Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOL013C (HRD1)55154225030.0
CAGL0E02299g54542710111e-131
Scas_644.65104339321e-120
Kwal_56.225225134138311e-105
KLLA0C05874g5534615951e-69
Scas_248.12602184943e-58
ACL019C5754084875e-54
AFR275W753691282e-07
KLLA0F25674g757651166e-06
Scas_625.4761571167e-06
Kwal_26.8099750571167e-06
Sklu_2102.1751571158e-06
YKL034W (TUL1)758571141e-05
KLLA0E03960g704331112e-05
CAGL0L01947g757751094e-05
Scas_713.45570321078e-05
Kwal_27.1054610437961e-04
AGR034W15983982e-04
CAGL0E01441g717291014e-04
Sklu_1676.310196924e-04
Kwal_56.2390058978997e-04
CAGL0M08690g32852977e-04
YDR143C (SAN1)61037940.002
YBR062C11527870.002
Kwal_55.1999915257880.003
KLLA0E16720g30557910.004
CAGL0K02563g58630920.005
Scas_705.4142858900.007
AER390W31652890.007
YDR265W (PEX10)33729890.008
CAGL0I04576g14988850.010
CAGL0B05049g147073890.011
Sklu_2317.249337880.014
ABR104W32841870.014
Scas_625.1127439840.024
Scas_615.1333056850.027
Scas_560.6*11834790.030
Kwal_55.2120627566830.034
CAGL0K08052g30556830.043
KLLA0F18458g14055780.059
YHL010C58526810.086
Sklu_2432.9147527810.10
KLLA0F12166g152868800.13
Scas_573.9150227800.13
CAGL0H10274g11424740.16
KLLA0C15697g30455780.16
YLR247C155668790.17
YPR093C28827770.24
Kwal_26.803066030770.25
Sklu_2416.811026720.25
KLLA0F25740g51725770.27
Kwal_56.2311213527730.29
CAGL0B02013g112033770.31
Kwal_55.2205411126710.31
CAGL0L06336g60055760.34
Kwal_26.809052026760.35
CAGL0J04796g59993760.37
KLLA0E18601g65030750.44
KLLA0E07139g11063700.49
Kwal_14.1287151827750.50
YOL138C134125750.54
ADL181W10855690.58
KLLA0E17787g16227710.59
YOL133W (HRT1)12126700.64
Scas_585.5*10926690.65
AAL030C153923740.67
Sklu_1785.333136701.4
Sklu_2337.232241701.6
Kwal_27.1041930031691.8
KLLA0C08756g42724701.8
CAGL0J03586g41151692.1
Scas_665.139238682.7
Kwal_56.2354396558683.2
YDR128W114833683.4
YOL054W40660665.4
Kwal_23.628545830665.9
AGL191W58228656.8
Scas_392.2376118657.4
CAGL0I09988g38764649.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL013C
         (542 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...   968   0.0  
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...   394   e-131
Scas_644.6                                                            363   e-120
Kwal_56.22522                                                         324   e-105
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...   233   1e-69
Scas_248.1                                                            194   3e-58
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...   192   5e-54
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    54   2e-07
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    49   6e-06
Scas_625.4                                                             49   7e-06
Kwal_26.8099                                                           49   7e-06
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          49   8e-06
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    49   1e-05
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    47   2e-05
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    47   4e-05
Scas_713.45                                                            46   8e-05
Kwal_27.10546                                                          42   1e-04
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    42   2e-04
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    44   4e-04
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         40   4e-04
Kwal_56.23900                                                          43   7e-04
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    42   7e-04
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    41   0.002
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    38   0.002
Kwal_55.19999                                                          39   0.003
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    40   0.004
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    40   0.005
Scas_705.41                                                            39   0.007
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    39   0.007
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    39   0.008
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    37   0.010
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    39   0.011
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            39   0.014
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    38   0.014
Scas_625.11                                                            37   0.024
Scas_615.13                                                            37   0.027
Scas_560.6*                                                            35   0.030
Kwal_55.21206                                                          37   0.034
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    37   0.043
KLLA0F18458g complement(1697871..1698293) some similarities with...    35   0.059
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    36   0.086
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              36   0.10 
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    35   0.13 
Scas_573.9                                                             35   0.13 
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    33   0.16 
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    35   0.16 
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    35   0.17 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    34   0.24 
Kwal_26.8030                                                           34   0.25 
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          32   0.25 
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    34   0.27 
Kwal_56.23112                                                          33   0.29 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    34   0.31 
Kwal_55.22054                                                          32   0.31 
CAGL0L06336g 713059..714861 some similarities with sp|P32917 Sac...    34   0.34 
Kwal_26.8090                                                           34   0.35 
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    34   0.37 
KLLA0E18601g complement(1645113..1647065) some similarities with...    33   0.44 
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    32   0.49 
Kwal_14.1287                                                           33   0.50 
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    33   0.54 
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    31   0.58 
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    32   0.59 
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    32   0.64 
Scas_585.5*                                                            31   0.65 
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    33   0.67 
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         32   1.4  
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         32   1.6  
Kwal_27.10419                                                          31   1.8  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    32   1.8  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    31   2.1  
Scas_665.1                                                             31   2.7  
Kwal_56.23543                                                          31   3.2  
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    31   3.4  
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    30   5.4  
Kwal_23.6285                                                           30   5.9  
AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH] complement(...    30   6.8  
Scas_392.2                                                             30   7.4  
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    29   9.5  

