/775 (100%)

Query: 1   MPLCEKGNDPIDSSTIDSLCAAFDKTLKSTPDVQKYNDAINTIFQLRQKSESGKMPADLT 60
           MPLCEKGNDPIDSSTIDSLCAAFDKTLKSTPDVQKYNDAINTIFQLRQKSESGKMPADLT
Sbjct: 1   MPLCEKGNDPIDSSTIDSLCAAFDKTLKSTPDVQKYNDAINTIFQLRQKSESGKMPADLT 60

Query: 61  NSEALKDRQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVGCFS 120
           NSEALKDRQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVGCFS
Sbjct: 61  NSEALKDRQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVGCFS 120

Query: 121 NKDATIALLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRISEDE 180
           NKDATIALLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRISEDE
Sbjct: 121 NKDATIALLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRISEDE 180

Query: 181 VKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPSLTT 240
           VKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPSLTT
Sbjct: 181 VKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPSLTT 240

Query: 241 LCSEIFLTKGLSKLFKKRVFEEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSL 300
           LCSEIFLTKGLSKLFKKRVFEEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSL
Sbjct: 241 LCSEIFLTKGLSKLFKKRVFEEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSL 300

Query: 301 NVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAVKLEEVP 360
           NVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAVKLEEVP
Sbjct: 301 NVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAVKLEEVP 360

Query: 361 KVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLYGLLVIMANLSTLPE 420
           KVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLYGLLVIMANLSTLPE
Sbjct: 361 KVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLYGLLVIMANLSTLPE 420

Query: 421 ESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTELISFLKREMHNL 480
           ESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTELISFLKREMHNL
Sbjct: 421 ESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTELISFLKREMHNL 480

Query: 481 SPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCRALTRML 540
           SPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCRALTRML
Sbjct: 481 SPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCRALTRML 540

Query: 541 IFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNYEALLALTNLASS 600
           IFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNYEALLALTNLASS
Sbjct: 541 IFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNYEALLALTNLASS 600

Query: 601 ETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAKFFNLEN 660
           ETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAKFFNLEN
Sbjct: 601 ETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAKFFNLEN 660

Query: 661 PQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAIQVFADQ 720
           PQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAIQVFADQ
Sbjct: 661 PQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAIQVFADQ 720

Query: 721 IDDIELRQRLLMLFFGLFEVIPDNGTNEVYPLLQENQKLKDALNMSLKRGDSGPE 775
           IDDIELRQRLLMLFFGLFEVIPDNGTNEVYPLLQENQKLKDALNMSLKRGDSGPE
Sbjct: 721 IDDIELRQRLLMLFFGLFEVIPDNGTNEVYPLLQENQKLKDALNMSLKRGDSGPE 775

>Scas_699.37
          Length = 768

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/769 (47%), Positives = 516/769 (67%), Gaps = 30/769 (3%)

Query: 16  IDSLCAAFDKTLKSTPDVQKYNDAINTIFQLRQKSESGKMPADLTNSEALKDRQKIEEIL 75
           I  LC  F+K L+   + +KYN+A++ IF             D+   E +  +Q +E +L
Sbjct: 6   IADLCLEFEKKLRVPVEPEKYNEALDEIFM-----------NDIEGIENIGSKQ-VETVL 53

Query: 76  TRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVGCFSNKDATIALLNELQIR 135
           +R+YQ HS SRV+L +LI  DIP +LNLFE LS  ++H+ +G F   + TI L+ EL+ R
Sbjct: 54  SRAYQAHSSSRVYLHELILKDIPKSLNLFESLSIQTVHILIGSFETANDTIPLIKELKDR 113

Query: 136 IHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRISEDEVKSMMLIIFAELQSS 195
           IHYGEDTH  YLLS I+Q LNK+ Y + ++ F+V+++ LR+ E + KS+ LIIF  LQ S
Sbjct: 114 IHYGEDTHPKYLLSCIVQSLNKYSYAWDQIEFIVRDVCLRMGEPDFKSIGLIIFTLLQES 173

