Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR033C (EXO1)70269032370.0
Scas_699.3570968715730.0
CAGL0H08085g67449913850.0
Sklu_1321.265645013341e-176
KLLA0E16797g67152912921e-170
Kwal_55.1998164552212651e-166
AER387C65543611981e-156
YDR263C (DIN7)43038511181e-147
Scas_538.641239510431e-136
Kwal_26.76873802851888e-15
Scas_717.643792841852e-14
CAGL0K11506g3813171807e-14
Sklu_2149.23812881808e-14
KLLA0F02992g3812621781e-13
AFR133C9701281793e-13
YKL113C (RAD27)3823331701e-12
Scas_645.810001331677e-12
YGR258C (RAD2)10311271679e-12
Kwal_23.434310311271633e-11
CAGL0F08327g9921301605e-11
Sklu_2443.2510331361571e-10
Kwal_47.191686732381516e-10
KLLA0A09427g10111811472e-09
KLLA0A01320g5842671434e-09
Scas_687.237453171321e-07
ABL052C3792781282e-07
AFR238W6982451231e-06
YER041W (YEN1)7591421114e-05
CAGL0C02255g648256870.025
AER414W76954760.51
Sklu_1834.280335750.74
CAGL0B02101g44590684.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR033C
         (690 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR033C (EXO1) [4845] chr15 complement(392415..394523) Double-st...  1251   0.0  
Scas_699.35                                                           610   0.0  
CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces c...   538   0.0  
Sklu_1321.2 YOR033C, Contig c1321 793-2763                            518   e-176
KLLA0E16797g 1487301..1489316 some similarities with sp|P39875 S...   502   e-170
Kwal_55.19981                                                         491   e-166
AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C (...   466   e-156
YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondr...   435   e-147
Scas_538.6                                                            406   e-136
Kwal_26.7687                                                           77   8e-15
Scas_717.64                                                            76   2e-14
CAGL0K11506g 1114740..1115885 highly similar to sp|P26793 Saccha...    74   7e-14
Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement          74   8e-14
KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces c...    73   1e-13
AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH] (675260..67...    74   3e-13
YKL113C (RAD27) [3150] chr11 complement(224373..225521) Single-s...    70   1e-12
Scas_645.8                                                             69   7e-12
YGR258C (RAD2) [2205] chr7 complement(1007676..1010771) Structur...    69   9e-12
Kwal_23.4343                                                           67   3e-11
CAGL0F08327g complement(829426..832404) similar to sp|P07276 Sac...    66   5e-11
Sklu_2443.25 YGR258C, Contig c2443 54418-57519                         65   1e-10
Kwal_47.19168                                                          63   6e-10
KLLA0A09427g complement(821244..824279) similar to sp|P07276 Sac...    61   2e-09
KLLA0A01320g complement(118369..120123) weakly similar to sp|P40...    60   4e-09
Scas_687.23                                                            55   1e-07
ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH] (300564..30...    54   2e-07
AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH] complement(...    52   1e-06
YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nucleas...    47   4e-05
CAGL0C02255g complement(228009..229955) similar to sp|P40028 Sac...    38   0.025
AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH] complement(...    34   0.51 
Sklu_1834.2 YNL085W, Contig c1834 1199-3610                            33   0.74 
CAGL0B02101g 194461..195798 similar to sp|P50079 Saccharomyces c...    31   4.4  

>YOR033C (EXO1) [4845] chr15 complement(392415..394523)
           Double-stranded DNA 5'->3' exonuclease, involved in
           mismatch repair and recombination [2109 bp, 702 aa]
          Length = 702

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/690 (89%), Positives = 617/690 (89%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120
           KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ
Sbjct: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120

Query: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180
           KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR
Sbjct: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180

Query: 181 RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
           RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA
Sbjct: 181 RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240

Query: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300
           MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP
Sbjct: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300

Query: 301 LYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPLA 360
           LYLKDTESKRKRLYACIGFVIHRETQKKQIV            KIAQGDLNPYDFHQPLA
Sbjct: 301 LYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPLA 360

Query: 361 NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQAEDK 420
           NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQAEDK
Sbjct: 361 NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQAEDK 420

Query: 421 LTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDTNSQSLEE 480
           LTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDTNSQSLEE
Sbjct: 421 LTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDTNSQSLEE 480

Query: 481 PVSESQLSTQIPSSFITTXXXXXXXXXXXXXXXXXXXXXXRKNSEGKTIGNEIXXXXXXX 540
           PVSESQLSTQIPSSFITT                      RKNSEGKTIGNEI       
Sbjct: 481 PVSESQLSTQIPSSFITTNLEDDDNLSEEVSEVVSDIEEDRKNSEGKTIGNEIYNTDDDG 540

Query: 541 XXXXXXXXXXTAESRVPXXXXXXXXXXXXXXISGCTKVLQKFRYSSSFSGVNANRQPLFP 600
                     TAESRVP              ISGCTKVLQKFRYSSSFSGVNANRQPLFP
Sbjct: 541 DGDTSEDYSETAESRVPTSSTTSFPGSSQRSISGCTKVLQKFRYSSSFSGVNANRQPLFP 600

Query: 601 RHVNQKSRGMVYVNQNRXXXXXXXXGKNQITQRPSLRKSLIGARSQRIVIDMKSVDERKS 660
           RHVNQKSRGMVYVNQNR        GKNQITQRPSLRKSLIGARSQRIVIDMKSVDERKS
Sbjct: 601 RHVNQKSRGMVYVNQNRDDDCDDNDGKNQITQRPSLRKSLIGARSQRIVIDMKSVDERKS 660

Query: 661 FNSSPILHEESKKRDIETTKSSQARPAVRS 690
           FNSSPILHEESKKRDIETTKSSQARPAVRS
Sbjct: 661 FNSSPILHEESKKRDIETTKSSQARPAVRS 690

>Scas_699.35
          Length = 709

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/687 (51%), Positives = 420/687 (61%), Gaps = 62/687 (9%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGIQGLLPQLKPIQNPV L RYEG+ LAIDGYAWLHRAACSCAYELAM KPT KYLQFFI
Sbjct: 1   MGIQGLLPQLKPIQNPVGLHRYEGQTLAIDGYAWLHRAACSCAYELAMEKPTQKYLQFFI 60

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120
           K+FS+L+ F +EPYLVFDGD+IPVKK TE KRR++R EN+AIAERLW  GEKKNAMDYFQ
Sbjct: 61  KKFSMLRKFNIEPYLVFDGDSIPVKKGTELKRRERRVENRAIAERLWTSGEKKNAMDYFQ 120

Query: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180
           KCVDITP+MAKC+I YCK+N I YIVAPFEADSQMVYLEQ  IVQGIISEDSDLLVFGCR
Sbjct: 121 KCVDITPDMAKCVIDYCKVNQINYIVAPFEADSQMVYLEQTGIVQGIISEDSDLLVFGCR 180

Query: 181 RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
           RLITKLNDYGEC+EIC+D+F KLP+KFPLG L  E   T+VCLSGCDYT+GIPKVGL+TA
Sbjct: 181 RLITKLNDYGECIEICKDDFNKLPRKFPLGQLNMECFRTLVCLSGCDYTDGIPKVGLVTA 240

Query: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300
           MK+V +   ++RI+LSIQR+GKL IP T+ +EY+ A  AFQ+QRVFCPI ++IV LN+IP
Sbjct: 241 MKMVYKLRNMDRILLSIQRDGKLKIPTTFKDEYKLANYAFQYQRVFCPISRRIVPLNKIP 300