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/542 (90%), Positives = 488/542 (90%)

Query: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFI     
Sbjct: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120
                     FGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI 180
           FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI 180

Query: 181 ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE 240
           ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE
Sbjct: 181 ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE 240

Query: 241 SDQSQPVLNXXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL 300
           SDQSQPVLN         RQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL
Sbjct: 241 SDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL 300

Query: 301 KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP 360
           KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP
Sbjct: 301 KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP 360

Query: 361 NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQXXXXXXXX 420
           NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQ        
Sbjct: 361 NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSD 420

Query: 421 XXXXXXXXXXXGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMXXXXXXXXXXX 480
                      GIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAM           
Sbjct: 421 ITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPT 480

Query: 481 WYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK 540
           WYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK
Sbjct: 481 WYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK 540

Query: 541 IV 542
           IV
Sbjct: 541 IV 542

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score =  394 bits (1011), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 207/427 (48%), Positives = 283/427 (66%), Gaps = 32/427 (7%)

Query: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           M+    +++  IF  +TY+LT YCV SA ++SVSFLQ+ LKL+EGFN++++++F      
Sbjct: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120
                     FGELR+IEHEHIFERLPF +INT+FM S F+E+YFFT+A   L+LLY+KV
Sbjct: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120

Query: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCI-------SSIY 173
           FHWIL+DRL+ LLQ IN+ T  K L+ +R+  NL+LL V+D  +I+ C+       SSI+
Sbjct: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF 180

Query: 174 TNQKSDI---------ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNE 224
           T   + I         +   +Y++Q MEFT L+IDL+NL L T L F+EF+ S++   ++
Sbjct: 181 TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRK--FSQ 238

Query: 225 NNHIVHGDPTDENTVESDQSQPVLNXXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTA 284
           NN   +    ++   ES+                 QF GLEGKFMYEK IDV TRFL+T 
Sbjct: 239 NNPTFNSISAEDADTESEDGD-------------SQFNGLEGKFMYEKLIDVVTRFLQTL 285

Query: 285 LHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSAN 344
           +H+ M +   +P+ML+KD+  D+  LY +  SL  IW+N+KQLD  L T+T + L N  N
Sbjct: 286 VHVVMAMVLNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPN 345

Query: 345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVF 404
            DN+CI+CMDEL+ S N    ++  KKPK+LPCGH+LHLSCLKNWMERSQTCPICRLPVF
Sbjct: 346 FDNVCIVCMDELV-SENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVF 404

Query: 405 DEKGNVV 411
           DE G ++
Sbjct: 405 DENGEIL 411

>Scas_644.6
          Length = 510

 Score =  363 bits (932), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 272/433 (62%), Gaps = 53/433 (12%)

Query: 4   ENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXX 63
           + RR QL  F  + Y+LT  C+ ++   S SFL ++LKLN+GFN+M+++IFI        
Sbjct: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLW 62

Query: 64  XXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHW 123
                  F ELRLIE EHI ERLPFTIIN +F+S++F+E++F T+AF+G +LLY+K+F+W
Sbjct: 63  KFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122

Query: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCI-------SSIYTNQ 176
           ILKDRLE L+QS N + ++   IFS+F  NL++L+ ++ Q+I  CI         +Y N 
Sbjct: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181

