Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR020W-A90904644e-62
KLLA0E09306g75311067e-08
Scas_699.27d79821051e-07
AAR108W-A7032866e-05
Kwal_56.231296925813e-04
AER021C6521770.002
Scas_710.48d6529730.006
YOL077W-A (ATP19)6821720.008
Sklu_2091.255049630.55
CAGL0D04752g35260610.96
KLLA0F12001g41253601.2
CAGL0A02596g87247591.6
Kwal_56.2454891957582.1
KLLA0E22726g103346556.4
KLLA0D03498g117545547.2
ADR314C45747549.1
Scas_521.289039549.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR020W-A
         (90 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR020W-A (YOR020W-A) [4834] chr15 (371684..371956) Protein of u...   183   4e-62
KLLA0E09306g 830886..831113 some similarities with ca|CA1107|IPF...    45   7e-08
Scas_699.27d                                                           45   1e-07
AAR108W-A [295] [Homologous to ScYOR020WX - SH] complement(53921...    38   6e-05
Kwal_56.23129                                                          36   3e-04
AER021C [2526] [Homologous to ScYOL077W-A (ATP19) - SH] (668604....    34   0.002
Scas_710.48d                                                           33   0.006
YOL077W-A (ATP19) [4742] chr15 (185437..185643) Subunit k of F0 ...    32   0.008
Sklu_2091.2 YDR110W, Contig c2091 826-2478 reverse complement          29   0.55 
CAGL0D04752g 466450..467508 similar to tr|Q06494 Saccharomyces c...    28   0.96 
KLLA0F12001g 1101429..1102667 gi|3024253|sp|O13366|ODPA_KLULA Kl...    28   1.2  
CAGL0A02596g 273775..276393 similar to sp|P32380 Saccharomyces c...    27   1.6  
Kwal_56.24548                                                          27   2.1  
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...    26   6.4  
KLLA0D03498g complement(301249..304776) similar to sp|P29465 Sac...    25   7.2  
ADR314C [2055] [Homologous to ScYOL061W (PRS5) - SH] (1258023..1...    25   9.1  
Scas_521.2                                                             25   9.2  

>YOR020W-A (YOR020W-A) [4834] chr15 (371684..371956) Protein of
          unknown function [273 bp, 90 aa]
          Length = 90

 Score =  183 bits (464), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 90/90 (100%), Positives = 90/90 (100%)

Query: 1  MGAAYKVFGKTVQPHVLAISTFIATAAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSD 60
          MGAAYKVFGKTVQPHVLAISTFIATAAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSD
Sbjct: 1  MGAAYKVFGKTVQPHVLAISTFIATAAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSD 60

Query: 61 AMGKDDDVVKSIEGFLNDLEKDTRQDTKAN 90
          AMGKDDDVVKSIEGFLNDLEKDTRQDTKAN
Sbjct: 61 AMGKDDDVVKSIEGFLNDLEKDTRQDTKAN 90

>KLLA0E09306g 830886..831113 some similarities with
          ca|CA1107|IPF11271 Candida albicans by homology to S.
          cerevisiae: ATP19 subunit K of the dimeric form of
          mitochondrial F1F0-ATP synthase, hypothetical start
          Length = 75

 Score = 45.4 bits (106), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 1  MGAAYKVFGKTVQPHVLAISTFIATAAVASY 31
          MGAAYK+FG TVQPH+LAI+T  +    A+Y
Sbjct: 1  MGAAYKIFGMTVQPHILAIATLGSVFGGAAY 31

>Scas_699.27d
          Length = 79

 Score = 45.1 bits (105), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 11/82 (13%)

Query: 1  MGAAYKVFGKTVQPHVLAISTFIATAAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSD 60
          M   YK+ G+TV+PH+LA++T   +A V +YF+ K           +    K  ES+   
Sbjct: 1  MSQGYKILGRTVKPHILAVATVATSAGVVAYFSRK-----------SPEPSKPVESAGPT 49

Query: 61 AMGKDDDVVKSIEGFLNDLEKD 82
          + GK  +   +IE  LND  K+
Sbjct: 50 SSGKSINDEFNIEEALNDYLKE 71

>AAR108W-A [295] [Homologous to ScYOR020WX - SH]
          complement(539210..539422) [213 bp, 70 aa]
          Length = 70

 Score = 37.7 bits (86), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 1  MGAAYKVFGKTVQPHVLAIST-FIATAAVASY 31
          MG AY +FGK VQPHVL + T F     V+ Y
Sbjct: 1  MGQAYNIFGKPVQPHVLVLGTLFTLFGGVSLY 32

>Kwal_56.23129
          Length = 69

 Score = 35.8 bits (81), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 1  MGAAYKVFGKTVQPHVLAISTFIAT 25
          MGAAY + GKTVQP+ LA+ T  A 
Sbjct: 1  MGAAYNILGKTVQPYQLALGTIAAV 25

>AER021C [2526] [Homologous to ScYOL077W-A (ATP19) - SH]
          (668604..668801) [198 bp, 65 aa]
          Length = 65

 Score = 34.3 bits (77), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 1  MGAAYKVFGKTVQPHVLAIST 21
          MGAAY + G+T QPH L+++T
Sbjct: 1  MGAAYTILGRTFQPHQLSLAT 21

>Scas_710.48d
          Length = 65

 Score = 32.7 bits (73), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 1  MGAAYKVFGKTVQPHVLAISTFIATAAVA 29
          M   Y++ G+ +QPH LA++T  A A +A
Sbjct: 1  MANTYEIMGRVIQPHQLAVATIGAVALIA 29