Query: 301 LYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPLA 360
              K T      L  CIG VIHR++Q KQ V            +IA GDLNPYDFH+PL 
Sbjct: 301 -EEKFTADDLIILSQCIGNVIHRDSQVKQCVINDEDIDHELHARIANGDLNPYDFHRPLT 359

Query: 361 NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNI--------- 411
           NRE KLQL SKS  E G +  + ++ + K I+SFF+K T L    K A N+         
Sbjct: 360 NREQKLQLVSKS--EMGISIPSKNQGETKGIDSFFKK-TALKVTEKKAVNVVQNKKIPQF 416

Query: 412 ---------HSLRQAEDKLTMAIKRRKLSNANVVQ--ETLKDTRSKFFNK-PSMTVVENF 459
                    +  +  E +L   +KRRKLSN N     E    T SKFF K P MT V+  
Sbjct: 417 LSTSSFNINNKNKTHEGRLEAMLKRRKLSNQNTKSQIEDSTTTSSKFFTKLPGMTDVK-- 474

Query: 460 KEKGDSIQDFKEDTNSQSLEEPVSESQLSTQIPSSFITTXXXXXXXXXXXXXXXXXXXXX 519
                S     ++ +S+ +E  V ES+L TQ+PSSF                        
Sbjct: 475 ----ISTSTVSQNLSSE-IETEVPESELPTQVPSSFTRITPDTVTDNDDEDAKDEEETKF 529

Query: 520 XRKNSEGKTIGNEIXXXXXXXXXXXXXXXXXTAESRVPXXXXXXXXXXXXXXISGCTKVL 579
              +SE   I NE+                   +  +P                  +  L
Sbjct: 530 EDGDSE---ILNEV---------DSEEEELIVKKKEIPPIESEGVVDDMIPETRVSSGSL 577

Query: 580 QKFRYS--SSFSGVNANRQPLFPRHVNQKSRGMVYVNQNRXXXXXXXXG----------- 626
           Q+FRYS           R+PL P+H N+ +R  V VN  R        G           
Sbjct: 578 QRFRYSFTEKLKTELIERKPLEPQHPNKYNR-FVSVNVKREASDMVEAGPKTGEEAVKEK 636

Query: 627 KNQITQRPSLRKSLIGARSQRIVIDMK 653
           +  +T RPSLR       SQ I I +K
Sbjct: 637 QRTLTARPSLRSQA----SQGITIGIK 659

>CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces
           cerevisiae YOR033c DHS1 or sp|Q12086 Saccharomyces
           cerevisiae YDR263c DIN7, start by similarity
          Length = 674

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/499 (54%), Positives = 344/499 (68%), Gaps = 17/499 (3%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGIQGLLPQLKPIQNPVSLRRYEG+ L IDGYAWLHRA+CSCAYELAMG PT+KYL+FFI
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGQTLGIDGYAWLHRASCSCAYELAMGLPTEKYLKFFI 60

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120
           KRF++LK+F V PYLVFDGD+I VK+ T  KRR+KR+EN+ IA RLW  G K+NAMDYFQ
Sbjct: 61  KRFNMLKSFGVTPYLVFDGDSINVKQETNKKRREKRQENREIAMRLWQSGNKRNAMDYFQ 120

Query: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180
           KCVD+TPEM KC+I YCK NGI+YIVAPFEAD QMVYLE+K ++QGII+EDSDLLVFGCR
Sbjct: 121 KCVDVTPEMVKCVIDYCKNNGIKYIVAPFEADPQMVYLEKKGLIQGIIAEDSDLLVFGCR 180

Query: 181 RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
           RL+TKLND+GEC+EICRD+F +L  KFP+G L+NEEI  MVCLSGCDYTNGIP++GLI A
Sbjct: 181 RLVTKLNDFGECIEICRDSFGQLTSKFPIGQLSNEEIRMMVCLSGCDYTNGIPRIGLIKA 240

Query: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300
           +KLV     ++RI++S+Q EGK  +P+ + +EY  A  +FQFQRVFCP+ K+IVSL EIP
Sbjct: 241 IKLVMTHRNMDRILMSLQTEGKFSVPENFYDEYRYADYSFQFQRVFCPLSKQIVSLTEIP 300

Query: 301 LYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPLA 360
           + L+      K L++CIG  I R    K+               +A+GDLNPYDF + L 
Sbjct: 301 MGLQSD----KILHSCIGKAICRLDGTKRYCLNDEIDHEIHGY-LARGDLNPYDFTKRLV 355

Query: 361 NREHKLQLASKSN--IEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQ-A 417
           NREHKLQL SKS+  I +  +N   S  KV  I++FF  + ++      +N         
Sbjct: 356 NREHKLQLQSKSDMSITYDPSNEQKSR-KVLSIDTFFSSVPEIKGQGTSSNKQPVYEDFV 414

Query: 418 EDKLTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDT---- 473
           E K T  I  RKL   +     +    SKFF     +        G ++   ++ T    
Sbjct: 415 EKKYTQLISNRKLGRKSDCNNKVT---SKFFTSNQESNSRTAGLNGCNLNSIEQATEKII 471

Query: 474 -NSQSLEEPVSESQLSTQI 491
            +    E  + ES+L TQ+
Sbjct: 472 ISDNESETDLPESELPTQV 490

>Sklu_1321.2 YOR033C, Contig c1321 793-2763
          Length = 656

 Score =  518 bits (1334), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 262/450 (58%), Positives = 322/450 (71%), Gaps = 13/450 (2%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGIQGLLPQLKPIQ P +LRRY G+ LAIDGYAWLHRAA SCA ELA  +PT KYLQFFI
Sbjct: 1   MGIQGLLPQLKPIQQPATLRRYSGQTLAIDGYAWLHRAAHSCAMELATDQPTTKYLQFFI 60

Query: 61  KRFSLLK-TFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYF 119
           KR ++L+ TF + PYLVFDGD+I VKK T+SKRR+KR+ENK    +LW  G+KK +++YF
Sbjct: 61  KRLTMLRSTFNITPYLVFDGDSINVKKETDSKRREKRQENKERGLKLWHMGDKKRSLEYF 120

Query: 120 QKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGC 179
           QKCV ITPEMAKC+I YCK+  ++YIVAPFEAD+QMVYLE      GIISEDSDLL+FGC
Sbjct: 121 QKCVAITPEMAKCVIEYCKVQKVQYIVAPFEADAQMVYLENHGFAHGIISEDSDLLIFGC 180

Query: 180 RRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239
           RRLITKLNDYGEC+EIC D+F  LP KFPL  L  EEI  MVCLSGCDYT+GIP+VGL+T
Sbjct: 181 RRLITKLNDYGECIEICSDDFNHLPSKFPLCQLNREEIRMMVCLSGCDYTSGIPQVGLLT 240

Query: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299
           AMKLV++F  +++I+LSIQREGKL IP  +  EY+ A  AFQFQRVFCP  ++IV+LN I
Sbjct: 241 AMKLVKKFRNMDKILLSIQREGKLKIPQDFTQEYQLANFAFQFQRVFCPKSQRIVTLNVI 300

Query: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPL 359
           P    +T    K ++ C+G VI ++ + K +V             ++ G+LNPYDFH+PL
Sbjct: 301 P----ETLYNNKLVFQCVGKVISKQHKIKTVVEDDDDIDHDLHRLVSLGELNPYDFHKPL 356

Query: 360 ANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIH-SLRQAE 418
            NREH+LQL SKS       N  N   K   I+SFF +  K    PK+A N    ++ A 
Sbjct: 357 VNREHRLQLVSKSE-PILINNRENENNKNNTIDSFFHR--KKLSTPKMAKNQEIDIQNAN 413