Query: 196 FQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPSLTTLCSEIFLTKGLSKLF 255
           F++ F K   + + SLI+EAE DVGNDPLS+IV+  +ELYP+LT +CSE+FL   L KLF
Sbjct: 174 FEEQFYKKFTNIIDSLILEAEADVGNDPLSLIVEIFTELYPALTNICSELFLGSELDKLF 233

Query: 256 KKRVFEEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSLNVEDVQIYSALVLVK 315
           K++     + +F K+LL+LLS ACIDE +R +I ENYL +LERSL +E  + YSA+VL+K
Sbjct: 234 KEKAMHNNEDEFIKKLLKLLSVACIDENVRNFIAENYLDMLERSLKLEQFKTYSAVVLIK 293

Query: 316 TWSFTKLTCINLKQLSEIFI-NAISRRIMPKIENVNESAVKLEEVPKVEMSVEALAYLSL 374
           TWSFTKL  + +  L      N +    +   +++N+  V         M +E LAYL+L
Sbjct: 294 TWSFTKLKGVTIGDLGTTLTDNFLMNLKIDDGQSLNDECV---------MCIEGLAYLTL 344

Query: 375 KASVKIMIRSNESFTEILLTMIKSQKM---THCLYGLLVIMANLSTLPEE--SNGS--SQ 427
           K  +K+ +R +E F+  ++ ++K Q         YG+LVI+ N+ST P +   +G+   Q
Sbjct: 345 KKQMKMTLRYHEEFSTTIINLLKKQDTPVDDSVKYGILVILGNISTYPMDVTMDGAMDPQ 404

Query: 428 SINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTELISFLKREMHNLSPNCKQQ 487
           ++ DLK Y++LK P         E+ ED+  + +KYIL+TEL+S+L+ ++  +SP  +QQ
Sbjct: 405 ALQDLKTYSELKSPKKRDANDVIENNEDVTRYIQKYILKTELLSYLRTKLAEVSPGSRQQ 464

Query: 488 VVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCRALTRMLIFTNPGL 547
           ++R+IYN+TR++  I   + QG    ++EYLANK+D  EP R+L  R+LT+ML  ++P L
Sbjct: 465 IIRIIYNLTRARENISASVEQGCVVTVIEYLANKKDKKEPTRLLALRSLTKMLTLSDPKL 524

Query: 548 IFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNYEALLALTNLASSETSDGEE 607
           IF KYS L AIPFL+ELL   +   +NPL  DE I   D+YEAL ALTNLAS+E S+ ++
Sbjct: 525 IFNKYSRLTAIPFLYELLQTPSLSAENPLSTDELITTQDSYEALCALTNLASTEDSNADD 584

Query: 608 VCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAKFFNLENPQSLRNF 667
           VCK +V+   YWS IENL+LD+N+ +QR+TLELI+N+M +PL+IAAK FN ENPQSLRNF
Sbjct: 585 VCKQVVTDVNYWSIIENLILDDNILVQRATLELIANLMCYPLSIAAKIFNFENPQSLRNF 644

Query: 668 NILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAIQVFADQIDDIELR 727
           NILVKLL+L+DV +QRAVAAIFANI++++PLIA+ LL KKELIE A  +FA+QIDD  LR
Sbjct: 645 NILVKLLELNDVAAQRAVAAIFANISSSVPLIAQTLLDKKELIEKATGIFAEQIDDEALR 704

Query: 728 QRLLMLFFGLFEVIPDNGTN-EVYPLLQENQKLKDALNMSLKRGDSGPE 775
           QRL + FF LFE++P    +   +  L  N  LK  L   +KR D  PE
Sbjct: 705 QRLFVFFFSLFELLPSKEEDSRKFDSLTRNTNLKMTLESLMKRDDIEPE 753

>CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces
           cerevisiae YOR035c SHE4, start by similarity
          Length = 783

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/791 (44%), Positives = 526/791 (66%), Gaps = 49/791 (6%)

Query: 11  IDSSTIDSLCAAFDKTLKSTPDVQKYNDAINTIFQL---RQKSESGKMPADLTNSEALKD 67
           +    I++LC   DK+   + D + Y +A++ I  +   +++  S ++P           
Sbjct: 3   VSKDAIETLCEELDKSATISIDEKSYQEALDEIKDIIVRKKRVASAQLP----------- 51

