Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR019W73071233560.0
YDR475C8764357476e-87
CAGL0H08261g7346087187e-84
Scas_660.307743917136e-83
CAGL0M08954g8504456554e-74
Kwal_47.182467734236365e-72
Scas_699.297166676301e-71
AEL233C7934115215e-56
KLLA0F02684g7794094012e-40
Kwal_14.10286801791722e-12
KLLA0E15642g7661901472e-09
YGR237C7851881436e-09
CAGL0F07975g7701961382e-08
ADL147W6261721241e-06
Scas_595.13766401151e-05
AGL139W73190684.2
CAGL0H01331g71458669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR019W
         (717 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unkno...  1297   0.0  
YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Prote...   292   6e-87
CAGL0H08261g 810168..812372 weakly similar to tr|Q99248 Saccharo...   281   7e-84
Scas_660.30                                                           279   6e-83
CAGL0M08954g 890764..893316 weakly similar to tr|Q99248 Saccharo...   256   4e-74
Kwal_47.18246                                                         249   5e-72
Scas_699.29                                                           247   1e-71
AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH] (1...   205   5e-56
KLLA0F02684g 242962..245301 some similarities with sgd|S0005545 ...   159   2e-40
Kwal_14.1028                                                           71   2e-12
KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089 Saccha...    61   2e-09
YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein...    60   6e-09
CAGL0F07975g complement(782229..784541) similar to sp|P50089 Sac...    58   2e-08
ADL147W [1594] [Homologous to ScYGR237C - SH] complement(431887....    52   1e-06
Scas_595.13                                                            49   1e-05
AGL139W [4173] [Homologous to ScYDR176W (NGG1) - SH] complement(...    31   4.2  
CAGL0H01331g complement(130263..132407) similar to tr|Q06629 Sac...    30   9.1  

>YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unknown
           function [2193 bp, 730 aa]
          Length = 730

 Score = 1297 bits (3356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/712 (90%), Positives = 643/712 (90%)

Query: 1   MISVCPQNDLQKCYRSLTFDVPGQQFEERNEQNLKKRAKKKGSFQPSVAFDTVPSTAGYS 60
           MISVCPQNDLQKCYRSLTFDVPGQQFEERNEQNLKKRAKKKGSFQPSVAFDTVPSTAGYS
Sbjct: 1   MISVCPQNDLQKCYRSLTFDVPGQQFEERNEQNLKKRAKKKGSFQPSVAFDTVPSTAGYS 60

Query: 61  SIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLRDTFQSSPFLNTRKENKSESS 120
           SIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLRDTFQSSPFLNTRKENKSESS
Sbjct: 61  SIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLRDTFQSSPFLNTRKENKSESS 120

Query: 121 SFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQR 180
           SFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQR
Sbjct: 121 SFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQR 180

Query: 181 KLQINERLNDKKKWFTYPELIFSEERIKPLYRGDDSAPCTKEQKRKHKILQQKVGYPNNP 240
           KLQINERLNDKKKWFTYPELIFSEERIKPLYRGDDSAPCTKEQKRKHKILQQKVGYPNNP
Sbjct: 181 KLQINERLNDKKKWFTYPELIFSEERIKPLYRGDDSAPCTKEQKRKHKILQQKVGYPNNP 240

Query: 241 KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLPKMISNRKKTAKDDTEWAPGYQK 300
           KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLPKMISNRKKTAKDDTEWAPGYQK
Sbjct: 241 KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLPKMISNRKKTAKDDTEWAPGYQK 300

Query: 301 EVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHE 360
           EVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHE
Sbjct: 301 EVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHE 360

Query: 361 RNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQREVNEHYVSKNHMKHEHTD 420
           RNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQREVNEHYVSKNHMKHEHTD
Sbjct: 361 RNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQREVNEHYVSKNHMKHEHTD 420

Query: 421 VESMSSSMFKKNTXXXXXXXXXXXXYAEDFKRQGYIKKQFNTSNDSIPRKLTGLAQHSRR 480
           VESMSSSMFKKNT            YAEDFKRQGYIKKQFNTSNDSIPRKLTGLAQHSRR
Sbjct: 421 VESMSSSMFKKNTISDISSHISVDSYAEDFKRQGYIKKQFNTSNDSIPRKLTGLAQHSRR 480

Query: 481 KITGDIEKLQDDEKDRECTXXXXXXXXXXXXXRESLKSSLAIETLPGKNVSQSSHGDQIS 540
           KITGDIEKLQDDEKDRECT             RESLKSSLAIETLPGKNVSQSSHGDQIS
Sbjct: 481 KITGDIEKLQDDEKDRECTKEKLLLKKIDIIIRESLKSSLAIETLPGKNVSQSSHGDQIS 540

Query: 541 SFKNALIGNGSKNTKFRKSLIPYSSSEEQNTTTTIKLSSSPTSQIKFATSVKHKDGRAAL 600
           SFKNALIGNGSKNTKFRKSLIPYSSSEEQNTTTTIKLSSSPTSQIKFATSVKHKDGRAAL
Sbjct: 541 SFKNALIGNGSKNTKFRKSLIPYSSSEEQNTTTTIKLSSSPTSQIKFATSVKHKDGRAAL 600