Query: 419 DKLTMAIKRRKLSNANVVQETLKDTRSKFF 448
           +KL   ++RRKL     V + L  T SKFF
Sbjct: 414 NKLGSTVERRKLCK---VDDNLGST-SKFF 439

>KLLA0E16797g 1487301..1489316 some similarities with sp|P39875
           Saccharomyces cerevisiae YOR033c DHS1 exonuclease which
           interacts with MSH2P, hypothetical start
          Length = 671

 Score =  502 bits (1292), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 263/529 (49%), Positives = 352/529 (66%), Gaps = 44/529 (8%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+ GLLPQLKPIQNPVSL RY+GE LAIDGYAWLHR+A SCA ELAM +PTDKYLQFFI
Sbjct: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120
           KR S+L+ FK+ P+ VFDGD+I VKK TE KR +KRKEN+  A  L+  G+++ A DYFQ
Sbjct: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELKRAEKRKENREKAHALFEAGDRRLAYDYFQ 120

Query: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180
           KCV ITP+MAKC+I Y ++N I Y+VAP+EAD+QMVYLE++ +VQGIISEDSDLLVFGC 
Sbjct: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180

Query: 181 RLITKLNDYGECLEICRDNFIKLPK-KFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239
           RLITKLND  EC+EI R NF +L + KFPL  LT +++ ++VCLSGCDYT+GIPKVGL+T
Sbjct: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240

Query: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299
           AMK V +  T+E++I++I+REGKL +P T+  EY+ A  AFQFQRV+CP+ +++V+LN I
Sbjct: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300

Query: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPL 359
           P  L + E    +L+ CIG  IH+E + K ++            +I+ G+LNPYDF++PL
Sbjct: 301 PNELLNNE----KLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPL 356

Query: 360 ANREHKLQLASKSNI----EFGKTNTT-NSEAKVKPIESFFQKMTKLDHNPKVANNIHSL 414
            NREHKL+L S+S +    +F    TT  S A  K + +F  + ++  +N    + I S 
Sbjct: 357 VNREHKLRLKSQSVVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNN---GSGIMS- 412

Query: 415 RQAEDKLTMAIKRRKLSNANVVQETLKDTRSKFFN---------------KPSMTVVENF 459
                KL  A+KRRKLS       T K   S+FF                +P +     F
Sbjct: 413 -----KLETALKRRKLSGPANEHSTKKVVNSQFFAAKREPKAVPKVEPKPEPGLAYSAAF 467

Query: 460 KEKG-------DSIQDFKEDTNSQSLEEP---VSESQLSTQIPSSFITT 498
                      DS ++ +  T  Q  +EP   +S+  + T++PSS + +
Sbjct: 468 HSDTFSDVMLLDSDEESETQTGEQQKKEPSQKLSQEDVETEVPSSLVPS 516

>Kwal_55.19981
          Length = 645

 Score =  491 bits (1265), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/522 (49%), Positives = 330/522 (63%), Gaps = 32/522 (6%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGIQGLLPQLK IQ PV+L RY G+ LAIDGYAWLHRAA SCA ELA+G+PT KYL+FF+
Sbjct: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60

Query: 61  KRFSLLKT-FKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYF 119
           KR ++L+  + + PYLVFDGDAI VKK TE KR+ KR E++  A  LW  GEK+ A +YF
Sbjct: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTEVKRKSKRVESREKALALWRSGEKRQAYEYF 120

Query: 120 QKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGC 179
           QKCVD+TPEMAKC+I YC++  I Y+VAPFEAD+QMVYLE+  +V GIISEDSDLL+FGC
Sbjct: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180

Query: 180 RRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239
           RRLITKLND+GE +EIC D+F  LP KFPL  L+ EE+  MVCLSGCDYT GIPKVGL+T
Sbjct: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240

Query: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299
           AMKLVR+  TI+ II  IQREGK  +P  +++EY+ A  AFQFQRVFCP    I +LN I
Sbjct: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300

Query: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPL 359
           P  L    +    L+  IG VI +ET  K+++            +IA G+L PY+  + L
Sbjct: 301 PEDLLGCSA----LFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDL 356

Query: 360 ANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQA-- 417
            NRE KLQL++KS     ++ T+     V  I+SFF K   +  +         +R A  
Sbjct: 357 VNRERKLQLSTKSEPILSRSTTST----VGKIDSFFGKSALVSVSAASTGASAQVRAAIR 412

Query: 418 ---------EDKLTMAIKRRKLSNAN---VVQETLKDTRSKFF---------NKPSMTVV 456
                      KL   ++RRKLS  N   V    +    SK F         N  S   V
Sbjct: 413 KQEEKQIEISRKLVSTVERRKLSRHNTPVVAGVGMSRFFSKSFDGSAHEYSGNATSAPSV 472

Query: 457 ENFKEKGDSIQDFKEDTNSQSLEEPVSESQLSTQIPSSFITT 498
           E+   +     D  + ++S    E  S+  + T IPSS ++T
Sbjct: 473 ESSPPRQSDSDDTSKASSSGHSGESDSQEDIPTDIPSSLLST 514

>AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C
           (DIN7) - SH] (1363438..1365405) [1968 bp, 655 aa]
          Length = 655

 Score =  466 bits (1198), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/436 (50%), Positives = 305/436 (69%), Gaps = 7/436 (1%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGI GLLPQLK IQ PV+L RY  + LAIDGYAWLHR+A SCA EL MG+PT+KYLQFF+
Sbjct: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60

Query: 61  KRFSLLKT-FKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYF 119
           KR ++L+  + +EPYLVFDG  I VK  TE+KR +KR E++A A  LW  GE++ + +YF
Sbjct: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120

Query: 120 QKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGC 179
           QKCVDITPEM K II YC   G +Y+VAP+EAD Q+VYLE+  +VQGIISEDSDLLVFGC
Sbjct: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180

Query: 180 RRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239
           RRLITKLNDYGE  EICRD+F+ LP KFPL SL    + TMVCL+GCDYT GIP+VGL+T
Sbjct: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240

Query: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299
           A+KLV +  T+++I+L+I+REGK  +P  +++EY  A LAFQFQRV+CP++ ++ +LNE+
Sbjct: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300

Query: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPL 359
           P  L++       LY CIG  +H+ T ++ ++            +IA G LNP +  Q L
Sbjct: 301 PSTLREDPI----LYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQAL 356

Query: 360 ANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQ-KMTKLDHNPKVANNIHSLRQAE 418
            NRE +L +  K  +    ++   + A  +P+ + ++ K T ++  P V  +  +     
Sbjct: 357 INRERQLGV-DKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVM 415

Query: 419 DKLTMAIKRRKLSNAN 434
           D++   +++RKL++++
Sbjct: 416 DRIERIVQKRKLADSH 431

>YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondrial
           inner membrane nuclease with a role in stabilizing the
           mitochondrial genome, expression is induced by DNA
           damage [1293 bp, 430 aa]
          Length = 430

 Score =  435 bits (1118), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/385 (54%), Positives = 279/385 (72%), Gaps = 2/385 (0%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MGI GLLPQLK IQ  VSL++Y  + LAIDGYAWLHRA+C+CA+EL M KPT+KYLQFFI
Sbjct: 1   MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFI 60

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120
           KR  LLK  K++PY+VFDGD++ VK  TE++RR KR EN+ IA++LW+ G + NAM+YFQ
Sbjct: 61  KRLQLLKRLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYFQ 120