>YOL077W-A (ATP19) [4742] chr15 (185437..185643) Subunit k of F0
          subunit of ATP synthase-mitochondrial respiratory
          complex V, ATP synthase is involved in ATP generation
          during cellular respiration and is required for
          mitochondrial cristae formation, associates only with
          dimeric form of ATP synthase [207 bp, 68 aa]
          Length = 68

 Score = 32.3 bits (72), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 14/21 (66%)

Query: 1  MGAAYKVFGKTVQPHVLAIST 21
          MGAAY   GK + PH LAI T
Sbjct: 1  MGAAYHFMGKAIPPHQLAIGT 21

>Sklu_2091.2 YDR110W, Contig c2091 826-2478 reverse complement
          Length = 550

 Score = 28.9 bits (63), Expect = 0.55,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 26  AAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKSIEG 74
           A+++   T   K K  G+N S LS  +S E  NS+A   + D+ + I G
Sbjct: 476 ASLSDTITPTKKVKKVGENRSRLSGSESVEQGNSEANRDEYDLSEEIPG 524

>CAGL0D04752g 466450..467508 similar to tr|Q06494 Saccharomyces
           cerevisiae YPR127w, start by similarity
          Length = 352

 Score = 28.1 bits (61), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 28  VASYFTTKPKTKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKSIE-------GFLNDLE 80
           V  +F   P    E +    +S + + + S+  AMGK DDVVKS+E       GF+   E
Sbjct: 71  VRDFFKKYP----ELREHVIISCKGAMDLSDLHAMGKYDDVVKSVEACTEAIGGFIEIFE 126

>KLLA0F12001g 1101429..1102667 gi|3024253|sp|O13366|ODPA_KLULA
          Kluyveromyces lactis Pyruvate dehydrogenase E1
          component alpha subunit, mitochondrial precursor
          (PDHE1-A), start by similarity
          Length = 412

 Score = 27.7 bits (60), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 38 TKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKSIEGFLNDLEKDTRQDTKAN 90
           +N  KN  ALSQ         D + + D    S EG+L D+ + + Q TK+N
Sbjct: 20 VRNFSKNVRALSQVADETKPGDDDLVQIDLPETSFEGYLLDVPELSYQTTKSN 72

>CAGL0A02596g 273775..276393 similar to sp|P32380 Saccharomyces
           cerevisiae YDR356w NUF1, hypothetical start
          Length = 872

 Score = 27.3 bits (59), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 25/47 (53%)

Query: 36  PKTKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKSIEGFLNDLEKD 82
           P+++   +NS A  Q++   +  SD + K  + +K  E  + DLE +
Sbjct: 88  PESRTSARNSGAAPQEEQNRNDYSDILSKTSNPIKDQEQKIKDLEHE 134

>Kwal_56.24548
          Length = 919

 Score = 26.9 bits (58), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query: 32  FTTKPKTKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKSIEGFLNDLEKDTRQDTK 88
             + P T N     S  S  K G+  NSD+  +DD        F N++E++  +D++
Sbjct: 88  LNSDPDTGNSSDTGSMASIPKLGQGRNSDSELQDDR-------FSNNMEENEDEDSQ 137

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score = 25.8 bits (55), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 43  KNSSALSQQKSGESSNSDAMGKDDDVVKSIEGFLNDLEKDTRQDTK 88
           K +  + Q K+ E+ + D + +   V K +EGF N  E+D +Q T+
Sbjct: 810 KQTGNIKQNKTSETDDFDKLSQISGVHK-LEGFFNSKEQDEKQSTE 854

>KLLA0D03498g complement(301249..304776) similar to sp|P29465
           Saccharomyces cerevisiae YBR023c CHS3 chitin synthase
           III singleton, start by similarity
          Length = 1175

 Score = 25.4 bits (54), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 33  TTKPKTKNEGKNSSALSQQKSGESSNSDAMGK----DDDVVKSIE 73
           + +P  KN  KNSS++S        +  ++GK    +D V++S+E
Sbjct: 503 SLRPMKKNHKKNSSSISLFNRKSRFSQQSLGKSVHLNDPVIQSLE 547

>ADR314C [2055] [Homologous to ScYOL061W (PRS5) - SH]
           (1258023..1259396) [1374 bp, 457 aa]
          Length = 457

 Score = 25.4 bits (54), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 17  LAISTFIATAAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSDAMG 63
           LAI   I+T  +      + K ++ G NS     QK  E+S+S+A G
Sbjct: 144 LAIENSISTLQLGESAPVRAKLEHSGSNSRIPVIQKHEEASSSEAAG 190

>Scas_521.2
          Length = 890

 Score = 25.4 bits (54), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 23/39 (58%)

Query: 34  TKPKTKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKSI 72
           TKP + +   N +  SQ +S E ++ + MG D++ ++ I
Sbjct: 806 TKPFSNHNASNFAQGSQFQSNEVTDGNVMGTDNESLRDI 844

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.121    0.317 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,872,748
Number of extensions: 106338
Number of successful extensions: 722
Number of sequences better than 10.0: 72
Number of HSP's gapped: 721
Number of HSP's successfully gapped: 72
Length of query: 90
Length of database: 16,596,109
Length adjustment: 61
Effective length of query: 29
Effective length of database: 14,484,411
Effective search space: 420047919
Effective search space used: 420047919
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 54 (25.4 bits)