Query: 601 GKARNLPDIRHSISFDKENSFDPSDKSSSVDNSIPLRKVKSAGALRKVKTNDXXXXXXXX 660
           GKARNLPDIRHSISFDKENSFDPSDKSSSVDNSIPLRKVKSAGALRKVKTND        
Sbjct: 601 GKARNLPDIRHSISFDKENSFDPSDKSSSVDNSIPLRKVKSAGALRKVKTNDSSSSAGSK 660

Query: 661 XXXXXXXXXXXXXXXXXXIFKVFXXXXXXXXXXXXXXXXXXGDVFESDDRND 712
                             IFKVF                  GDVFESDDRND
Sbjct: 661 KSSSSFSTVNTFTGGGVGIFKVFKSGSSSGNKSSSRRNSSSGDVFESDDRND 712

>YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Protein
           of unknown function [2631 bp, 876 aa]
          Length = 876

 Score =  292 bits (747), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 165/435 (37%), Positives = 242/435 (55%), Gaps = 77/435 (17%)

Query: 44  FQPSVAFDTVPSTAGYSSIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLRDTF 103
           + P V+F+TVP +   S +D+ +  F GV +   YTMEE YDDE+   S N   Y     
Sbjct: 70  YLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNADYFSGNS 129

Query: 104 QSSPFLNTRKENKSESSSFPMRSSK---LLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIV 160
            SS         + E S+ P R S      ++N  I K F +S+NGKIVR DYP+TP  +
Sbjct: 130 YSS---------RREGSASPGRYSSPPPASKRNIKIGKMFKISENGKIVREDYPTTPTDI 180

Query: 161 NETLMINRFEKNWIKLWRQRKLQINERLNDKKKWFTYPELIF------SEERIKPLYR-- 212
           N+ L+I+R   NW +LW ++K QI+ RL  K+ +F YP ++F      S E   P  +  
Sbjct: 181 NDALVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFN 240

Query: 213 ---GDDSAPCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNLD 269
               D   P TK QKRK ++L +KVG+PN P+TI+CHI+G+KHTWVALDW +    +N D
Sbjct: 241 PPIEDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTD 300

Query: 270 HIVVITTLPKM----------ISNRKKT--AKDDT------------------------- 292
           HIVV+  LP++          +S RK+     DD+                         
Sbjct: 301 HIVVLANLPRLTKNNFEDNDSMSERKRMLMMMDDSRSVSSARRSRSRSRSRSICTRRALS 360

Query: 293 ----------------EWAPGYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKI 336
                           EW  GY +  I++KL D+FDY+  ++   + SVK+T+EI++GK 
Sbjct: 361 LGPEESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQDR-SVKVTVEILIGKT 419

Query: 337 KKSLVDVINVHTPDFLVLATLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSF 396
           KK+L++ IN++ PDF V +TL+ ER ++L+ +KS  LTD    ++PIPTF+VP+KRM+  
Sbjct: 420 KKTLLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDL 479

Query: 397 ELNLQREVNEHYVSK 411
           E++LQ+E  E  V+K
Sbjct: 480 EIDLQKEFKEPEVTK 494

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 4/30 (13%)

Query: 584 QIKFATSVKHKDGRAALGKARNLPDIRHSI 613
           QIKFA+SVK+ DG AALG  ++    RHS+
Sbjct: 728 QIKFASSVKNVDGNAALGAIKS----RHSL 753

>CAGL0H08261g 810168..812372 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 734

 Score =  281 bits (718), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 189/608 (31%), Positives = 306/608 (50%), Gaps = 67/608 (11%)

Query: 44  FQPSVAFDTVPSTAGYSSIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLRDTF 103
            +PSV++DTVP   GYS+I+D   GF GV V  + T+    D      +   Q +L   F
Sbjct: 34  IRPSVSYDTVPKYIGYSAIEDMDGGFPGVEVTKH-TVPVKTDLSRKGATLGSQVFLNPRF 92

Query: 104 QSSPFLNTRKENKSES------SSFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTP 157
                ++   + + E        + P+ ++ L    S  K  F  + +GKI+R DYP+ P
Sbjct: 93  LLHNHVSGDDDYEIERMKKRIFDASPLANNPLSLTRSK-KSVFNYTADGKIIRSDYPTKP 151

Query: 158 VIVNETLMINRFEKNWIKLWRQRKLQINERLNDKKKWFTYPELIFSEERIKPLYRGDDSA 217
           V VN+ ++ +R   +W + W QRK +I   +  K + F YP+++F E + KPL  GDD  
Sbjct: 152 VFVNKIIIRSRTNVHWDERWAQRKSKIEYNMEHKDEKFMYPDILFPEVKEKPLIMGDDFV 211

Query: 218 PCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTL 277
           P TKEQ+R++KIL  K  +P  P+T+VC+I+G++HTW  LDW V   A N DH+V++ T+
Sbjct: 212 PITKEQRRRNKILTIKQAHPTLPRTVVCYISGRRHTWAGLDWAVRSLAEN-DHLVIVATI 270