Query: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180
           K VDITPEMAKCII YCKL+ I YIVAPFEAD QMVYLE+  ++QGIISEDSDLLVFGC+
Sbjct: 121 KSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGCK 180

Query: 181 RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
            LITKLND G+ LEI +D+F  LP+ FPLG L+ ++   +VCL+GCDYT+GI KVG++TA
Sbjct: 181 TLITKLNDQGKALEISKDDFSALPENFPLGELSEQQFRNLVCLAGCDYTSGIWKVGVVTA 240

Query: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300
           MK+V+R++ ++ I++ I+R  KL     +  + E A  AFQ+QRVFCP+  +I +LN IP
Sbjct: 241 MKIVKRYSEMKDILIQIERTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNIP 300

Query: 301 LYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPLA 360
             + ++ ++  ++  CIG V+ R +  ++ V             IA+G+L+P D    L 
Sbjct: 301 KAVTNSHAEIIKIMKCIGSVVERGSGVRKDVINTKNIDHKVHEMIAKGELHPVDMASKLI 360

Query: 361 NREHKLQLAS--KSNIEFGKTNTTN 383
           NRE KL+     K  +  G++N+ N
Sbjct: 361 NRERKLKARKLFKVGLLGGESNSFN 385

>Scas_538.6
          Length = 412

 Score =  406 bits (1043), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 203/395 (51%), Positives = 273/395 (69%), Gaps = 7/395 (1%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+ GLLP LK IQ  V+L++Y G  L ID Y+WLH+AACSCAYELAM KPT+KYLQ+FI
Sbjct: 1   MGVAGLLPHLKTIQKHVTLKKYAGMTLGIDAYSWLHKAACSCAYELAMDKPTEKYLQYFI 60

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120
           ++F+L+K   ++PYL+FDGDAI VK   ES R +KRK NK + E+LW  GE+K A ++FQ
Sbjct: 61  RKFNLMKKLNIKPYLIFDGDAILVKGEVESSRLNKRKTNKLMGEKLWRIGERKAATEFFQ 120

Query: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180
           K V+IT +MAK II YC+ N I+Y+VAPFEADSQMVYLE+   VQGIISEDSDL+VFG +
Sbjct: 121 KSVNITTQMAKHIINYCRENSIQYVVAPFEADSQMVYLEKTVQVQGIISEDSDLIVFGSK 180

Query: 181 RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
           RLITKLN++GEC+EI   +F  L  KFP G L+ ++I  +VCLSGCDYT GI K+GL+TA
Sbjct: 181 RLITKLNEFGECIEIASCDFGDLTGKFPFGELSMDQIRMLVCLSGCDYTVGIWKIGLVTA 240

Query: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300
           +KLVR+F+ ++ I+  I+  GK  +   ++ EY+ A  +FQ+QRVF P   +IV+LN IP
Sbjct: 241 IKLVRQFDNMDDIVNHIKESGKYSLNCNFLQEYKYANYSFQYQRVFDPKENRIVTLNRIP 300

Query: 301 LYLKDTESKRKRLYACIGFVIHRETQKKQIVXXXXXXXXXXXXKIAQGDLNPYDFHQPLA 360
             LK+   +   +  CIG VI +++  K IV             IA GDL+P+++ + L 
Sbjct: 301 TELKNDRKELGIVGQCIGNVISKKSGIKSIVVNDDDIDHNIHTMIANGDLDPHNWKETLI 360

Query: 361 NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFF 395
           +RE  L   S+ +I     N TN    + PI +F 
Sbjct: 361 SREEYLH--SERSITL--NNLTNP---LSPISNFL 388

>Kwal_26.7687
          Length = 380

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 129/285 (45%), Gaps = 25/285 (8%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYE-----GEVLAIDG----YAWLHRAACSCAYELAM--G 49
           MGI+GL   +     P ++R+ E     G  +AID     Y +L         +LA   G
Sbjct: 1   MGIKGLNAIISE-HVPTAVRKSEIKHFFGRKVAIDASMSLYQFLIAVRQQDGVQLASESG 59

Query: 50  KPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWAC 109
           + T   +  F +   ++    ++P  VFDG   P+ KS E  +R  R+      E+L   
Sbjct: 60  ETTSHLMGIFYRTLRMIDN-GIKPCYVFDGKP-PILKSHELDKRSARRAT--TEEKLKEA 115

Query: 110 GEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIIS 169
            E+   + + ++ V +TPE         +L G+ Y+ AP EA++Q   L +   V    S
Sbjct: 116 VEEAEKLKHERRLVRVTPEHNDEAKKLLRLMGLPYVEAPCEAEAQCAELAKAGKVYAAAS 175

Query: 170 EDSDLLVFGCRRLITKLNDYGECLE--ICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCD 227
           ED D L +    L+  L  + E  +  I   N   L +      LT E+ I +  + GCD
Sbjct: 176 EDMDTLCYRTPYLLRHLT-FSEAKKEPIHEINVEVLLQGL---ELTIEQFIDLGIMLGCD 231

Query: 228 YTNGIPKVGLITAMKLVRRFNTIERIILSIQR---EGKLMIPDTY 269
           Y + I  VG +TA+KL++   T+E I+  I+      K  IP+ +
Sbjct: 232 YCDSIRGVGPVTALKLIKEHKTLENIVQYIESGEANTKWKIPENW 276

>Scas_717.64
          Length = 379

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 131/284 (46%), Gaps = 23/284 (8%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYE-----GEVLAIDGYAWLHRAACSCAYELA------MG 49
           MGI+GL   +     P+++R+ E     G  +AID    L++   +   +         G
Sbjct: 1   MGIKGLTAIISE-NAPLAIRKSEIKAFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAG 59

Query: 50  KPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKEN-KAIAERLWA 108
           + T   +  F +   ++    ++P  VFDG    +K    SKR  +R+E  K +AE +  
Sbjct: 60  ETTSHLMGMFYRTLRMIDN-GIKPCYVFDGKPPTLKSHELSKRTSRREETEKKLAEAV-- 116

Query: 109 CGEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGII 168
             ++   M   ++ V ++ E         +L GI Y+ AP EA+SQ   L +K  V    
Sbjct: 117 --DQAEKMKQERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAESQCAELAKKGKVYAAA 174

Query: 169 SEDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDY 228
           SED D L +    L+  L       E  ++  I   +      LT E+ I +  + GCDY
Sbjct: 175 SEDMDTLCYRTPYLLRHLTFSEAKKEPIQE--INTEQVLQGLDLTLEQFIDLGIMLGCDY 232

Query: 229 TNGIPKVGLITAMKLVRRFNTIERIILSIQR-EG--KLMIPDTY 269
            + I  VG +TA+KL++   ++E+I+  I+  EG  K  +P+ +
Sbjct: 233 CDNIRGVGPVTALKLIKEHGSLEKIVEFIESDEGNKKWKVPENW 276

>CAGL0K11506g 1114740..1115885 highly similar to sp|P26793
           Saccharomyces cerevisiae YKL113c RAD27 ssDNA
           endonuclease and 5 -3 exonuclease, start by similarity
          Length = 381

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 140/317 (44%), Gaps = 35/317 (11%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYE-----GEVLAIDGYAWLH------RAACSCAYELAMG 49
           MGI+GL   +     P ++R+ +     G  +AID    L+      R           G
Sbjct: 1   MGIKGLNSIITE-HVPSAIRKSDIKAFFGRKVAIDASMSLYQFLIAVRQQDGGQLSTETG 59

Query: 50  KPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWAC 109
           + T   +  F +   ++    ++P  VFDG   PV KS E  +R  R+E     ++L   
Sbjct: 60  ETTSHLMGMFYRTLRMIDN-GIKPCYVFDGKP-PVLKSHELDKRTSRREE--TEKKLAEA 115

