Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOL048C34233717130.0
Scas_643.21*3143065504e-68
CAGL0F00869g2872654859e-59
KLLA0D02112g3152763343e-36
ADL027W3363013181e-33
Kwal_26.71461431072612e-27
YAL018C3252592119e-19
Scas_548.5d3012711772e-14
ADR122C3752521783e-14
KLLA0F07601g3052861533e-11
CAGL0H06237g3023311481e-10
ACR283W2261301363e-09
YOL047C356911366e-09
Scas_643.20d357781199e-07
CAGL0F00891g2151081034e-05
AFR472C15281997e-05
Kwal_23.565419946981e-04
KLLA0F07535g13989790.024
YJR049C (UTR1)53025645.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL048C
         (337 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL048C (YOL048C) [4771] chr15 complement(240202..240945,241024....   664   0.0  
Scas_643.21*                                                          216   4e-68
CAGL0F00869g join(complement(94301..94456),complement(93453..941...   191   9e-59
KLLA0D02112g join(180975..181208,181302..182015) weakly similar ...   133   3e-36
ADL027W [1715] [Homologous to ScYAL018C - NSH] complement(652351...   127   1e-33
Kwal_26.7146                                                          105   2e-27
YAL018C (YAL018C) [50] chr1 complement(118567..119544) Nonessent...    86   9e-19
Scas_548.5d                                                            73   2e-14
ADR122C [1863] [Homologous to ScYAL018C - NSH] (922514..923641) ...    73   3e-14
KLLA0F07601g complement(717689..718606) weakly similar to sp|P31...    64   3e-11
CAGL0H06237g complement(613054..613962) similar to sp|P31379 Sac...    62   1e-10
ACR283W [1330] [Homologous to ScYAL018C - SH; ScYOL048C - SH] co...    57   3e-09
YOL047C (YOL047C) [4772] chr15 complement(241612..242439,242503....    57   6e-09
Scas_643.20d                                                           50   9e-07
CAGL0F00891g complement(94950..95597) weakly similar to tr|Q0821...    44   4e-05
AFR472C [3664] [Homologous to NOHBY] (1288484..1288942) [459 bp,...    43   7e-05
Kwal_23.5654                                                           42   1e-04
KLLA0F07535g 711142..711561 no similarity, hypothetical start          35   0.024
YJR049C (UTR1) [2943] chr10 complement(526798..528390) NAD kinas...    29   5.7  

>YOL048C (YOL048C) [4771] chr15
           complement(240202..240945,241024..241308) Protein of
           unknown function [1029 bp, 342 aa]
          Length = 342

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/337 (96%), Positives = 325/337 (96%)

Query: 1   MKAGIELISHSQASHATYANSMTLAEKGPQRLKRQFKEHSSSKESNVSRWLKIFIRQFDI 60
           MKAGIELISHSQASHATYANSMTLAEKGPQRLKRQFKEHSSSKESNVSRWLKIFIRQFDI
Sbjct: 1   MKAGIELISHSQASHATYANSMTLAEKGPQRLKRQFKEHSSSKESNVSRWLKIFIRQFDI 60

Query: 61  WFPETIPTMKVRYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALI 120
           WFPETIPTMKVRYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALI
Sbjct: 61  WFPETIPTMKVRYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALI 120

Query: 121 FVTIAGLFYVTLVPLLVTWAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITNQI 180
           FVTIAGLFYVTLVPLLVTWA            HIQWILQTNVLTAFVCRTLVLTHITNQI
Sbjct: 121 FVTIAGLFYVTLVPLLVTWAILLLGPLGVILVHIQWILQTNVLTAFVCRTLVLTHITNQI 180

Query: 181 FDISLVLQDQDEFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFK 240
           FDISLVLQDQDEFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFK
Sbjct: 181 FDISLVLQDQDEFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFK 240

Query: 241 VSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFI 300
           VSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFI
Sbjct: 241 VSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFI 300

Query: 301 CFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSLLKG 337
           CFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSLLKG
Sbjct: 301 CFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSLLKG 337