Query: 278 PKMISNRKKTAKDDTEWAPGYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIK 337
           PKM S+R +  + D  W  GY  + ID  ++D+F+YI +++K V  ++K+T+EI + + K
Sbjct: 271 PKMTSHRDQEPEVDGTWVSGYTFDEIDTIISDLFEYI-KVIKPVHKALKVTIEISIERTK 329

Query: 338 KSLVDVINVHTPDFLVLATLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFE 397
            +L+D INV++PDFL+L TLK +R ENL++Y+   + D    ++PIPTF+VP++R++  E
Sbjct: 330 GALIDAINVYSPDFLILGTLKWQRYENLVSYRGNNMVDKLCTTFPIPTFIVPARRLFMLE 389

Query: 398 LNLQREVNEHYVSKNHMKH---EHTDVE---------SMSSSMFKKNTXXXXXXXXXXXX 445
             ++ E     +S N  K    E+ ++E         + S   + KN             
Sbjct: 390 KEIEEETLTKLISDNTKKAVTPENEEIEYPRSPKLVSTDSFGFWSKNEQKLLDESYSIST 449

Query: 446 YAEDFKRQGYIK--------------------KQFNTSNDSIPRKLTGLAQHSRRKITGD 485
             +  KRQ                             S +SI  KL  +A  +R+ +  D
Sbjct: 450 KDKLEKRQESFTSLTTHESEDSLAIEDDDDRDSNLLESTESIVSKLKSIAITNRKNMMAD 509

Query: 486 IEKLQDDEKDRECTXXXXXXXXXXXXXRESLKSSLAIETLPGKNVSQSSHGDQISSFKNA 545
           +E+   D +                  + SL SS  I+ L  +N+ + + G   +  +  
Sbjct: 510 LEEF--DNEHSNINTKENQLAKVSLIIKHSLNSSNTIKNLT-QNLDEENRG--FAVLQKV 564

Query: 546 LIGNGSKNTKFRKSL---------IPYSSSEEQNTTTTIKLSSSPTSQIKFATSVKHKDG 596
           + G G+  ++ + S+         IP  SS ++             SQIKFA++VK  DG
Sbjct: 565 ITGTGTVESRPKFSMVDAVRVNGKIPGESSAKKR-----------RSQIKFASNVKPTDG 613

Query: 597 RAALGKAR 604
            A LG  R
Sbjct: 614 TAGLGTPR 621

>Scas_660.30
          Length = 774

 Score =  279 bits (713), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 154/391 (39%), Positives = 236/391 (60%), Gaps = 38/391 (9%)

Query: 44  FQPSVAFDTVP-STAGYSSIDDSREGFKGVPV--PNYYTMEECYDDETDSFSPNLQYYLR 100
           ++  V+F+T+P  T+  S +D+    F GV +  P+ YTM+E YD+E+   S N  +++ 
Sbjct: 45  YKKCVSFNTIPVKTSKDSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIH 104

Query: 101 DTFQSSPFLNTRKENKSESSSFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIV 160
           + + +    +  KE        P  ++    K   +   F +++NGKIVR DYPS P + 
Sbjct: 105 NKYITQKGFSNVKE------ILPPPTTNG-GKRVALSNLFKIAENGKIVREDYPSRPTLS 157

Query: 161 NETLMINRFEKNWIKLWRQRKLQINERLNDKKKWFTYPELIFSEERIKPLYRG--DDSAP 218
           NE ++INR   +W  LW +RKLQI+ RL  K++ F Y   +FS++          D   P
Sbjct: 158 NEAVVINRAVLDWGSLWEKRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNNIPKKEDPYMP 217

Query: 219 CTKEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLP 278
            +KEQKRK K+L++ VG+P  P+TI+C ++G++HTWVALDWT+   A++ D +VV+  LP
Sbjct: 218 LSKEQKRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLP 277

Query: 279 KMI----SNRKKTA----------------------KDDTEWAPGYQKEVIDQKLNDIFD 312
           KMI    SN++ +                       +D+ EW+ GY K+VI+QKL DIF 
Sbjct: 278 KMIDLSKSNKRGSRSRSRTRSQARSRSSEKLYSTLPEDEEEWSAGYSKDVIEQKLRDIFR 337

Query: 313 YILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHERNENLITYKSKK 372
           YI  L+     S+KIT+E+I+GK KK L +VIN +TPDF++ +TLK +R E+L+ +KS+K
Sbjct: 338 YISVLLTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRK 397

Query: 373 LTDVFPVSYPIPTFVVPSKRMYSFELNLQRE 403
           LTD    SYP+P +VVP+KRM+ FE  L ++
Sbjct: 398 LTDKICTSYPVPVYVVPAKRMFDFERKLAKQ 428

>CAGL0M08954g 890764..893316 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 850

 Score =  256 bits (655), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 151/445 (33%), Positives = 242/445 (54%), Gaps = 67/445 (15%)

Query: 29  RNEQNLKKRAKKKGSFQPSVAFDTVPSTAGYSSIDDSREGFKGVPV-PNYYTMEECYDDE 87
           + ++++  RA  K   +P V+F+TVP  + ++ +D+  + F GV + P  YTMEE YDDE
Sbjct: 66  KKQRSVSVRANAK--VRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDE 123