Query: 177 KSDIES-------------------TSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRS 217
            S ++S                     +YL+  MEF +LLI+ +NLFL + L+ +E Y+ 
Sbjct: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK- 240

Query: 218 QQSLSNENNHIVHGDPTDENTVESDQSQPVLNXXXXXXXXXRQFTGLEGKFMYEKAIDVF 277
               SN+ + +       E+  + D   P              F GLE KF+YEK ID+F
Sbjct: 241 ----SNQYDQLNAIIEDIEDENDDDDDTPA------------DFNGLENKFIYEKIIDLF 284

Query: 278 TRFLKTALHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVE 337
           TR L T +H+S+ +P  +PM++LKD++WD+++LYQ+   L++I +NNK LD  L  +  E
Sbjct: 285 TRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPE 344

Query: 338 QLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCP 397
            LQ+S   DN+CI+CMD+L+        ++K KK KRLPCGH LHLSCLKNWMERSQTCP
Sbjct: 345 DLQDS---DNVCIVCMDDLLSE------EHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395

Query: 398 ICRLPVFDEKGNV 410
           ICRLPVFDE GNV
Sbjct: 396 ICRLPVFDESGNV 408

>Kwal_56.22522
          Length = 513

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 163/413 (39%), Positives = 247/413 (59%), Gaps = 40/413 (9%)

Query: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXX 60
           M    +R+Q A +V  +Y    + +    + S+SFL+++ +L EG NL++L  F      
Sbjct: 1   MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGV 60

Query: 61  XXXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120
                     FGELRL+E+EHIFERL FTI+N  FMSS F E  F +V  F   L+++KV
Sbjct: 61  LLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKV 120

Query: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI 180
           FHW+L+DRLE + Q  ++ T    L+ SRF FN+ LL  +D+Q+   CI       +S  
Sbjct: 121 FHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF 180

Query: 181 ESTSL--YLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENT 238
            S+SL  +L+  +EF MLL+D+  + +++ +N  E Y+ ++S + +              
Sbjct: 181 YSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKRSFARDGE------------ 228

Query: 239 VESDQSQPVLNXXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMM 298
                                 +TGLEGKFMYEK + +  +  +  LH+ +++PF MP+M
Sbjct: 229 ---------------------DYTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPFSMPLM 267

Query: 299 LLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIH 358
           + KD++WD  A++ +  SL   W++N+Q+D+ L  V+  QL  +A+DD +CI+CMD+++ 
Sbjct: 268 IAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQL--AASDDKMCIVCMDDML- 324

Query: 359 SPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 411
           +P++ T  N  +KPKRLPC H LHL CLK+WMERSQTCPICR+PVFD+KGNVV
Sbjct: 325 APSECT--NAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVV 375

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score =  233 bits (595), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 233/461 (50%), Gaps = 26/461 (5%)

Query: 13  FVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXXXXXXXFG 72
           + +++Y    + ++    TS S+L    K+ EG + M+                    FG
Sbjct: 29  YSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIHMLFG 88

Query: 73  ELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHWILKDRLEAL 132
           +LRLIE+EHI ER+ +T+I TL +S          +    +L +  +  HWILKDR+E  
Sbjct: 89  QLRLIEYEHILERISYTVI-TLLLSCSSMNGLISVMQIHCVLFVCCRTLHWILKDRMEVT 147

Query: 133 LQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIEST-SLYLIQVM 191
            Q+ +   T+K ++ SRF FNL++L  VD  I+   ++ I    KS+I+ T +L++I   
Sbjct: 148 FQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKIL--YKSNIDVTYTLFIIS-- 203

Query: 192 EFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQSQPVLNXX 251
           ++ +L  DLL + L+T LN +E    Q       N   H D      V + + +P     
Sbjct: 204 QYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVD----EPVINHEERPNAVAI 259

Query: 252 XXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDILALY 311
                   +  GLEGKF+YEK IDVF   +K  +  +    F    +++  V+W+ +  +
Sbjct: 260 EEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFAS--SFSTGRVMMVTVLWEAITTF 317

Query: 312 QSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKK 371
           +S   LWK W+++K LD +L+  T  Q+++   D  ICI+CM++ +  P+ Q  K+  KK
Sbjct: 318 KSARGLWKNWKSSKSLDASLMDATDIQIESGEID--ICIVCMEDFL--PSHQR-KSDGKK 372