>Scas_643.21*
          Length = 314

 Score =  216 bits (550), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 172/306 (56%), Gaps = 31/306 (10%)

Query: 58  FDIWFPETIPTMKVRYELLRKNFIKEIFNSRAFIYPFL--------------------GF 97
           F++WFP   PT++ R   L KNF+ EI    +F+YPF                     G 
Sbjct: 1   FNLWFPTFKPTLEKRLNSLGKNFLHEIIFGGSFVYPFKVCFLDVIHSNIYPNRLTKVKGI 60

Query: 98  YEVLTNPVYWKHILLFAVCYALIFVTIAGLFYVTLVPLLVTWAXXXXXXXXXXXXHIQWI 157
            E+ TNP+YW+ I LF   Y +IF+ I  + Y  L+P L+ W+            H+QW+
Sbjct: 61  CEIFTNPIYWRFIFLFGGSYTVIFILILTIDYFILLPFLLAWSALILGPIGIGIAHVQWL 120

Query: 158 LQTNVLTAFVCRTLVLTHITNQIFDISLVLQDQDEFLNEVKVLPKPQKPHRKIDEPDAVR 217
           + +  +T++ C+ L+L  I +++FD++LV    + FLN  K L   +   R++ +     
Sbjct: 121 VISASITSWSCKKLLLPIIRDKVFDMALVANGGENFLNNAKFL---KSSDRRVQDVKVEE 177

Query: 218 NFNTIKGSRIFKIPRLLFRMFFKVSNFTS-------LTLLSLIPIVGPILANQLMAPKRT 270
           N    K S   ++ + +FR F  VSNF            +S++PI+GP + NQ+ AP+R 
Sbjct: 178 NTEYDKKSNNREL-KWVFREFCMVSNFVKKIFFFIMFVGISMVPIIGPAIVNQINAPRRG 236

Query: 271 FTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGLLELIPFFTIVTISSNTVGAAKW 330
           F+Y++R+F L GF K Q +DFQYEH+  F+CFG +AG+LE +PF  I+T+ SNTVGAAKW
Sbjct: 237 FSYMKRFFYLSGFDKVQTRDFQYEHFGLFLCFGTAAGILEFLPFSPIITMISNTVGAAKW 296

Query: 331 CTSLLK 336
             SLLK
Sbjct: 297 SISLLK 302

>CAGL0F00869g
           join(complement(94301..94456),complement(93453..94160))
           some similarities with tr|Q08219 Saccharomyces
           cerevisiae YOL048c or sp|P31379 Saccharomyces cerevisiae
           YAL018c
          Length = 287

 Score =  191 bits (485), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 153/265 (57%), Gaps = 12/265 (4%)

Query: 72  RYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALIFVTIAGLFYVT 131
           + +L+++ F K++F S  + YP  G + V+T P YWK + +FA  Y +IF  +AG +YVT
Sbjct: 29  KMDLIKQGFNKDLFLSSTYKYPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVT 88

Query: 132 LVPLLVTWAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITNQIFDISLVLQDQD 191
           ++P ++  A            HIQW++Q+N + A++CR L+L  +  ++FD++L    Q 
Sbjct: 89  IMPFILGGALLTMGPIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQ 148

Query: 192 EFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSNFTSLTLLS 251
           + +++ K L +     R+     ++ + +TI       I   L      +     L+L+S
Sbjct: 149 KLVSDAKYLSRKTTKSRR-----SIWSAHTI-------IYSFLSAKVTSLGQSIVLSLVS 196

Query: 252 LIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGLLEL 311
           LIP++GP++ NQ+ AP R  +YL RY  LK ++    K F+Y++     CFG+SAGL EL
Sbjct: 197 LIPVLGPLIVNQITAPDRALSYLSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFEL 256

Query: 312 IPFFTIVTISSNTVGAAKWCTSLLK 336
           IP  ++VTI SNTVGAA W   L+K
Sbjct: 257 IPLASMVTIMSNTVGAAIWSADLVK 281

>KLLA0D02112g join(180975..181208,181302..182015) weakly similar to
           sgd|S0005408 Saccharomyces cerevisiae YOL048c,
           hypothetical start
          Length = 315