Query: 88  TDSFSP-NLQYYLRDTFQSSPFLNTRKENKSESSSFP----------MRSSKLLEKN-SD 135
           +   S  N  Y L +++ +   +    +N +  SS P           +  K+  K  ++
Sbjct: 124 SGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDREYPSAGKQKKMSSKQQAN 183

Query: 136 IKKYFLVSKNGKIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQRKLQINERLNDKKKWF 195
           I K F ++KNG+IVR DYPS P +VN+  ++NR   +W   WR R+  I +R  D  + F
Sbjct: 184 ITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKEDLSETF 243

Query: 196 TYPELIFSEERIKP----LYRGDDSAPCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKK 251
            YP+L+F ++  KP    +  G+D  P TKEQ++K KI+ +K+   + P+ ++CHI+GK+
Sbjct: 244 EYPQLLFPQQ-TKPSEPVIMMGEDYKPLTKEQRKKEKIIHKKIESTSGPRVVLCHISGKR 302

Query: 252 HTWVALDWTVYKFARNLDHIVVITTLPKMIS------------------------NRKKT 287
           HTWV LDWT+ + + + DHIVV+  +P+MIS                        NRK  
Sbjct: 303 HTWVGLDWTIKRLSNDGDHIVVLAHIPRMISSRRLITSASASRSRSRTRSRSRDVNRKAY 362

Query: 288 AKDD----------------------TEWAPGYQKEVIDQKLNDIFDYILQLVKVVKISV 325
            K D                       EWA GY +E ++  + +IFDYI  ++   + SV
Sbjct: 363 NKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEER-SV 421

Query: 326 KITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHERNENLITYKSKKLTDVFPVSYPIPT 385
           KIT+E++VG    +++D  N + PD +V +TL+ ER +NL+ +KS  L D     +P+P 
Sbjct: 422 KITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLWKSNLLIDKLATVFPLPL 481

Query: 386 FVVPSKRMYSFELNLQREVNEHYVS 410
           FVVP++RM+ FE  L+ E  +  +S
Sbjct: 482 FVVPARRMFLFEHGLEEESKQIEIS 506

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 82/154 (53%), Gaps = 17/154 (11%)

Query: 514 ESLKSSLAIETLPGKNVSQSSHGDQISSFKNALIGNGSKN--TKFRKSLI-----PYSSS 566
           +++K SLAIE L  ++      G  ++  K  + G    N  +  +KS++     P ++ 
Sbjct: 653 QTIKFSLAIEDLGSESDDDDDVG--LTKLKRVITGGAVLNPQSGSKKSMLSVLDNPKTTR 710

Query: 567 EEQN---TTTTIKLSSSP-TSQIKFATSVKHKDGRAALGKA--RNLPDIR-HSISFDKEN 619
           ++++   TT+ +  +  P +SQIKFA+SVKHKDG  ALG +     P I+ H+ S D   
Sbjct: 711 KKKSLSATTSGVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQIQVHAASEDSSP 770

Query: 620 SFDP-SDKSSSVDNSIPLRKVKSAGALRKVKTND 652
              P    ++   N   L+ +KS  +LR+VK+ND
Sbjct: 771 KLTPIRSYNTGSSNQAGLKTMKSNNSLRRVKSND 804

>Kwal_47.18246
          Length = 773

 Score =  249 bits (636), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 147/423 (34%), Positives = 236/423 (55%), Gaps = 62/423 (14%)

Query: 33  NLKKRAKKKGS-FQPSVAFDTVPSTAGYSSIDDSREGFKGVPVPNYYTMEECYDDETDSF 91
           ++ +  K KGS F P V+FDTVP  AG ++ +D  EG        Y T EE YD+E    
Sbjct: 35  SITEGGKFKGSNFVPGVSFDTVPLLAG-TACEDFDEGHCSDHTLEY-TEEEFYDNEC--- 89

Query: 92  SPNLQYYLRDTFQSSPFLNTRKENKSESSSFPMR-----SSKLLEKNSDIKKYFLVSKNG 146
           SP+      +     PF ++R       SS P+R     S  L++   +      V  +G
Sbjct: 90  SPDFLRPSGNDRLMVPFSHSR-------SSSPLRGQSGTSMSLIDSTMNGLDGIHVGADG 142

Query: 147 KIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQRKLQINERLNDKKKWFTYPELIFSEER 206
           +I R DYPS P IVN+ L+INR  K++  LW +RK QI++RL  ++  F +P+++F  E+
Sbjct: 143 RITRTDYPSRPTIVNDALVINRTHKDYSALWLKRKEQIDQRLRSREAHFVFPDILFPPEK 202

Query: 207 IKPLYRGDDSAPCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFAR 266
           +  L   D   P +KE++RK  I+ +K+GYPN+P+TI+C+I+G+KHTWV+LDW + +F++
Sbjct: 203 VANLPLSDGYTPLSKEERRKALIIGKKIGYPNSPRTILCYISGRKHTWVSLDWLLKRFSQ 262

Query: 267 NLDHIVVITTLPKMISNR------------------------------KKTAKDDT---- 292
           ++DH+V+IT LPKM ++R                              ++T   D     
Sbjct: 263 DVDHLVIITNLPKMSNHRSRSRSRSRSTAPRSRSAAPSTHSSSGVSSIQRTLSADGHGDH 322