Query: 110 GEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIIS 169
            E+   M + ++ V ++ E         +L GI Y+ AP EA++Q   L +K  V    S
Sbjct: 116 TEEAEKMKHERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAEAQCAELAKKGKVYAAAS 175

Query: 170 EDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPKKFPLGSL--TNEEIITMVCLSGCD 227
           ED D L +    L+  L       E  ++   ++  +  L  L  T ++ I +  + GCD
Sbjct: 176 EDMDTLCYRTPYLLRHLT----FSEARKEPIHEINTEIVLQGLELTIDQFIDLGIMLGCD 231

Query: 228 YTNGIPKVGLITAMKLVRRFNTIERIILSIQR---EGKLMIPDTYINEYEAAVLAFQFQR 284
           Y + I  VG +TA+KL++   ++E+I+  I+      K  +P+ +   Y+ A   F    
Sbjct: 232 YCDSIKGVGPVTALKLMKEHGSLEKIVEYIESGEANNKWKVPENW--PYKEARELF---- 285

Query: 285 VFCPIRKKIVSLNEIPL 301
               ++  ++  NEI L
Sbjct: 286 ----VKPDVIDANEIDL 298

>Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement
          Length = 381

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 134/288 (46%), Gaps = 31/288 (10%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYE-----GEVLAIDG----YAWLHRAACSCAYELAM--G 49
           MGI+GL   +     P ++R+ E     G  +AID     Y +L         +LA   G
Sbjct: 1   MGIKGLNAIISE-HVPTAIRKSEIKSFFGRKVAIDASMSLYQFLIAVRQQDGVQLASESG 59

Query: 50  KPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWAC 109
           + T   +  F +   ++    ++P  VFDG    +K     KR  KR E +   ++L A 
Sbjct: 60  ETTSHLMGMFYRTLRMVDN-GIKPCYVFDGKPPTLKSHELGKRSQKRDETQ---KKLEAA 115

Query: 110 GEKKNAMDYFQKCVDITP---EMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQG 166
            ++     + ++ V +TP   E AK ++   +L GI Y+ AP EA++Q   L + + V  
Sbjct: 116 TDEAEKRMHERRLVKVTPLHNEEAKRLL---ELMGIPYVNAPGEAEAQCAALAKADKVYA 172

Query: 167 IISEDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPKKFPLGSL--TNEEIITMVCLS 224
             SED D L +    L+  L       E  ++   ++  +  L  L  T E+ I +  + 
Sbjct: 173 AASEDMDTLCYRTPFLLRHLT----FSEAKKEPIHEIDTELVLKGLDLTLEQFIDLCIML 228

Query: 225 GCDYTNGIPKVGLITAMKLVRRFNTIERI---ILSIQREGKLMIPDTY 269
           GCDY + I  VG +TA+KL++   ++++I   I S +   K  IP+ +
Sbjct: 229 GCDYCDNIRGVGPVTALKLIKEHGSLDKIVEFIESGEANNKWKIPEHW 276

>KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces
           cerevisiae YKL113c RAD27 ssDNA endonuclease and 5 -3
           exonuclease, start by similarity
          Length = 381

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 117/262 (44%), Gaps = 16/262 (6%)

Query: 18  SLRRYEGEVLAIDG----YAWLHRAACSCAYELAM--GKPTDKYLQFFIKRFSLLKTFKV 71
            ++ + G  +AID     Y +L         +LA   G+ T   +  F +   ++    +
Sbjct: 22  DIKYFHGRKVAIDASMSLYQFLIAVRQQDGVQLAGEDGETTSHLMGMFYRTLRMI-DHGI 80

Query: 72  EPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQKCVDITPEMAK 131
           +P  VFDG    +KK    KR+ +R++ +A   +L    E+   + + ++ V + P   +
Sbjct: 81  KPCYVFDGSPPELKKYELDKRKVRREDTEA---KLKEATEQAEIIKHERRLVKVLPWHNE 137

Query: 132 CIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITKLNDYGE 191
                  L GI Y+VAP EA++Q   L +   V    SED D L +    L+  L  + E
Sbjct: 138 EAQKLLSLMGIPYVVAPAEAEAQCAELAKSGKVFAAASEDMDTLCYQTPVLLRHLT-FSE 196

Query: 192 CLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKLVRRFNTIE 251
             ++    F      +    LT  + I +  + GCDY  GI  VG + A+KL++   ++E
Sbjct: 197 ARKLPIQEF-DTDVIYNTLDLTQTQFIDLGIILGCDYCEGIKGVGPVNALKLIKEHGSLE 255

Query: 252 RIILSIQR----EGKLMIPDTY 269
            I+   +      G+  IP+ +
Sbjct: 256 AIVEKFENGDISSGRWKIPEGW 277

>AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH]
           (675260..678172) [2913 bp, 970 aa]
          Length = 970

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 69/128 (53%), Gaps = 5/128 (3%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++TPEM + I     + GI Y+ AP EA++Q   L +  ++ GII++DSD+ +FG  ++ 
Sbjct: 704 EVTPEMIRDIQQLLSIFGIPYLTAPMEAEAQCAELLRLKLIDGIITDDSDVFLFGGSKVF 763

Query: 184 TKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKL 243
             +      +E      I       LG L   + I +  L G DYTNGI  +G ++ +++
Sbjct: 764 KNMFQEKNYVEYYNTETISA----ELG-LDRLKFIALAQLMGSDYTNGIKGIGPVSGIEI 818

Query: 244 VRRFNTIE 251
           +  +NT+E
Sbjct: 819 LANYNTLE 826

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+  L   L P   PV L       +A+D   W+++     A +    +    ++  F 
Sbjct: 1   MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQF-LKAARDKNGNRLKGAHIIGFF 59

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKST---ESKRRDKRKENKAIAER 105
           +R   L  F ++P  VFDG   P+K+ T     +RR+ ++E+ A+  R
Sbjct: 60  RRICKLLYFGIKPVFVFDGGVPPLKRETIRQRKERREGKRESAAVTAR 107

>YKL113C (RAD27) [3150] chr11 complement(224373..225521)
           Single-stranded DNA endonuclease and 5'-3' exonuclease
           that functions in the MSH2-MLH1-PMS1-dependent mismatch
           repair system [1149 bp, 382 aa]
          Length = 382

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 144/333 (43%), Gaps = 36/333 (10%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYE-----GEVLAIDGYAWLHRAACSCAYELA------MG 49
           MGI+GL   +     P ++R+ +     G  +AID    L++   +   +         G
Sbjct: 1   MGIKGLNAIISE-HVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAG 59

Query: 50  KPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWAC 109
           + T   +  F +   ++    ++P  VFDG    +K    +KR  +R E +   ++L   
Sbjct: 60  ETTSHLMGMFYRTLRMIDN-GIKPCYVFDGKPPDLKSHELTKRSSRRVETE---KKLAEA 115

Query: 110 GEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIIS 169
             +   M   ++ V ++ E  +       L GI YI+AP EA++Q   L +K  V    S
Sbjct: 116 TTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAAS 175

Query: 170 EDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPKKFPLGSL--TNEEIITMVCLSGCD 227
           ED D L +    L+  L       E  ++   ++  +  L  L  T E+ + +  + GCD
Sbjct: 176 EDMDTLCYRTPFLLRHLT----FSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCD 231