 Score =  133 bits (334), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 132/276 (47%), Gaps = 16/276 (5%)

Query: 64  ETIPTMKVRYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALIFVT 123
           E   T+  R + +R NF  + F +++  YPFLG ++ L    YW + L+ +VCY ++F  
Sbjct: 47  ELYATVIWRVDSIRTNFFHDFFQTKSIWYPFLGVFQFLICYRYWYYGLVTSVCYLILFFA 106

Query: 124 IAGLFYVTLVPLLVTWAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITNQIFDI 183
           +  L+   L+P+L  W              +Q +LQ N  T    R  VL   TN IF++
Sbjct: 107 LLWLYAAFLLPILAGWQILLLGPVGLAIAVLQMLLQCNAWTLRGVRNFVLPKFTNDIFEL 166

Query: 184 SLVLQDQDEFLNEVKVLPKPQKPHRKIDEPDAVRN---FNTIKGSRIFKIPRLLFRMFFK 240
           +L+ + Q E LN +K    P  P   ++  +   +   FNT      F   R LF   F 
Sbjct: 167 TLLRKGQIETLNSLKRRQLPACPELHLNNIEFWIHDVPFNT------FSFLRWLFVFIF- 219

Query: 241 VSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFI 300
                 +TL+SL+PIVGP+ A  L  P R + Y   + + +  S K  +D  Y       
Sbjct: 220 ------ITLISLLPIVGPLAATILQTPDRAYGYYDVWMIRRRLSDKAKRDEYYSRLGQLW 273

Query: 301 CFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSLLK 336
            FG++AGLLELIP F+ + + SN +    W    +K
Sbjct: 274 AFGLTAGLLELIPGFSALLMISNVIAVGVWANDDIK 309

>ADL027W [1715] [Homologous to ScYAL018C - NSH]
           complement(652351..653361) [1011 bp, 336 aa]
          Length = 336

 Score =  127 bits (318), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 132/301 (43%), Gaps = 21/301 (6%)

Query: 33  KRQFKEHSSSKESNVSRWLKIFIRQFDIWFPETIPTMKVRYELLRKNFIKEIFNSRAFIY 92
           +R      +S   N   W +++       F E    +  R   LRKNF  +  N R ++Y
Sbjct: 6   QRSLSSQRTSISQNHGFWNELYNATVGSLF-ELSTVVTARAGALRKNFWDDFTNYRNYLY 64

Query: 93  PFLGFYEVLTNPVYWKHILLFAVCYALIFVTIAGLFYVTLVPLLVTWAXXXXXXXXXXXX 152
           P  GF E L  P YW   L+   CYAL+F+ +  L++  L+P+L  W             
Sbjct: 65  PIRGFCEFLKWPRYWGFGLIVGFCYALLFIMLTALYFTFLLPILSAWQVVLLGPIGMVIS 124

Query: 153 HIQWILQTNVLTAFVCRTLVLTHITNQIFDISLVLQDQDEFLNEVK-----VLPKPQKPH 207
            IQ +LQ N+ T    +  VL  I   +FD  L  +     LN +K     V+P  +K H
Sbjct: 125 IIQMVLQCNMWTVRGVKWFVLPVIKEDLFDTYLRRKGYGRLLNTLKQRSFPVVPTYRKNH 184

Query: 208 RKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSNFTSLTLLSLIPIVGPILANQLMAP 267
            +                 I++IP  +F     V+    +  LS++PI+GP  A  L++P
Sbjct: 185 LEF---------------WIYQIPLQVFLFVCSVTLTIFIIALSMVPIIGPTFATILLSP 229

Query: 268 KRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGLLELIPFFTIVTISSNTVGA 327
           +R+F Y   +      +++   D  YE     + FG+S G  EL P  +I+ I SN +  
Sbjct: 230 RRSFNYYNTWMNQLRMTRQMKCDSYYEKLGQHMAFGLSCGFFELFPVLSIIGICSNVIST 289

Query: 328 A 328
           A
Sbjct: 290 A 290

>Kwal_26.7146
          Length = 143

 Score =  105 bits (261), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 67/107 (62%)

Query: 230 IPRLLFRMFFKVSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAK 289
           +P  +  + F ++    L++LSLIPIVGP + NQL +PKR F+Y  RY+ LK     Q K
Sbjct: 33  LPSKIVSLKFSITTSVLLSVLSLIPIVGPTIVNQLKSPKRGFSYGSRYYTLKNLGGAQLK 92

Query: 290 DFQYEHYASFICFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSLLK 336
           D  YEH   +  FGM AGLLELIP  +I+TI SN +  A W ++ LK
Sbjct: 93  DKFYEHLGEYTGFGMMAGLLELIPVMSIITIPSNIIAGALWASNELK 139

>YAL018C (YAL018C) [50] chr1 complement(118567..119544) Nonessential
           protein of unknown molecular function, putative
           component of the spore wall [978 bp, 325 aa]
          Length = 325

 Score = 85.9 bits (211), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 118/259 (45%), Gaps = 21/259 (8%)

Query: 70  KVRYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVC-YALIFVTIAGLF 128
           + RY L+  NF K+ F   AF+YPF GF E  TN   +   +L  +  Y ++F  ++ ++
Sbjct: 53  RTRYVLM--NFFKDAFTGGAFMYPFKGFLEFNTNKSSYSTTMLGILSSYLIMFALVSFVY 110

Query: 129 YVTLVPLLVTWAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITNQIFDISLVLQ 188
           + T+ P+   +                  LQ NV T    R   L+H  N + ++ L   
Sbjct: 111 WATITPMYTAFLIVLGPIGLFIAI-FHSFLQANVFTLLFMR---LSHFNNHLVEVCLEKN 166

Query: 189 DQDEFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSNFTSLT 248
             +E L+EVK    P K +  I         N+I     +  P  L +    +S    L 
Sbjct: 167 GLEENLSEVK----PIKYYAPI---------NSIY-FWAYYFPFKLVKYMLGLSVLFVLL 212

Query: 249 LLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGL 308
           ++S  P++GPIL + L++P  T  Y  +   L+ F   Q ++  Y H   +  FG  AGL
Sbjct: 213 VISFFPLIGPILFHILISPFITQIYFTKVLRLQNFDNIQRRENIYLHAGQYASFGFLAGL 272

Query: 309 LELIPFFTIVTISSNTVGA 327
           +E +P      IS+NT+G+
Sbjct: 273 IESVPILAGFAISTNTIGS 291

>Scas_548.5d
          Length = 301

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 119/271 (43%), Gaps = 38/271 (14%)

Query: 72  RYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPV-YWKHILLFAVCYALIFVTIAGLFYV 130
           R  L+  +F+ + F+ + + YPF GF E+  N   Y   I    + Y L F T+ G+++V
Sbjct: 53  RISLMTSSFLSDFFSIKPYYYPFKGFKEMQLNVAGYMPTITRLYLLYCLSFATVFGIYWV 112

Query: 131 TLVPLLVTWAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITNQIFDISL----V 186
           T+ P+  +               +  +L  N+LT    R   ++H  NQ+  + +    +
Sbjct: 113 TITPVYFS-ILLVFGPFGFILTGLHSLLHANLLTMLFLR---MSHFNNQLTIVCMKTYGL 168

Query: 187 LQDQDEFLNEVKVLPKPQK---PHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSN 243
             D+D          +P K   P   +        + T+K    F +  +L         
Sbjct: 169 TVDKDA---------RPTKHFVPLNSLYFWTYYLPYKTMKYGIGFIVLSILLS------- 212

Query: 244 FTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFG 303
                 +S +PI GPI+ + ++AP  +  Y  + F L+GF  ++ ++  +  +  +  FG
Sbjct: 213 ------ISFLPIFGPIIFSVIIAPFVSKIYFSKMFRLRGFDDRRREEIFFNRFGLYASFG 266

Query: 304 MSAGLLELIPFFTIVTISSNTVGAAKWCTSL 334
           + A L E IP F+ + IS NT+G    CT L
Sbjct: 267 IVASLTETIPIFSALFISFNTIG----CTLL 293