Query: 293 ---------EWAPGYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDV 343
                    EWA GY  + I + LN+I  Y+  ++   + +VK+T+EI++GK++K +VD 
Sbjct: 323 NKHVHEHWLEWASGYDADQIKETLNNILRYVTTILPDHR-AVKVTVEIVIGKLQKIVVDA 381

Query: 344 INVHTPDFLVLATLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQRE 403
           INV+ PD +VL++L+ + +E+L+ +KS  + D    + PIP  +VP K+M   E  +  E
Sbjct: 382 INVYGPDLIVLSSLRSKPDESLVRWKSNGVNDKICQTLPIPILLVPVKKMLELENEVFNE 441

Query: 404 VNE 406
           + E
Sbjct: 442 ICE 444

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 582 TSQIKFATSVKHKDGRAALGKARNLPDIRHSISFDKENSFDPSDKSSSVDNS--IPLRKV 639
           +SQIKFA+SVK  DG+   G   + P I  SIS+D   S  P + S   +NS  + LRKV
Sbjct: 641 SSQIKFASSVKRNDGKE--GHTESKP-IERSISYDL--SLRP-ESSQGTNNSRNMDLRKV 694

Query: 640 KSAGALR 646
           +SA  ++
Sbjct: 695 RSATGIK 701

>Scas_699.29
          Length = 716

 Score =  247 bits (630), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 191/667 (28%), Positives = 317/667 (47%), Gaps = 110/667 (16%)

Query: 44  FQPSVAFDTVPSTAG---YSSIDDSREGFKGVPVPNYYTMEECYDDETDSFSPNLQYYLR 100
           ++P V+F+TVPS++    Y  +D     F+GV +P                         
Sbjct: 33  WEPCVSFNTVPSSSSEKEYPDLD-----FEGVTMP------------------------- 62

Query: 101 DTFQSSPFLNTRKENKSESSSFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIV 160
            + +  PF      + S+     + SSK  ++   + + F +++ GKIVR DYPS P++ 
Sbjct: 63  -SMKRQPFYYHEYPSNSQ-----LCSSKNPKRQKSMNEMFKMAQGGKIVRVDYPSRPMVD 116

Query: 161 NETLMINRFEKNWIKLWRQRKLQINERLN-DKKKWFTYPELIFSEER-----------IK 208
           NE +++ + +  W K WR+RK  I  R   D    F Y  ++F  E            +K
Sbjct: 117 NEAMIMTKKQPLWRKKWRERKKIIEARRKCDGDSVFKYRFILFPHEEKQKEGKGSGGTLK 176

Query: 209 PLYRGDDSAPCT---------KEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDW 259
             Y G  +             KEQKR+ +++  K+G  N P+TIVCHI+G++HTWVALDW
Sbjct: 177 KRYMGLSNNSSHSSSKTDVKLKEQKRQKEVINLKIGDTNLPRTIVCHISGRRHTWVALDW 236

Query: 260 TVYKFARNLDHIVVITTLPKMISNRKKTAKD------------DTEWAPGYQKEVIDQKL 307
              +  ++ DH+V++  LP+M+  R K A D            + EW  GY + ++  ++
Sbjct: 237 LFKELVQDTDHVVILANLPRMVC-RSKVAPDTKKIIQDEPKLLEEEWTSGYSENLVASRI 295

Query: 308 NDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHERNENLIT 367
             I +YI  ++ V K S+KIT+EI +GK KK L+D IN++TP+  V  TLK  + ENLI+
Sbjct: 296 ARILEYISLILPVDK-SIKITVEIAIGKTKKVLIDAINIYTPNLFVFGTLKWSKTENLIS 354

Query: 368 YKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQREVNEHYVSKNHMKHEHTD------- 420
           YKS  L D F V YPIPTF+VP++RM  FEL+LQ +       K+  K+ H D       
Sbjct: 355 YKSNILMDTFCVHYPIPTFIVPARRMSKFELSLQEQFANCEQQKSFKKNNHVDKVNKNQQ 414

Query: 421 -----VESMSSSMFKKNTXXXXXXXXXXXXYAEDFKRQGYIKKQFNTSNDSIPRK-LTGL 474
                V+S  S      +             ++D      +    + SN +  R  L  +
Sbjct: 415 SIMLAVQSQDSLTAGYESSTETDSLDSVEKTSDDKDDNESVDTLRSYSNQTGTRANLCNI 474

Query: 475 AQHSRRKITGDIEKLQDDEKDRECTXXXXXXXXXXXXXRESLKSSLAIETLPGKNVSQSS 534
           A+  R  +  ++  L+ ++K  + T             + S++  L  + +  +++  ++
Sbjct: 475 ARDYRHSMLKELNTLEANKK--KLTNQERQLGKLDIIIKASIRLVLKTDEIDEQSI--AT 530

Query: 535 HGDQISSFKNALIGNGSKNTKFRKSLI------PYSSSEEQNTTTTIKLSSSPTSQIKFA 588
           +     + K  + G  S++    +S++      P + +++     T+   S  +SQI+FA
Sbjct: 531 NNKDYMNLKTTITGGKSRSQSRPRSMLDVNGYDPRAETKQSELGATL-YQSRGSSQIRFA 589