Query: 228 YTNGIPKVGLITAMKLVRRFNTIERIILSIQ----REGKLMIPDTYINEYEAAVLAFQFQ 283
           Y   I  VG +TA+KL++   +IE+I+  I+       K  IP+ +   Y+ A + F   
Sbjct: 232 YCESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDW--PYKQARMLF--- 286

Query: 284 RVFCPIRKKIVSLNEIPLYLKDTESKRKRLYAC 316
                +  +++  NEI L     + K    Y C
Sbjct: 287 -----LDPEVIDGNEINLKWSPPKEKELIEYLC 314

>Scas_645.8
          Length = 1000

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 71/133 (53%), Gaps = 17/133 (12%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++TPEM + +       G+ YI AP EA++Q   L Q  +V G++++DSD+ +FG  ++ 
Sbjct: 735 EVTPEMIQDVQELLSRFGVPYITAPMEAEAQCAELLQLKLVDGVVTDDSDVFLFGGSKIY 794

Query: 184 TKL---NDYGECLE---ICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGL 237
             +    +Y E  +   I R+          LG L  E +I +  L G DYTNGI  +G 
Sbjct: 795 KNMFHEKNYVEFYDSESILRN----------LG-LDRENMIELAELLGSDYTNGIKGMGP 843

Query: 238 ITAMKLVRRFNTI 250
           +++++++  F  +
Sbjct: 844 VSSLEVLAEFGNL 856

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+      + P   PV L+  + + +A+D   W+++       +    + ++ ++  F 
Sbjct: 1   MGVHSFWDVVGPTARPVRLKSLQDKKMAVDASIWIYQF-MKAVRDQDGNRVSNSHITGFF 59

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAER 105
           +R   L  F ++P  VFDG    +K+ T  +RR+ R+  +  A++
Sbjct: 60  RRICKLLYFGIQPVFVFDGGVPALKRDTIKQRREIRQGKRDNAQK 104

>YGR258C (RAD2) [2205] chr7 complement(1007676..1010771)
           Structure-specific single-stranded DNA endonuclease of
           the nucleotide excision repairosome [3096 bp, 1031 aa]
          Length = 1031

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++T +M K +       GI YI AP EA++Q   L Q N+V GII++DSD+ +FG  ++ 
Sbjct: 766 EVTMDMIKEVQELLSRFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIY 825

Query: 184 TKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKL 243
             +      +E     F        L  L  + +I +  L G DYTNG+  +G ++++++
Sbjct: 826 KNMFHEKNYVE-----FYDAESILKLLGLDRKNMIELAQLLGSDYTNGLKGMGPVSSIEV 880

Query: 244 VRRFNTI 250
           +  F  +
Sbjct: 881 IAEFGNL 887

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 72/186 (38%), Gaps = 16/186 (8%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+        P   PV L   E + +A+D   W+++       +       + ++  F 
Sbjct: 1   MGVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQ-FLKAVRDQEGNAVKNSHITGFF 59

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKST----ESKRRDKRKENKAIAERLWACGEKKNAM 116
           +R   L  F + P  VFDG    +K+ T    + +R+ KR+  K+ A +L A   +  + 
Sbjct: 60  RRICKLLYFGIRPVFVFDGGVPVLKRETIRQRKERRQGKRESAKSTARKLLALQLQNGSN 119

Query: 117 DYFQKCVDITPEMAKCIICY--------CKLNGIRYIVAPFEADSQMVYLEQKNIVQGII 168
           D  +     TP     +  +          + G +Y       +S   + +  N + G  
Sbjct: 120 DNVKNS---TPSSGSSVQIFKPQDEWDLPDIPGFKYDKEDARVNSNKTFEKLMNSINGDG 176

Query: 169 SEDSDL 174
            ED DL
Sbjct: 177 LEDIDL 182

>Kwal_23.4343
          Length = 1031

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++T  M   +       GI Y+ AP EA++Q   L    +V GII++DSD+ +FG  ++ 
Sbjct: 763 EVTAAMVSEVQELLTRFGIPYMTAPMEAEAQCAELLALKLVDGIITDDSDIFLFGGDKVY 822

Query: 184 TKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKL 243
             +      +E      IK      LG L  E+ I M  L G DYT+G+  VG ++AM++
Sbjct: 823 KNMFHEKNYVEYYVTELIKR----ELG-LDREKFIEMAQLLGSDYTSGVKSVGPVSAMEI 877

Query: 244 VRRFNTI 250
           +  F  +
Sbjct: 878 LAEFGDL 884

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 21/121 (17%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLH--------RAACSCAYELAMGKPT 52
           MG+  L   + P   PV L     + LA+D   W++        +   +  Y   +G   
Sbjct: 1   MGVHALWDVIGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRDKEGNAMRYSHVIG--- 57

Query: 53  DKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKST---ESKRRDKRKENKA-IAERLWA 108
                 F +R   L  F ++P  VFDG A  +K+ T     +RR  R+EN A  A++L A
Sbjct: 58  ------FFRRICKLLYFGIKPVFVFDGGAPALKRRTIQQRKERRQGRRENAASTAKKLLA 111

Query: 109 C 109
            
Sbjct: 112 L 112

>CAGL0F08327g complement(829426..832404) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 992

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 11/130 (8%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++T +M K +       GI YI AP EA++Q   L    +V GII++DSD+ +FG +++ 
Sbjct: 727 EVTMDMIKDVQELLARFGIPYITAPMEAEAQCAELVNLKLVDGIITDDSDVFLFGGKKVY 786

Query: 184 TKL---NDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
             +    +Y E  +   D +  L        LT E +I +  L G DYT GI  +G +++
Sbjct: 787 KNMFQEKNYVEYYD-SEDIYQGL-------GLTRETMIELAQLLGSDYTTGIKGMGPVSS 838

Query: 241 MKLVRRFNTI 250
           M+++  F  +
Sbjct: 839 MEILAEFGDL 848

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 2/100 (2%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+      + P   PV L       +A+D   W+++       +         ++  F 
Sbjct: 1   MGVHSFWDIVGPTAKPVRLESLHDRRMAVDASIWIYQF-LKAVRDKEGNAIKSAHITGFF 59

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENK 100
           +R   L  F ++P  VFDG  +PV K    ++R +R+E K
Sbjct: 60  RRVCKLLYFGIKPVFVFDG-GVPVLKRKTIQKRKERREGK 98

>Sklu_2443.25 YGR258C, Contig c2443 54418-57519
          Length = 1033

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 68/136 (50%), Gaps = 17/136 (12%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++T  M K I       GI YI AP EA++Q   L +  +V GII++DSD+ +FG  R+ 
Sbjct: 767 EVTAVMIKEIQELLSRFGIPYITAPMEAEAQCAELIRLELVDGIITDDSDVFLFGGDRVY 826

Query: 184 TKL---NDYGECLE---ICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGL 237
             +    +Y E  E   I RD          LG L  + +I +  L G DYT G+  +G 
Sbjct: 827 KNMFHEKNYVEFYESGAILRD----------LG-LNRDRMIELAQLLGSDYTEGVKGIGP 875

Query: 238 ITAMKLVRRFNTIERI 253
           +  M+++  F  + ++
Sbjct: 876 VYGMEVLAEFGNLVKL 891

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 5/118 (4%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+      + P   PV L     + +A+D   W+++   +   +          + FF 
Sbjct: 1   MGVYAFWDIVGPTARPVRLESLADKRMAVDASIWIYQFLKAVRDKEGNAMRHSHVVGFF- 59

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKST----ESKRRDKRKENKAIAERLWACGEKKN 114
           +R   L  F ++P  +FDG A  +K+ T    + +R+ KR +    A +L A   +KN
Sbjct: 60  RRVCKLLYFGIKPVFIFDGGAPALKRQTINQRKERRQGKRDDAAKTARKLLALQMQKN 117