>ADR122C [1863] [Homologous to ScYAL018C - NSH] (922514..923641)
           [1128 bp, 375 aa]
          Length = 375

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 107/252 (42%), Gaps = 17/252 (6%)

Query: 79  NFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLFAVCYALIFVTIAGLFYVTLVPLLVT 138
           N   + F  +A+ YP        T   Y+   +   V Y+ I+V I  ++++T+ P+ + 
Sbjct: 59  NATPDFFRDQAYRYPVRALIRSCTTRRYFVVNISIFVFYSAIYVVITVIYFLTIFPVYLG 118

Query: 139 WAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITNQIFDISLVLQDQDEFLNEVK 198
            +             +  +L TN L   V R   ++ ++      +L +    E L    
Sbjct: 119 LSVILGPAGIVMA-WLHMLLHTNNLAMMVLR---MSQVSRYTLKNALKVNGNIELLENP- 173

Query: 199 VLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSNFTSLTLLSLIPIVGP 258
             P P K    +D P    N            P  +            L L+S IP+ GP
Sbjct: 174 --PVPVKLFYPLDTPYFWMN----------HFPWKMLEYMGGAFTMVVLLLVSAIPVFGP 221

Query: 259 ILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGLLELIPFFTIV 318
           +  N L++P  T  YL +Y  L+GF+  Q ++  Y+++  ++ FG+ A  LE+ PF + +
Sbjct: 222 VFFNILISPFVTRLYLAKYLRLRGFNNIQREERFYDNFGQYVAFGLVATCLEIPPFLSGI 281

Query: 319 TISSNTVGAAKW 330
           T ++N +  A W
Sbjct: 282 TYATNNIAVALW 293

>KLLA0F07601g complement(717689..718606) weakly similar to sp|P31379
           Saccharomyces cerevisiae YAL018c singleton, start by
           similarity
          Length = 305

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 123/286 (43%), Gaps = 26/286 (9%)

Query: 55  IRQFDIWFPET-IPTMKVRYELLRKNFIKEIFNSRAFIYPFLGFYEVLTNPVYWKHILLF 113
           ++ + + F +T I  +K R++    + +  +     ++YP + ++E+L+ P YWK  +  
Sbjct: 35  VQDYTVRFAKTKIKILKRRFKDAVASLVPGLSTPGIYLYPLVSYWELLSTPEYWKSSVPI 94

Query: 114 AVCYALIFVTIAGLFYVTLVPLLVTWAXXXXXXXXXXXXHIQWI---LQTNVLTAFVCRT 170
            V Y L++  +  ++ +T++P+    +             + WI   L TN+LT    R 
Sbjct: 95  MVVYLLLYALVTFVYLLTILPVYTPLSVFLGPIGLI----VAWIHMFLHTNMLTMMTIR- 149

Query: 171 LVLTHITNQIFDISLVLQDQDEFLNEVKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIF-- 228
             ++ + +      + ++  D     V ++          D+P  ++ +  +  +  F  
Sbjct: 150 --MSQMNSFTMYQGMAIRSMD-----VNIIDAGN------DQP--IKYYYPLASTYFFFN 194

Query: 229 KIPRLLFRMFFKVSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQA 288
            +P  L   F        L L+S IPI+GP + + L++P  T  Y   Y         Q 
Sbjct: 195 HLPWKLTEYFAGFVVLCGLLLISSIPILGPFIFHTLISPFITRLYWAPYLRYLKVDNLQR 254

Query: 289 KDFQYEHYASFICFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSL 334
           +   Y+    +I FG+ AG LE  P  + +  S++ +   +W   L
Sbjct: 255 ETRFYKMMGQYIAFGLVAGQLESWPIVSALAYSAHAIAICQWAQDL 300

>CAGL0H06237g complement(613054..613962) similar to sp|P31379
           Saccharomyces cerevisiae YAL018c, start by similarity
          Length = 302

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/331 (20%), Positives = 132/331 (39%), Gaps = 62/331 (18%)