Query: 68  RQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVGCFSNKDATIA 127
             +IE++L RSYQDH+ES+  L ++I++++  AL+LFE+LS  SIHV VG F + + T+ 
Sbjct: 52  --EIEKVLIRSYQDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMV 109

Query: 128 LLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRISEDEVKSMMLI 187
           LL+EL+ RIHYGED ++ YLLSI+LQLL+KF Y F +  FLV++L LR  E +V  MML+
Sbjct: 110 LLDELRTRIHYGEDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLL 169

Query: 188 IFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPSLTTLCSEIFL 247
           IF +L   +  +F    ++ M  LI+EAE D+G++PL +IV+ L+ELYPSLT LCSE+ L
Sbjct: 170 IFTQLNYRYPDEFKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLL 229

Query: 248 TKGLSKLFKKRVF-EEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSLNVEDVQ 306
           T+G  K+ K+R   E+ D  F  +LL+LLS ACIDET+R +I+E Y++ LE S+   + +
Sbjct: 230 TRGAGKMLKERATSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYIETLETSMQFSEYK 289

Query: 307 IYSALVLVKTWSFTKLTCINLKQLSEIFIN-----AISRRIMPKIENVNESAVKLEEVPK 361
           + +ALVL+KTWSF KL  I++ +L+ I ++     A+      +  + N++ V       
Sbjct: 290 VLAALVLIKTWSFLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLV------- 342

Query: 362 VEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLY-GLLVIMANLSTLP- 419
              ++E LAYL+LK  +K M+R +E F   ++ + K +  T+  Y G+L+I+ANL+ LP 
Sbjct: 343 --YTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLAKKESGTNPNYFGILIIIANLTALPN 400

Query: 420 EESNGSSQ----SINDLKNYADLKGPGADKVGAE-KESKEDILLFNEKYILRTELISFLK 474
           +++N ++Q    S+  L  YA++ G   +K+     +S+E++  F EK+IL+ +L++ +K
Sbjct: 401 DKTNPTNQTHSGSMAQLSMYANM-GADTNKLKDNVPDSEEEVKEFQEKFILKKDLLADMK 459

Query: 475 REMHNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCR 534
            + +++SP  KQQ +R++YN+TR K  I  C+ QG TT ILEYL +KQD G  +R+L  R
Sbjct: 460 TKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTNILEYLVSKQDKGVAVRLLAYR 519

Query: 535 ALTRMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDD-------NPL-HNDEQIKLTD 586
           +LTR+LI T+P LIF KYS LNAIPFLF+L+  +   ++       NPL  ND+ I++ D
Sbjct: 520 SLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESGEETQEKIELNPLLENDDNIEVLD 579

Query: 587 NYEALLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMS 646
            YEALLALTNLA++ TS+GEE+CK I +T  YW++I NLML+EN+ +QRSTLELISN+MS
Sbjct: 580 RYEALLALTNLAATPTSNGEEICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMS 639

Query: 647 HPLTIAAKFFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTK 706
           HPL +AAKFFN  NPQSLRNFN LV+L++L D+ SQRA+AA+FANI  ++P I++EL  K
Sbjct: 640 HPLPVAAKFFNFSNPQSLRNFNTLVQLIELDDIASQRAIAALFANIVISVPFISEELYEK 699

Query: 707 KELIENAIQVFADQIDDIELRQRLLMLFFGLFEVIPDNGTNEVYPL--LQENQKLKDALN 764
             LI  AI++  DQ DDIEL QRL++ F+GLFE  P+   ++      L +N  L+ AL 
Sbjct: 700 DVLISRAIRILNDQNDDIELTQRLIIFFYGLFEYAPEKPESQKAKEKNLFKNANLRKALE 759

Query: 765 MSLKRGDSGPE 775
            SL   + G E
Sbjct: 760 KSLVNQNVGGE 770

>KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534
           Saccharomyces cerevisiae YOR035c SHE4 required for
           mother cell-specific gene expression singleton,
           hypothetical start
          Length = 661