Query: 589 TSVKHKDGRAALGKARNLPDIRHSISFDKENSFDPSDK---SSSVDNSIPLRKVKSAGAL 645
            +V  KDG++ALG  +       SI         PS K     S ++ IPLRK+KS G L
Sbjct: 590 GNVNPKDGKSALGTIKKPQSGGASI---------PSSKYISDYSYNDVIPLRKIKSTGGL 640

Query: 646 RKVKTND 652
              K+++
Sbjct: 641 HPRKSSE 647

>AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH]
           (193752..196133) [2382 bp, 793 aa]
          Length = 793

 Score =  205 bits (521), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 116/411 (28%), Positives = 215/411 (52%), Gaps = 66/411 (16%)

Query: 44  FQPSVAFDTVPSTAGYSSIDDSREGF----KGVPVPNYYTMEECYDDETDSFSPNLQYYL 99
           F P+++FDTVP   G S  +D ++      +       YT+EE Y++E  S++ + +   
Sbjct: 71  FVPTISFDTVP-IQGISPEEDEQDALHEHQRAYGTSLDYTLEEYYNNEDTSYNHDYRSGG 129

Query: 100 RDTFQSSPFLNTRKENKSESSSFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVI 159
               + SP        +S S S     ++L +        F V  +G+ VR DYPS   +
Sbjct: 130 GYAGELSPL-------RSLSPSRYGSGAQLAK--------FDVLPDGRRVRIDYPSKSTL 174

Query: 160 VNETLMINRFEKNWIKLWRQRKLQINER-LNDKKKWFTYPELIFSEERIK----PLYRGD 214
           ++++ ++N+  + W   W+ RK QI  R L + ++W+ YP ++F E ++     P+   +
Sbjct: 175 LSDSFVLNKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILFPETKVDLSDLPMINDE 234

Query: 215 DSAPCTKEQ---KRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNLDHI 271
             A  + ++   KR  ++++  VG+P +P+ ++CH++G+KHTW A+DW +  F  + DH+
Sbjct: 235 GVAYNSNQRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHTWAAVDWVLQNFIADSDHL 294

Query: 272 VVITTLPKMIS-------------------------------------NRKKTAKDDTEW 294
           VV+  LP+++S                                     +   T   D EW
Sbjct: 295 VVVANLPRLMSRFGYMSRSVSRSRSRSRSRSVRRTTGLNSTSSFGSDVSESMTKNKDEEW 354

Query: 295 APGYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVL 354
             GY    I+  L+ + +YI  ++   K+++K+T+E+++GK ++ L++ +N+H PD LV 
Sbjct: 355 CNGYTVGSIETILDHLIEYITFIIP-EKLAIKVTVEVMIGKTRQVLIEALNLHCPDLLVA 413

Query: 355 ATLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQREVN 405
           +T K++ N+ L+ ++SK+LT V    YP+P FVVP+KRM+   + L+  V+
Sbjct: 414 STTKYKENDGLLDHRSKRLTTVLANYYPLPVFVVPAKRMFLLGMQLESIVH 464

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 546 LIGNGSKNTKFRKSL------IPYSSSEEQNTTTTIKLSSSP-----TSQIKFATSVKHK 594
           +I  G K+T FRK        +P +   +Q+      LS+       T++IKF  +VK  
Sbjct: 613 IITGGEKHTGFRKKSMLDVLDLPSAKPRKQDPIPKPNLSAGDPTPRRTTRIKFEATVKDV 672

Query: 595 DGRAALGKARNLPDIRHSISFDKENSFDPSDKSSSVDNSIPLRKVKSA 642
           DG  A+ ++ +   +R      +  S   S+    V N+  LRKV+SA
Sbjct: 673 DGSTAVQQSPSDEVLREMSPLRQVQSLSQSNLMKYVSNN-SLRKVRSA 719

>KLLA0F02684g 242962..245301 some similarities with sgd|S0005545
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 779

 Score =  159 bits (401), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/409 (27%), Positives = 192/409 (46%), Gaps = 62/409 (15%)

Query: 46  PSVAFDTVPSTAGYSSIDDSREGFKGVPVPNYYTMEECYD-DETDSFSPNLQYYLRDTFQ 104
           P+V++DTVP       + +   G+   P    Y ++  YD D++     + +   R    
Sbjct: 56  PTVSWDTVP----IEGVSNEESGYDSDPHNLDYALDRFYDSDDSHDDIRHGRGSSRTHLG 111

Query: 105 SSPFLNTRKENKSESSSFPMR-------SSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTP 157
            +P L  R    S     PMR       + +L    S          NG+I RRDYPS P
Sbjct: 112 ITPTLTDRVRGSS-----PMRPRQNNDFTFQLDVGGSSNNPKIFFGPNGEIRRRDYPSRP 166

Query: 158 VIVNETLMINRFEKNWIKLWRQRKLQINERLNDK-KKWFTYPELIFSEERI----KPLYR 212
           V+ N  L+  ++ K+W   WRQR  ++ ER       +F +PE++F + ++     PL  
Sbjct: 167 VLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDLTDAPLV- 225