>Kwal_47.19168
          Length = 673

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 98/238 (41%), Gaps = 25/238 (10%)

Query: 27  LAIDGYAWLHRAACSCAYELAMGKPTDKY-LQFFIKRFSLLKTFKVEPYLVFDGDAIPVK 85
           +AID + WL        ++      TD + +  F+ R  L  +  V   LVFDG   P+K
Sbjct: 38  IAIDAFTWLFECGFISEFQPEKAYKTDAHSVISFLNRLKLFLSLDVTFILVFDG---PMK 94

Query: 86  KSTESKRRDKRKENKAIA---ERLWACGEKKNAMDYFQKCV-----DITPEMAKCIICYC 137
            S ++K + K      I    +      E     +    C+       TP + K I+   
Sbjct: 95  PSFKNKFKSKTAVQSPIEVEEDYFGVYNEHHRQHEQSGTCIGGPGIQSTPTIVKEIL--- 151

Query: 138 KLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITKLNDYGECLEIC- 196
           K   I YI +  E +++   L++ N+V  ++S DSD  VFG  +++  ++ + E L    
Sbjct: 152 KAMNISYIESCSEGEAECARLQKLNLVDYVLSNDSDAFVFGANKVLRNMSKFWEDLPATS 211

Query: 197 ------RDN---FIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKLVR 245
                 RD+   F+ +     +       I+    L G DY  G+  +G   A KL +
Sbjct: 212 SSPVKKRDHKEMFVTIVDLQQISDWNRASIVFFCTLLGADYNQGVRGLGSKKAAKLAQ 269

>KLLA0A09427g complement(821244..824279) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 1011

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 89/181 (49%), Gaps = 24/181 (13%)

Query: 124 DITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLI 183
           ++T EM   I       GI YI AP EA++Q   L Q  +V G+I++DSD+ +FG   + 
Sbjct: 745 EVTIEMIHEIQSLLSRFGIPYITAPMEAEAQCATLLQLKLVDGVITDDSDVFLFGGTHVY 804

Query: 184 TKL---NDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA 240
             +    +Y E   +  D F +      LG L  +++I +  L G DYT G+  +G +  
Sbjct: 805 KNMFQEKNYVEYYSL--DLFDQ-----KLG-LDRDKLIQLAQLLGSDYTPGLRGIGPVMG 856

Query: 241 MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP 300
           ++++  F +++        EG+    D    E E    AFQ Q     +RK++VS NEI 
Sbjct: 857 VEILAEFGSLKEFA-KWYNEGQF---DKQKLEGET---AFQKQ-----LRKRLVS-NEII 903

Query: 301 L 301
           L
Sbjct: 904 L 904

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 7/113 (6%)

Query: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60
           MG+  L   + P+  PV L       +A+D   W+++   +   +          + FF 
Sbjct: 1   MGVHSLWDIVSPVAKPVRLESLNERRMAVDASIWIYQFLKAMRNKEGDALRNAHIIGFF- 59

Query: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENK-----AIAERLWA 108
           +R   L  + ++P  VFDG  +PV K    + R +R++ K     A A RL A
Sbjct: 60  RRICKLLYYGIKPVFVFDG-GVPVLKLNTIRERKERRQGKRDTANATARRLLA 111

>KLLA0A01320g complement(118369..120123) weakly similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1 singleton, start
           by similarity
          Length = 584

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 106/267 (39%), Gaps = 59/267 (22%)

Query: 1   MGIQGLLPQLKPIQNP-VSLRRYEGEV---------LAIDGYAWLHRAACSCAYELAMGK 50
           MG   L  Q+     P V+ +++  E          +AIDGY WL      C Y     +
Sbjct: 1   MGSSELWNQISQYNVPRVAFKQFVAEFVEKNGRFPRIAIDGYLWLF----ECGY---FDE 53

Query: 51  PTDK--YLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWA 108
           P +K   L  ++++   +   +    ++FDG         + KRR KRK        LW 
Sbjct: 54  PQNKSKTLLNWLRKLKEMLHLQCFIVIIFDGTF-----KLDGKRRKKRK-----VATLWD 103

Query: 109 CGEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGII 168
                 +M+ F    D    +   II  CKL  I+ I AP E ++Q  +L+    V  ++
Sbjct: 104 SYWLMRSMNRFNH--DSVSYVDDYIIECCKLFNIQTINAPGEGEAQCAFLQLVGQVDFVL 161

Query: 169 SEDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPK--KFPLGSLTNEEIITMV----- 221
           S D+D+L FG  +++   + +G         +  LP     P+ S  NE  +T V     
Sbjct: 162 SNDADVLSFGASKVLKNYSKHG---------WQDLPNSSNSPVKSKQNERFVTFVDLDII 212

Query: 222 ------------CLSGCDYTNGIPKVG 236
                        L G DY  G+  +G
Sbjct: 213 KDWDRDRFVLFNLLVGSDYNGGVKGLG 239

>Scas_687.23
          Length = 745

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 111/317 (35%), Gaps = 75/317 (23%)

Query: 1   MGIQGLLPQLKPI--QNPVSLRRYEGEV---------LAIDGYAWLHRAAC------SCA 43
           MG+  +   L+P    N +  R +  +          +AID Y WL           S  
Sbjct: 1   MGVPQIWEYLRPYTEDNRLPFRHFVSDFRGKHGRSPRIAIDAYNWLFECGFIKSHGNSIK 60

Query: 44  YELAMGKPTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAI- 102
           Y      P  K +  FI R   L +  V   LVFDG   P  K+      D   +   I 
Sbjct: 61  YNSQGTLP--KAILNFISRLKDLLSLDVTFLLVFDGPMKPSFKNNFMNESDATLDFNQID 118

Query: 103 ---AERLWACG---EKKNAMDYFQKCVDIT---PEMAKCIICYCKLNGIRYIVAPFEADS 153
                + W       K NA      C+  T   PE   CI    +   I ++ +  E ++
Sbjct: 119 MIEYMKQWELHIQYHKDNAT----GCLTSTNHQPEFMSCITTILRAMNISFLESCGEGEA 174

Query: 154 QMVYLEQKNIVQGIISEDSDLLVFGCRRLITK----LNDYG----------------ECL 193
           Q  +L+    V  I + DSD L+FG  +L+      L+D G                   
Sbjct: 175 QCAWLQINGYVDFIWTNDSDTLIFGGTKLLKNYSKSLDDVGMTSTKASPSKSRSPSRSPS 234

Query: 194 EICRDNFIKLPKKFPLGSLTNEEIITMV----------------------CLSGCDYTNG 231
           +    +  ++P++   G L+ E  +T V                       LSG DY  G
Sbjct: 235 KSPSRSPTRIPQQETTGGLSREYFVTEVDLNRISLETEGRLGRWPLLFFSILSGADYNQG 294

Query: 232 IPKVGLITAMKLVRRFN 248
           +  +G   AMKL +  N
Sbjct: 295 VKGLGKAKAMKLAQLSN 311

>ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH]
           (300564..301703) [1140 bp, 379 aa]
          Length = 379

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 119/278 (42%), Gaps = 29/278 (10%)

Query: 1   MGIQGL----LPQLKPIQNPVSLRRYEGEVLAIDGYAWLH------RAACSCAYELAMGK 50
           MGI+GL      Q+     P  ++++ G  +AID    L+      R A       A G+
Sbjct: 1   MGIKGLNSIIQQQVPSAIRPREMKQFFGRRVAIDASMSLYQFLIAVRQADGVQLASADGE 60