Query: 17  TYANSMTLAEKGPQRLK----RQFKEHSSSKESNVSRWLKIFIRQFDIWFPETIPTMKVR 72
           ++A S+ L   G    K    + FK    ++++ +     I+ RQ        +  +  R
Sbjct: 2   SFAGSLILTGLGGVYYKFSRDQHFKPLEIAQKATIQDATSIYQRQ--------LVKLATR 53

Query: 73  YELLRKNFIKEIFNSRAFIYPFLGFYEVLTN---------PVYWKHILLFAVCYALIFVT 123
              +      ++F    F+YPF G YE+ +N          ++  +++ +A+   + + T
Sbjct: 54  SAQVSAVIADDLFTGNMFVYPFKGMYELYSNFRDYAASTTALFSLYLVSYAIVTMVYWAT 113

Query: 124 IAGLF---YVTLVP--LLVTWAXXXXXXXXXXXXHIQWILQTNVLTAFVCRTLVLTHITN 178
           I  ++   ++ L P  +L+ W              I  IL TN+LT    R   ++H+  
Sbjct: 114 ITPVYTALFIVLGPFGILIAW--------------IHSILHTNMLTMMFLR---VSHLNE 156

Query: 179 QIFDISLVLQDQDEFLNE--VKVLPKPQKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFR 236
            +    +             +K    P  P+                    F + + L  
Sbjct: 157 GLVKNCVDANGYQSLFRHTPIKYQVSPSTPYF-----------------WYFHLTKKLSE 199

Query: 237 MFFKVSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHY 296
               +     L ++S IPIVGP   + L++P  +  Y  +   LKG S  +  +  Y+H 
Sbjct: 200 YLTGLIILVFLLIISSIPIVGPFTFHFLVSPALSRVYFSKMLRLKGLSNIERYERIYQHP 259

Query: 297 ASFICFGMSAGLLELIPFFTIVTISSNTVGA 327
             +  FG++AG L+  PF   +++S+N +GA
Sbjct: 260 GQYTMFGITAGFLDSFPFLAGISLSTNILGA 290

>ACR283W [1330] [Homologous to ScYAL018C - SH; ScYOL048C - SH]
           complement(870395..871075) [681 bp, 226 aa]
          Length = 226

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 63/130 (48%), Gaps = 13/130 (10%)

Query: 204 QKPHRKIDEPDAVRNFNTIKGSRIFKIPRLLFRMFFKVSNFTSLTLLSLIPIVGPILANQ 263
           ++ + ++ EP+A   ++ +   R+             V +   + +L  IPI+GP+L   
Sbjct: 95  KRHNPELVEPEAFSAYDVLTVLRL-------------VMSVAVMVVLVTIPILGPVLLMF 141

Query: 264 LMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAGLLELIPFFTIVTISSN 323
           +M  K ++ + +R+ +L+G ++ Q +D  Y+H   F  FG S  +L  +P F++      
Sbjct: 142 VMNVKFSYDFYERFLILRGLNQVQRRDVFYQHILQFAYFGGSYTVLNFVPLFSVWGFVCY 201

Query: 324 TVGAAKWCTS 333
            +    W TS
Sbjct: 202 PLAIKMWATS 211

>YOL047C (YOL047C) [4772] chr15
           complement(241612..242439,242503..242745) Protein of
           unknown function [1071 bp, 356 aa]
          Length = 356

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%), Gaps = 4/91 (4%)

Query: 249 LLSLIPIVGPILANQL-MAPKRTFTYLQRYFL--LKGFSKKQAKDFQYEHYASFICFGMS 305
           LL L+PIVGPI  N L  +P   F Y + YF+  L   S+K +K + Y+ +A ++ + +S
Sbjct: 230 LLLLVPIVGPITINMLPFSPGMGFYYFEPYFVDVLHLDSRKLSKVY-YKGFAKWLLYSIS 288

Query: 306 AGLLELIPFFTIVTISSNTVGAAKWCTSLLK 336
           +GLLE IP    + I +N VGA+ W    +K
Sbjct: 289 SGLLESIPILGGLFIGTNAVGASLWIVKEIK 319