 Score =  396 bits (1017), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 251/633 (39%), Positives = 376/633 (59%), Gaps = 53/633 (8%)

Query: 118 CFSNKDAT--IALLNELQIRIHY-GEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELIL 174
           C S KD T  + ++      IH  GE+T     +     +L  +  ++ ++ FL + ++L
Sbjct: 24  CSSPKDVTDLLHVIQNWTSEIHNNGEETRCWKCVP----MLAGYVKDWGQLEFLCRRILL 79

Query: 175 RISEDEVKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSEL 234
           R S  E++ ++L+    L S+   + ++   + +  L++EAE D GN  L ++V  +S +
Sbjct: 80  RSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEAEEDSGNVSLRLLVDAMSLV 139

Query: 235 YPSLTTLCSEIFLTKGLSKLFKKRV-FEEQDLQFTKELLRLLSSACIDETMRTYITENYL 293
           +P    +C ++FL+     +  + +     D       LRLL+ +CIDE +R +I E+YL
Sbjct: 140 FPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRLLAVSCIDEAVRRFIAEHYL 199

Query: 294 QLLERSLNVEDVQIYSALVLVKTWSFTKL------TCINLKQLSEIFINAISRRIMPKIE 347
           + L++S  VE  ++ +ALVL+K WSFTK+      +CINL      FI+++S       E
Sbjct: 200 KTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCINL------FIDSLSNG-----E 248

Query: 348 NVNESAVKLEEVPKVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHC-LY 406
           N+             E++ EALAYL+LK SV++++R N      ++ +IKSQ  T   LY
Sbjct: 249 NI-------------EINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLY 295

Query: 407 GLLVIMANLSTLPEESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILR 466
           GLL+I+AN+S  P ++     +++ LK  A LK           E+ +DI  FN  YI+ 
Sbjct: 296 GLLIILANVSEHPSQN---EDTVDKLK--ASLKTNQEKNDEPTLENVKDIEEFNRDYIID 350

Query: 467 TELISFLKREMHNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIG- 525
            +LI  LK     LS +   Q +R+IYN+TR K  I +C+ QG   ++L +LA K+++  
Sbjct: 351 LDLIGSLKS--IKLSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSK 408

Query: 526 EPIRILGCRALTRMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLT 585
           +   +L  RAL++ LI+ NP   F KYS L+A PFLFE LP     +DN L ++ Q    
Sbjct: 409 DEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFENLPLP---NDNAL-SELQFTQL 464

Query: 586 DNYEALLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMM 645
           D YEALLALTNLA+   + G ++ K I+S   YW +IENL+LD +V +QRSTLELISN+M
Sbjct: 465 DTYEALLALTNLAT--INQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLM 522

Query: 646 SHPLTIAAKFFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLT 705
           S+P+ I+AKFF  ENP+S +NF ILVKLL+L D++SQRAVAAIFANIA+T+P I KEL  
Sbjct: 523 SNPMAISAKFFCFENPKSAQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSE 582

Query: 706 KKELIENAIQVFADQIDDIELRQRLLMLFFGLF 738
           K+ LIE AI+VF  Q  D +LR RLL+L   +F
Sbjct: 583 KRNLIETAIRVFKTQNTDTDLRIRLLVLLSSIF 615

>AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH]
           (1367924..1370200) [2277 bp, 758 aa]
          Length = 758

 Score =  397 bits (1021), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 275/709 (38%), Positives = 421/709 (59%), Gaps = 35/709 (4%)

Query: 58  DLTNSEALKDRQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVG 117
           +L +  ++ + + IEE++    +DH+ESR H  +L +      L L E  S  SI   V 
Sbjct: 43  ELVSGSSVINVEDIEEVVLHCIKDHTESRNHFLQLSRTRPGSLLELLEYGSGKSIPAIVD 102