Query: 213 GDDSAPCTKEQ----KRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNL 268
            D+     KE+    KR  K+++  VG    P+TI+ HI+G++HTWVALDW + + A ++
Sbjct: 226 NDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDI 285

Query: 269 DHIVVITTLPKM-ISNRKKTA-------------------------------KDDTEWAP 296
           D+IV+I  +P+   S R  +                                + D  W  
Sbjct: 286 DYIVIIANIPRRDWSTRSGSYTRSRSASRSRSRSRSRMRSVSRTREFGTDDDQPDATWCD 345

Query: 297 GYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLA- 355
           G     ++  L  + +Y   ++   K+  KIT+EI++G   + L+D +N + PDF V+  
Sbjct: 346 GCTVGEVNDLLQRLIEYSTLIMGGKKL--KITVEIVIGSTSQILIDSLNAYAPDFFVIGS 403

Query: 356 TLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQREV 404
           ++    + +++ +KS+ L  V    +PIP F V ++RM  FE  LQR++
Sbjct: 404 SIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQRDI 452

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 577 LSSSPTSQIKFATSVKHKDGRAALGKARNL-PDIRHSISFDKENS 620
           L+++    IKFA SVK KDG+ A+ + ++  P  ++S  FD+E+S
Sbjct: 643 LANNGEGGIKFANSVKSKDGKGAIQRIKSYDPYSQNSDPFDREDS 687

>Kwal_14.1028
          Length = 680

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 84/179 (46%), Gaps = 36/179 (20%)

Query: 241 KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLPKMISNRKKTAKDDTEWAPGYQK 300
           +TI+C I+G+KHTW A+DW V   AR+ D++++ T +P    + K+T    T     Y  
Sbjct: 308 RTIICSISGRKHTWSAVDWYVKNLARDGDYLIIATRIPVFEESVKRTPAPQTHLTENYDP 367

Query: 301 E--------------------------VIDQKLNDIFDYILQLVKVVKISVKITLEIIV- 333
                                      +  QK NDI +Y L   K+    VK+T+EII  
Sbjct: 368 RNKNQSRSQERKSSITEQGLLVQDIDILARQKCNDILNYYLD--KLSHKCVKVTVEIIKD 425

Query: 334 GKIKKSLVDVINVHTPDFLVLATLKHERNENL-ITYKSK--KLTDVFPVSYPIPTFVVP 389
                +L   I ++ PD  +++T+    + NL I +K+   KL +     + +PT+VVP
Sbjct: 426 NSTVFALTSAIALYKPDLKIVSTV----STNLHIKFKNGHVKLPNFLMRHFWVPTYVVP 480

>KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089
           Saccharomyces cerevisiae YGR237c singleton, start by
           similarity
          Length = 766

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 45/190 (23%)

Query: 239 NPKTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLP---KMISNRKKTAKDDTEWA 295
           N +T+VC +NG++HTW  +DW + + AR+ DH+VV T LP   ++I+  KK    +T   
Sbjct: 326 NTRTVVCFLNGRRHTWATVDWFIKEAARDGDHLVVATNLPMYEELINMLKKNESSETGST 385

Query: 296 ------------------------PGYQKEVIDQKLNDIFDYILQ------LVKVVKISV 325
                                   P  Q  +I  +L+ +  Y  +        K     +
Sbjct: 386 KTKLEEFTFDGKIKNKTPSAVVQLPFRQVGMIINELDQLTRYKCENMLNYYAAKCQDKVM 445

Query: 326 KITLEIIVGKIKKSLV-DVINVHTPDFLVLATLKHE-----RNENLITYKSKKLTDVFPV 379
           KIT+E++     K LV  V++++ P+F V++T+        RN N+      KL +    
Sbjct: 446 KITIELVKELSAKPLVTHVMDLYRPNFHVVSTISTNLSIKFRNGNV------KLPNFLYR 499

Query: 380 SYPIPTFVVP 389
              +PT ++P
Sbjct: 500 HLWVPTVIIP 509

>YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein of
           unknown function, has weak similarity to uncharacterized
           C. albicans Orf6.794p [2358 bp, 785 aa]
          Length = 785

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 89/188 (47%), Gaps = 46/188 (24%)

Query: 241 KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLP--------------------KM 280
           + + C+I+G+++TW ++DW V    RN DH+V+ITT+P                    +M
Sbjct: 337 RVVSCYISGRRYTWSSVDWYVENLTRNGDHLVIITTIPEFEAKIDTLAYKEKRRHRLERM 396

Query: 281 ISNRKK--TAKDDTEWAP--------GYQKEVID----QKLNDIFDYILQ--LVKVVKIS 324
            SN  +  T    +   P        G + E I     Q  +DI +Y  +    K+V+IS
Sbjct: 397 TSNTSESMTTASHSLIGPDLSSPLSTGIRIEAIHNEAKQTCSDILNYYARRLATKIVRIS 456

Query: 325 VKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHERNENL-ITYKSKKLTDVFPV--SY 381
           +++  E      + +++   +++ P   V++T+    + N+ I +++ K+   F +   +
Sbjct: 457 IEMVKE---NSTRSAIISATSLYRPSLQVISTV----SANIQIKFRNGKVKLPFFLMKHF 509