Query: 372 PKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQXXXXXXXXXXXXXXXXXXX 431
            K LPC H LHLSCLKNW+ RS TCPICRLP+FDE GNV+                    
Sbjct: 373 VKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVMPYQDHSQSTDPNTTAQEISP 432

Query: 432 GIATDQQGFAN---------EVDLLPTRTTSPDIRIVPTQN 463
           GIA +     N          + L P  +T+ ++  +PT+N
Sbjct: 433 GIAVETNSQTNINTLETTNQNITLSPDNSTAQNLAFLPTRN 473

>Scas_248.1
          Length = 260

 Score =  194 bits (494), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 147/218 (67%), Gaps = 2/218 (0%)

Query: 2   VPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXX 61
           V +NRR Q  ++ V TY    + VY +  +SV+FLQ T+KL EG NL++L  F       
Sbjct: 37  VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 96

Query: 62  XXXXXXXXXFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVF 121
                    FGELRLIE+EH+FERL FTI+N++F+SS+F E+ F TV  F  +L++LKVF
Sbjct: 97  LWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 156

Query: 122 HWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIE 181
           HWILKDRLE + Q+ N++T +K ++FSRF+FNL+ LA VDYQ++  C+S+  +N +    
Sbjct: 157 HWILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQ--WT 214

Query: 182 STSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQ 219
           S+S+YL+  ++F MLL+D L++ L   +NF E YR Q 
Sbjct: 215 SSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQS 252

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score =  192 bits (487), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 210/408 (51%), Gaps = 50/408 (12%)

Query: 11  AIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFIXXXXXXXXXXXXXXX 70
           A+F+  TY L  +  YS   +    L      + G + ++   F+               
Sbjct: 11  AMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVL 70

Query: 71  FGELRLIEHEHIFERLPFTIINTLFMSSLFHERYF---FTVAFFGLLLLYLKVFHWILKD 127
           FG+L  IE++HIFERL   ++    +     + Y     T+ F+ L L    V HW+L+D
Sbjct: 71  FGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRD 126

Query: 128 RLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIESTSLYL 187
           R++ + Q     +++  ++ SRF F+L++L +VDY+++  C+     N   D +   LYL
Sbjct: 127 RMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQ----NTNVDGKRHELYL 182

Query: 188 IQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQSQPV 247
           +  + F  L++D+L++ L T LN +E  RS+++ S   N +  G  TD++  +       
Sbjct: 183 MLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSA--NLVYEGGTTDDDADD------- 233

Query: 248 LNXXXXXXXXXRQFTGLEGKFMYEKAIDVFTRFLKTALHL--SMLIPFRMPMMLLKDVVW 305
                       +   LEGK++YE   D+    LK  L +   + +P+ +       VV+
Sbjct: 234 ------------EVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSIT------VVY 275

Query: 306 DILAL-YQSGTS---LWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPN 361
            I     ++G S   ++  W+NNK+L + L  V+ EQL ++   D++CIICMD+++  P 
Sbjct: 276 SIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDT---DSMCIICMDDML--PT 330

Query: 362 QQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGN 409
            +T K  N++ K LPCGH+LH  CLK+WMERSQTCPICRL VF    N
Sbjct: 331 TETTK-MNRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 339 LQNSANDDNI--CIICMDEL-IHSPN-QQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQ 394
           L++ AND+    C ICM EL IH  +  +T K         PC H+ H  CL+NWM    
Sbjct: 682 LEHGANDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKL 741

Query: 395 TCPICRLPV 403
            CP+CR P+
Sbjct: 742 QCPVCRAPL 750

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 341 NSANDDNICIICM-DELIH-SPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPI 398
            S N+  +C ICM D  ++    ++T K   +     PC HI H  CL+NWM     CP+
Sbjct: 690 GSQNNCFVCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPV 749

Query: 399 CRLPV 403
           CR P+
Sbjct: 750 CRAPL 754

>Scas_625.4
          Length = 761

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 349 CIICMDEL-IHSPNQQTWKNKNKKPKRL-PCGHILHLSCLKNWMERSQTCPICRLPV 403
           C ICM E+ ++    +   N ++    + PC HI H  CL+NWM     CP+CR P+
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>Kwal_26.8099
          Length = 750