Query: 118 CFSNKDATIALLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRIS 177
            FSN   T A+L E+Q  +     T   Y+  +I QLL K  Y F ++ FLV+ L  R+ 
Sbjct: 103 AFSNAQDTNAVLREIQKLLQDRNRTPAWYI-QLIYQLLEKNWYTFSDLAFLVRVLPRRMD 161

Query: 178 EDEVKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPS 237
            ++V+ + L++FA L SS+  DF+K   D + +L +EA++ +    L  ++ TL+EL+P 
Sbjct: 162 SEQVRPLSLVLFARLHSSYPSDFEKEFTDTIDTLAIEADVGIEGS-LDAVLLTLTELFPL 220

Query: 238 LTTLCSEIFLTKGLSKLFKKRVFEEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLE 297
           L  LCS++ L   L ++ +      ++ +     L LLS ACID+T+R YI +N L+ LE
Sbjct: 221 LPLLCSQLLLKPELQQVLRDE--STRNRKTLLLALNLLSVACIDDTVRRYIADNLLKELE 278

Query: 298 RSLNVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAVKLE 357
            + +  D ++Y+++VL+KTW+F KL  I+++QL    +  +   +               
Sbjct: 279 TAFSDSDTKLYASIVLIKTWAFKKLQSIDIEQLCATCVTELQSPV--------------- 323

Query: 358 EVPKVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLYGLLVIMANLST 417
            V +  ++VE LAYL+LK++V+I IR++   + IL+ ++K    +  +YG+L  + NL+ 
Sbjct: 324 -VKRRAIAVEGLAYLTLKSTVRISIRADGDSSLILVQLLKKNPDSSTIYGILSTLVNLTA 382

Query: 418 LPEESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTELISFLKREM 477
            P E +   +S+N LK YADL  P + K     E  ++I  F E YIL  ++I  L+   
Sbjct: 383 SPSEQSSEQKSLNALKAYADLHVPASGK-QEPLEDDDEIDAFIEDYILDLQVIGTLRSSK 441

Query: 478 HNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCRALT 537
           + L  NCK+Q+ ++IY +T+S+ FI  C+ QG TT +LEYL N   +   I+IL  RAL 
Sbjct: 442 NVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYL-NDAPVHNIIQILAARALA 500

Query: 538 RMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKL---TDNYEALLAL 594
           R+LI T+P L+F ++S +N++P LF L+P    +D     N+E +      D+YEALLAL
Sbjct: 501 RILINTDPKLLFHRHSPMNSVPALFGLIPILDGLD-----NEEALSYLTTRDSYEALLAL 555

Query: 595 TNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHPLTIAAK 654
           TNLA++++S  EE+ K IVS   YW  + N +LDE V +QRS LEL++N+M+ P+ IAAK
Sbjct: 556 TNLAATDSS--EELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELLANLMARPINIAAK 613

Query: 655 FFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTKKELIENAI 714
           FFNL NP+S +NF+ LV LL+L D+ SQRA+AAIFANIA +IP IA+ELL + ELI+  I
Sbjct: 614 FFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAEELLKEDELIKAVI 673

Query: 715 QVFADQIDDIELRQRLLMLFFGLFEVIPDNGTNEVYPLLQENQKLKDAL 763
               +Q +D EL QRLL     L EV P    +    LL +N+ L   L
Sbjct: 674 LTLKEQCEDEELMQRLLFFIDALLEVSPSKNDSH---LLVDNKDLYKTL 719

>Kwal_55.19991
          Length = 275

 Score =  242 bits (617), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 185/284 (65%), Gaps = 9/284 (3%)

Query: 409 LVIMANLSTLPEESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTE 468
           +V++ANLS+  +ES+   +++  L+ YADLK P   K      + E++L FN+KYIL   
Sbjct: 1   MVVLANLSSPLDESSSRQRALQGLQAYADLKRPDNLK-DVASPTNEEVLAFNKKYILDLN 59

Query: 469 LISFLKREMHNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPI 528
            +  LK    + S     Q+VR+I+N++R+K FI + + QG   ++LE LA+ + +    
Sbjct: 60  TLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIK-MPADF 118