Query: 51  PTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTE-SKRRDKRKENKAIAERLWAC 109
            T   +  F +   ++    ++P  VFDG    +K   + +KR + ++  + +AE     
Sbjct: 61  TTSHLMGMFYRTLWMVD-HGLKPCYVFDGSRRCLKAPPKLTKRTNAKEPEQKLAE----- 114

Query: 110 GEKKNAMDYFQKCVDITPEMAKCIICYCKLNG----IRYIVAPFEADSQMVYLEQKNIVQ 165
               N+ DY  +    +   +  +    ++ G     R    P EA++Q   L +K  V 
Sbjct: 115 -ADLNSRDYEARTRGWS-RWSNGMWRGQEIAGPDGHTRMWTLPGEAEAQCAELAKKGKVF 172

Query: 166 GIISEDSDLLVFGCRRLITKLNDYGECLEICRDNFIKLPKKFPLGSL--TNEEIITMVCL 223
              SED D L +    L+  L       E  ++   ++  +  L  L  + E+++ +  +
Sbjct: 173 AAASEDMDTLCYRTPYLLRHLT----FSEARKEPIHEIDTELVLQGLGLSQEQLVDLGIM 228

Query: 224 SGCDYTNGIPKVGLITAMKLVRRFNTIERIILSIQREG 261
            GCDY   I  VG +TA+KL++   ++E I+  I   G
Sbjct: 229 LGCDYCESIKGVGPVTALKLIKEHGSLENIVEFISSGG 266

>AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH]
           complement(869659..871755) [2097 bp, 698 aa]
          Length = 698

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/245 (20%), Positives = 96/245 (39%), Gaps = 37/245 (15%)

Query: 27  LAIDGYAWLHRAACSCAYEL--------AMGKPTDKYLQFFIKRFSLLKTFKVEPYLVFD 78
           +A+D + WL    C   + +        A+     K +  F+ +   L +  ++  LVFD
Sbjct: 38  IAVDAFQWLFE--CGFLFNVQQEERSTSAVWPAPRKAILNFVTKLRDLISLDLDFVLVFD 95

Query: 79  GDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQKCVDITPEMAKCIICYCK 138
           GD  P+ K    K+R   ++ +A   R    G            VD+   +       C+
Sbjct: 96  GDEKPIYKQHYWKKRGTGQQTEA---RYSPRGRSPQLPHQLHSVVDLAGGI-------CR 145

Query: 139 LNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITKLNDYGECL----- 193
              + YI A  E +++   L+    V  I++ DSD  +FG  R++   + + + L     
Sbjct: 146 AFNVDYITAAGEGEAECAALQVAGSVDYILTNDSDAAIFGASRILRNFSKHAQDLPSSGV 205

Query: 194 ----EICRDNFIKL------PKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKL 243
               +   + F+ +       ++ P  + + +       L+G DY  G+  +G   A  L
Sbjct: 206 SPVKKHVSEYFVTVVDIRAATEEHP--TFSRKAFALFAILTGADYGTGLQHLGYKRAWAL 263

Query: 244 VRRFN 248
            +  N
Sbjct: 264 TQWSN 268

>YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nuclease,
           has similarity to DNA repair nucleases Rad2p and Rad27p
           [2280 bp, 759 aa]
          Length = 759

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 65/142 (45%), Gaps = 13/142 (9%)

Query: 59  FIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDY 118
           FI R   L +  VE  LVFDG    +K S + K   ++       E+ +    +++  ++
Sbjct: 99  FISRLKELLSLNVEFLLVFDG---VMKPSFKRKFNHEQNATTCDDEKEYYSSWEQHVKNH 155

Query: 119 --FQKCVDI----TPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDS 172
             +  C  +     PE    +     L  I Y++A  E ++Q V+L+    V  I+S DS
Sbjct: 156 EVYGNCKGLLAPSDPEFISLVRKLLDLMNISYVIACGEGEAQCVWLQVSGAVDFILSNDS 215

Query: 173 DLLVFGCRRLITK----LNDYG 190
           D LVFG  +++       +D+G
Sbjct: 216 DTLVFGGEKILKNYSKFYDDFG 237

>CAGL0C02255g complement(228009..229955) similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1, start by
           similarity
          Length = 648

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 97/256 (37%), Gaps = 46/256 (17%)

Query: 27  LAIDGYAWL------HRAACSCAYELAMGKPTDKYLQF-----FIKRFSLLKTFKVEPYL 75
           +AIDG+ WL      H  A +  +        D  L        I +   L    V   +
Sbjct: 38  IAIDGHNWLFECGFYHNDARAEPFSFTKDSHDDDTLYAKPYMNMIHKLKELSLLDVSFVI 97

Query: 76  VFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQKCVDITPE--MAKCI 133
           VFDG   P       K + +++  ++I           + +D ++      PE  M K +
Sbjct: 98  VFDGPLKP-------KFKRQKETLRSITGTADVDTYLTSYVDSYRSFQTERPEGMMKKYM 150

Query: 134 ICYC--------KLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITK 185
             Y          L  + Y  A  E +S   +L+  + V  ++S DSD L+FG  R++  
Sbjct: 151 SQYTLKKVQELLNLLKVNYTFAYGEGESHCAWLQISDHVDYVMSNDSDTLMFGATRVLRN 210

Query: 186 LNDYGEC-----------------LEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDY 228
           L+   E                    I   N  ++ +K+ L  L++  ++    + G DY
Sbjct: 211 LSKNLEDKSPSSRQGNNSTSSEAEYYITEVNLQEINQKYGL-QLSSASLLFFSLIIGGDY 269

Query: 229 TNGIPKVGLITAMKLV 244
            +G+  +G   A+ L+
Sbjct: 270 NSGLSGLGKTKALTLM 285

>AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH]
           complement(1431488..1433797) [2310 bp, 769 aa]
          Length = 769

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%)

Query: 133 IICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITKL 186
           +I Y    GI Y+VAP+ +  Q+ YL +   V GI      LLV    + I  +
Sbjct: 166 LIQYFISKGINYMVAPYSSWIQLAYLLEDGYVDGIYGPTDLLLVESVPKFILGM 219

>Sklu_1834.2 YNL085W, Contig c1834 1199-3610
          Length = 803

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 133 IICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGI 167
           +ICY    GI Y VAP+ +  Q+ YL Q   +  I
Sbjct: 177 LICYLISQGIAYQVAPYSSWLQLAYLLQNGYIDAI 211

>CAGL0B02101g 194461..195798 similar to sp|P50079 Saccharomyces
           cerevisiae YGR223c, start by similarity
          Length = 445

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 345 IAQGDLNPY--DFHQPLANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLD 402
           +A+G LNP   + HQ   +  H   + + +N      N   +  K K ++S +       
Sbjct: 297 MAEGTLNPANPEDHQSSGSNGH---IKANTNQVHSLRNIVPTSWKPKYLDSVWSMCKVHL 353

Query: 403 HNPKVANNIHSLRQAEDKLTMAIKRRKLSN 432
            NPK+ NN++ L   ED+ T+A  R+  S+
Sbjct: 354 RNPKLRNNVNDLAFNEDRCTIAWCRQNRSH 383

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,576,458
Number of extensions: 802688
Number of successful extensions: 2715
Number of sequences better than 10.0: 54
Number of HSP's gapped: 2772
Number of HSP's successfully gapped: 62
Length of query: 690
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 581
Effective length of database: 12,822,747
Effective search space: 7450016007
Effective search space used: 7450016007
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)