>Scas_643.20d
          Length = 357

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 250 LSLIPIVGPILANQLMAPKRTFTYLQRYFL-LKGFSKKQAKDFQYEHYASFICFGMSAGL 308
           + LIP VG  L   L A +  F+Y   YF  L+  +  + +   Y HY  +  FG+S  +
Sbjct: 265 IMLIPFVGIFLFMGLTAARHGFSYSFPYFWELRKVNSNERRKIFYGHYGKWFWFGVSCYI 324

Query: 309 LELIPFFTIVTISSNTVG 326
            E IP F+ ++I+SN+VG
Sbjct: 325 CEFIPIFSTLSITSNSVG 342

>CAGL0F00891g complement(94950..95597) weakly similar to tr|Q08218
           Saccharomyces cerevisiae YOL047c or sp|P31379
           Saccharomyces cerevisiae YAL018c, hypothetical start
          Length = 215

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 51/108 (47%), Gaps = 1/108 (0%)

Query: 230 IPRLLFRMFFKVSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFL-LKGFSKKQA 288
           +P  L     ++ ++  +     IP  G  +   + A +  F Y Q YF  L+   +K+ 
Sbjct: 89  LPNFLIDRSIEILDYIFIVACFFIPFFGITIVQLIFAGQNGFAYFQPYFKELRKMDEKEL 148

Query: 289 KDFQYEHYASFICFGMSAGLLELIPFFTIVTISSNTVGAAKWCTSLLK 336
           +   Y++Y+ +  +G++  ++E +PF +     S  VGA+ W    LK
Sbjct: 149 RKVYYQNYSKWYLYGVACAVIESLPFLSGYLQPSLFVGASLWSARELK 196

>AFR472C [3664] [Homologous to NOHBY] (1288484..1288942) [459 bp,
           152 aa]
          Length = 152

 Score = 42.7 bits (99), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 9/81 (11%)

Query: 248 TLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYASFICFGMSAG 307
            LLSL+PIVG      L AP   + Y        GF         YE YA ++  G+   
Sbjct: 74  CLLSLVPIVGLFAVAALEAPSTGWEYCDALRPGIGF---------YEDYARYLLLGLGCT 124

Query: 308 LLELIPFFTIVTISSNTVGAA 328
            L++IP  + +T ++NT+   
Sbjct: 125 ALDMIPVLSGLTFTTNTIACG 145

>Kwal_23.5654
          Length = 199

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 285 KKQAKDFQYEHYASFICFGMSAGLLELIPFFTIVTISSNTVGAAKW 330
           +++  DF Y +   ++ FG+++G LEL+P  + +TI+SN +G A W
Sbjct: 145 QRRGDDF-YSNIGKYMAFGITSGFLELLPVISGLTIASNYLGRATW 189

>KLLA0F07535g 711142..711561 no similarity, hypothetical start
          Length = 139

 Score = 35.0 bits (79), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 239 FKVSNFTSLTLLSLIPIVGPILANQLMAPKRTFTYLQRYFLLKGFSKKQAKDFQYEHYAS 298
           F +S+F    +LS+   V P++   LM P   + YL   +L      +   D   ++  S
Sbjct: 44  FVLSSFKFFLILSVS--VFPLVPQLLMIPSIGWQYLNAIYL----PNELPDDIYRKNTFS 97

Query: 299 FICFGMSAGLLELIPFFTIVTISSNTVGA 327
           +I FG  A  LE +PF + +  +SN +G 
Sbjct: 98  YIGFGFVAAFLEAVPFVSGLAFTSNYLGG 126

>YJR049C (UTR1) [2943] chr10 complement(526798..528390) NAD kinase,
           phosphorylates NAD [1593 bp, 530 aa]
          Length = 530

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 38  EHSSSKESNVSRWLKIFIRQFDIWF 62
           E S  +ES +  W K FIR+ D++F
Sbjct: 180 EDSKCRESRIKYWTKDFIREHDVFF 204

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.140    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,104,935
Number of extensions: 410487
Number of successful extensions: 1566
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1574
Number of HSP's successfully gapped: 26
Length of query: 337
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 235
Effective length of database: 13,065,073
Effective search space: 3070292155
Effective search space used: 3070292155
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)