Query: 529 RILGCRALTRMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNY 588
           ++L  R+L R+L   NP L+F+++SAL A+P+LFEL+P    V   P  ND QI   D Y
Sbjct: 119 KLLALRSLARILAMVNPELVFRRFSALTAVPYLFELIP----VPTQPASND-QIDPKDTY 173

Query: 589 EALLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHP 648
           EALLALTNL + + SD   +C+ IV++ VYW  +E L+LD  V +QRS LEL+ N+M+  
Sbjct: 174 EALLALTNLVTIQESDS--ICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGS 231

Query: 649 LTIAAKFFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANI 692
           L +A KFFN +NPQSLRNFNILVKLL L D+ SQ AV  IFANI
Sbjct: 232 LHLAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGIFANI 275

>KLLA0A07997g 711231..712958 similar to sp|P06779 Saccharomyces
           cerevisiae YJR052w RAD7 nucleotide excision repair
           protein singleton, start by similarity
          Length = 575

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 295 LLERSLNVEDVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAV 354
           LL  S  +E++ + + L  + + +FT + C NLKQL+  F++ +   I+ KI   NE   
Sbjct: 487 LLNSSSTLEELNL-NGLKSLTSKTFTFMACPNLKQLNIGFVHCVDNEIVEKISKDNEKLT 545

Query: 355 KLEEVPKVEMSVEALAYLSLKASVKIMIRSNES 387
            +E    V    +     S +  V I+ R ++S
Sbjct: 546 IIE----VYGDNQVTGKCSPRNGVSIIGRQSDS 574

>KLLA0E05137g complement(456708..459161) similar to sp|Q06708
           Saccharomyces cerevisiae YLR386w singleton, start by
           similarity
          Length = 817

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 43/173 (24%)

Query: 253 KLFKKRVFE--------EQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSL-NVE 303
           KL  +RV++        + DL FTK ++++LSS          +T   L    +SL   E
Sbjct: 529 KLSAERVYKIVSLMLDSDDDLIFTKMIVQILSS--------NLVTAQELSKFRKSLRKGE 580

Query: 304 DVQIYSALVLVKTWSFTKLTCINLKQLSEIFINAISRRIMPKIENVNESAVK-LEEVPKV 362
           D   +   +L KTWS   ++ + L  +SE +                E A K L+   + 
Sbjct: 581 DWSCFC--ILFKTWSHNPISLLALCLISENY----------------ELAYKVLKTYVEY 622

Query: 363 EMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTH---CLYGLLVIM 412
           ++SV  L    ++  + +    + +FT + + ++   K  +   CLYG+L+++
Sbjct: 623 DLSVNDL----IQIDILVQFLESPAFTTLRMQLLDPDKYPYLYKCLYGILMVL 671

>Scas_705.38
          Length = 1051

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 656 FNLENPQSLRNF-------NILVKLLQLSDVESQRAVAA-IFANIATTIPLIAKELLTKK 707
           F  E+P+  RN        N L +L++L   ++   +++ I  N   T PL++K +   +
Sbjct: 46  FTNEDPKQARNSKSAEGDSNKLTELIRLDAEQTDFPMSSYILRNFVMTFPLLSKNMAVDE 105

Query: 708 ELIENAIQVF 717
              +N +QVF
Sbjct: 106 SFWQNKVQVF 115

>YBR133C (HSL7) [320] chr2 complement(501760..504243) Protein
           methyltransferase that acts as a negative regulatory
           protein for the Swe1p protein kinase [2484 bp, 827 aa]
          Length = 827

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 100 ALNLFEILSRSSIHVFVGCFS----NKDATIALLNELQIRIHYGEDT 142
           +LN F+I  R  IH F+G FS    N      L N+  +R+ + E+T
Sbjct: 568 SLNEFKIKHRGEIHGFIGFFSANLYNNIFLSTLPNDSTVRLKFSEET 614

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,683,092
Number of extensions: 1009999
Number of successful extensions: 4062
Number of sequences better than 10.0: 60
Number of HSP's gapped: 4195
Number of HSP's successfully gapped: 60
Length of query: 775
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 666
Effective length of database: 12,822,747
Effective search space: 8539949502
Effective search space used: 8539949502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)