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 349 CIICMDELIHSPNQQTWKNKNKKPKRL--PCGHILHLSCLKNWMERSQTCPICRLPV 403
           C ICM E+    +     +K  K   +  PC HI H  CL++WM     CP+CR P+
Sbjct: 691 CAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 349 CIICMDE--LIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPV 403
           C ICM +  +  S  ++T K         PCGHI H  CL++WM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 349 CIICMDELIHSPNQ--QTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPV 403
           C ICM ++     +  +T K         PC H+ H SCL+NWM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 375 LPCGHILHLSCLKNWMERSQTCPICRLPVFDEK 407
           LPCGH+    CL  W     +CPICR P+  E+
Sbjct: 217 LPCGHVFGRECLYKWTTEHNSCPICRAPILSEE 249

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 334 VTVEQLQNSANDDN---ICIICMDELIHSPNQQTWKNKNKKPKRL--PCGHILHLSCLKN 388
           V+++ L      +N    C ICM E      +    ++  K   +  PC H+ H SCL++
Sbjct: 680 VSLQHLMEHGGSENHTVDCAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLES 739

Query: 389 WMERSQTCPICRLPV 403
           WM     CP+CR P+
Sbjct: 740 WMSYKLQCPVCRSPL 754

>Scas_713.45
          Length = 570

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 369 NKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           N  P +LPCGHI    CL  W +   TCP+CR
Sbjct: 227 NHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>Kwal_27.10546
          Length = 104

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 375 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 410
           LP C H   L C+  W+ +S+TCP+CR  V   K NV
Sbjct: 53  LPHCNHRFDLECVAVWLSKSRTCPLCRDDVLSHKPNV 89

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 329 DTLVTVTVEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLP-CGHILHLSCLK 387
           DTL  V  ++L   A  DN  I C   L         +++      LP CGH   L C+ 
Sbjct: 74  DTLPRVPKKRL---AEGDNCAICCCGYL---------EDEYPLVVELPNCGHTFDLQCVS 121

Query: 388 NWMERSQTCPICRLPVFDEKGNV 410
            W+ RS TCP+CR  V   K  +
Sbjct: 122 VWLSRSTTCPMCRSDVLVRKPEI 144

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 372 PKRLPCGHILHLSCLKNWMERSQTCPICR 400
           P ++PCGHI   SCL  W     +CP+CR
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 37/96 (38%), Gaps = 33/96 (34%)

Query: 325 KQLDDTLVTVTVEQLQNSANDDNI--------------------CIICMDELIHSPNQQT 364
           K LDD  VT +  ++     D +I                    CI+C+ E+        
Sbjct: 7   KPLDDGTVTTSNNEISGVPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEM-------- 58

Query: 365 WKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
                K P   PCGHI   +C+ NW +    CP+CR
Sbjct: 59  -----KDPSCAPCGHIFCWNCIINWCKERSECPLCR 89

>Kwal_56.23900
          Length = 589

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 336 VEQLQNSANDDNICIICMDELIHSPNQQTWKNKNK-----KPKRLPCGHILHLSCLKNWM 390
           V+     AND        ++     N+ +  ++ K      P +LPC H+    C++ W 
Sbjct: 181 VDDQNGPANDGETASSPPEQEQPKDNENSGDDQGKVTYKHSPVQLPCSHVFGRECIRQWT 240

Query: 391 ERSQTCPICRLPVFDEKG 408
               TCPICR  +    G
Sbjct: 241 NLHNTCPICRANIVGADG 258

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 13/52 (25%)

Query: 349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           CI+C+ E+               P  LPCGH+    C+ +W + +  CP+CR
Sbjct: 277 CILCLMEMTD-------------PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 372 PKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 408
           P +LPCGHI    C+  W     +CP+CR  + +  G
Sbjct: 252 PIKLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG 288

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 375 LP-CGHILHLSCLKNWMERSQTCPICR 400
           LP C H   L CL  W+ RS TCP+CR
Sbjct: 62  LPHCHHKFDLECLSVWLSRSTTCPLCR 88

>Kwal_55.19999
          Length = 152

 Score = 38.5 bits (88), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 13/57 (22%)

Query: 344 NDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           +D   CI+C+  ++              P   PCGH+    CL +W      CP+CR
Sbjct: 97  SDSRKCILCLGFML-------------DPSCAPCGHVFCWKCLLSWCNERPECPLCR 140

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 24/57 (42%), Gaps = 13/57 (22%)