Query: 382 PIPTFVVP 389
            +P FVVP
Sbjct: 510 AMPAFVVP 517

>CAGL0F07975g complement(782229..784541) similar to sp|P50089
           Saccharomyces cerevisiae YGR237c, start by similarity
          Length = 770

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 89/196 (45%), Gaps = 55/196 (28%)

Query: 241 KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLPKM------ISNRKK-------- 286
           +TI+C+I+G+++TW ++DW +   A + DH+V+++ +P+       + N++K        
Sbjct: 316 RTIMCYISGRRYTWSSVDWYIENVAADGDHLVIVSRVPEFEKELETLCNQEKRKSKLQQR 375

Query: 287 --------------------TAKDDTEWAP---GYQKEVIDQKLNDI----FDYILQLVK 319
                                + D     P   G++ E I  +  ++     DY    +K
Sbjct: 376 NSDRSDRISVYSESHTLSSTPSSDPDAVTPSTIGFRAEAIRDRAREVCRELLDYYAYRLK 435

Query: 320 VVKISVKITLEII-VGKIKKSLVDVINVHTPDFLVLATLKHE-----RNENLITYKSKKL 373
             KI+ KIT+EI+     K ++     V+ P+F +++T+        RN N+      KL
Sbjct: 436 -DKIT-KITVEIVKSDSTKDAITGAAGVYAPNFQIISTVSTNTQIKFRNGNV------KL 487

Query: 374 TDVFPVSYPIPTFVVP 389
                  YP+PTF++P
Sbjct: 488 PFFVLKHYPMPTFLIP 503

>ADL147W [1594] [Homologous to ScYGR237C - SH]
           complement(431887..433767) [1881 bp, 626 aa]
          Length = 626

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 78/172 (45%), Gaps = 35/172 (20%)

Query: 219 CTKEQKRKHKILQQKVGYPNN--PKTIVCHINGKKHTWVALDWTVYKFARNLDHIVV--- 273
           C+   +     + Q     N   P+T+ C+++G++H+W A+D  +  FAR+ DH+V+   
Sbjct: 222 CSNMHEEYSAYVSQTAAAANGAKPRTVACYLSGRRHSWSAVDAYINMFARSGDHLVIWAY 281

Query: 274 -------ITTLPKMISNRKKTAKD-----------DTEWAPGYQKE---------VIDQK 306
                  IT L    S R K++ D             E A  +++          +   K
Sbjct: 282 LPMYDREITNLSSKTSERPKSSLDMYQFATEKKTTKPETASDHERACMMVLELDNIAKAK 341

Query: 307 LNDIFDYILQLVKVVKISVKITLEIIVGK-IKKSLVDVINVHTPDFLVLATL 357
              + D+  +  +   + +K+T+E I  + ++ +  ++I+++ PD   ++T+
Sbjct: 342 CKSLLDFYTK--RCSHLIMKVTVEFIKHESMQGATANLISLYEPDMEFVSTI 391

>Scas_595.13
          Length = 766

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 29/40 (72%)

Query: 241 KTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTLPKM 280
           +T+ C+I+G++ TW  +DW +   A++ DH++++T +P+ 
Sbjct: 337 RTVSCYISGRRFTWATVDWYIENIAKDGDHVIIMTCIPEF 376

>AGL139W [4173] [Homologous to ScYDR176W (NGG1) - SH]
           complement(451466..453661) [2196 bp, 731 aa]
          Length = 731

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 232 QKVGYPNNPKTIVCHINGKKHTWVALDWTVY--KFARNLDHIVVITTLPKMISNRKKTAK 289
           +++  P    + +    G K   V+LD+T +  +  R L ++ +  +LPK      +   
Sbjct: 502 EEIKLPTQSTSSLPQQQGWKAQDVSLDYTSFEERLKRELKYVGIYMSLPK-----DENGT 556

Query: 290 DDTEWAPGYQKEVIDQKLNDIFDYILQLVK 319
           DD +W  G + + I  +L ++ + + Q+ K
Sbjct: 557 DDPDWLNGREDDEISVELRELQNVLRQVTK 586

>CAGL0H01331g complement(130263..132407) similar to tr|Q06629
           Saccharomyces cerevisiae YDR295c PLO2, hypothetical
           start
          Length = 714

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 11/58 (18%)

Query: 381 YPIPTFVVPSKRM-YSFELNLQREVN------EHYVSKNHMKHEHTDVESMSSSMFKK 431
           YPI    +P KRM Y  + N++   N      +HY+ +  ++ E T++   SS  FKK
Sbjct: 59  YPI----IPQKRMTYMLDANIRAIANHPSLLVDHYIPRQFLRMEPTEISITSSDKFKK 112

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,173,833
Number of extensions: 1049459
Number of successful extensions: 3338
Number of sequences better than 10.0: 41
Number of HSP's gapped: 3374
Number of HSP's successfully gapped: 60
Length of query: 717
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 608
Effective length of database: 12,822,747
Effective search space: 7796230176
Effective search space used: 7796230176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)