Query: 344 NDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
            D   C++C++ ++              P   PCGH+    C+  W    Q CP+CR
Sbjct: 250 EDSRKCVLCLNYMLD-------------PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 375 LPCGHILHLSCLKNWMERSQTCPICRLPVF 404
           +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>Scas_705.41
          Length = 428

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 10/58 (17%)

Query: 346 DNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQT--CPICRL 401
           DNIC IC D+L  +   Q         K  PC H  H  C++ W   S    CP+CR 
Sbjct: 9   DNICPICFDDLNDTDILQ--------GKLKPCNHKYHYDCIRRWHGYSDNSDCPLCRC 58

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           CI+C+ ++               P  LPCGH+   +C+  W      CP+CR
Sbjct: 266 CILCLADMT-------------DPSCLPCGHMFCWACVMQWCNERNECPLCR 304

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 372 PKRLPCGHILHLSCLKNWMERSQTCPICR 400
           P   PCGH+   SCL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 37.4 bits (85), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 15/88 (17%)

Query: 317 LWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPNQQT-WKNKNKKPKRL 375
           +W I +N  +LD+++          +  D+++C IC     H+P     +  ++      
Sbjct: 15  VWDIPKNEDRLDESM----------ADEDEDVCGICRASY-HAPCPNCRYPGESCAIVLG 63

Query: 376 PCGHILHLSCLKNWMERSQT---CPICR 400
            CGH  H+ C+  W++   +   CP+CR
Sbjct: 64  RCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 16/73 (21%)

Query: 331  LVTVTVEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWM 390
            L T+T E  +N+  +   C IC+  + +                + CGH+   SC+ +W+
Sbjct: 1149 LSTLTYEAQKNTTME---CSICLQPITNGA-------------MVNCGHLFCTSCIFSWL 1192

Query: 391  ERSQTCPICRLPV 403
            +  +TCP+C+ P 
Sbjct: 1193 KNRKTCPLCKHPT 1205

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 372 PKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKG 408
           P +L CGH     C+  W +   +CPICR  +   +G
Sbjct: 136 PTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 172

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 4/41 (9%)

Query: 364 TWKNKNKKPKRL-PCGHILHLSCLKNWME---RSQTCPICR 400
            W++      RL PCGH  HL+C++ W      +++CP+CR
Sbjct: 21  CWESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Scas_625.11
          Length = 274

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 375 LP-CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQ 412
           LP C H  H  C+K W++++  CP+CR  V + K    +
Sbjct: 228 LPNCSHHFHFECIKLWLQKNSLCPLCRDNVMECKAETTE 266

>Scas_615.13
          Length = 330

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 13/56 (23%)

Query: 345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           D   CI+C+  +               P   PCGHI    C+ +W +    CP+CR
Sbjct: 276 DARKCILCLAYMTD-------------PSCSPCGHIFCWECILDWCKERPECPLCR 318

>Scas_560.6*
          Length = 118

 Score = 35.0 bits (79), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 377 CGHILHLSCLKNWMERSQTCPICRLPVFDEKGNV 410
           C H   L C+  W+ +S TCP+CR  V + K N+
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>Kwal_55.21206
          Length = 275

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 11/66 (16%)

Query: 336 VEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMER-SQ 394
           VE L   A+    C IC ++           NK      L C H+ H  C+  W+ R S 
Sbjct: 107 VESLGPGADSRTTCAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSA 156

Query: 395 TCPICR 400
            CP+C+
Sbjct: 157 CCPLCK 162

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 11/56 (19%)

Query: 348 ICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQ--TCPICRL 401
           +C IC++++    +    K         PCGH  H  C++ W   ++   CP+CR+
Sbjct: 5   VCAICLEDICGKSSTSYLK---------PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 34.7 bits (78), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 346 DNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           ++ C IC    +  P    +    K P+   C H   L CL  W++ + TCP+CR
Sbjct: 68  EDTCAICQCNFLDDP----YPLVAKVPR---CNHKFDLECLSIWLQNNHTCPMCR 115

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 375 LPCGHILHLSCLKNWMERSQTCPICR 400
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 377  CGHILHLSCLKNWMERSQTCPICRLPV 403
            CGH    SC+  W++   TCP+C+  V
Sbjct: 1180 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1206

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 15/68 (22%)

Query: 335  TVEQLQNS-ANDDNI-CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMER 392
            T+ QL+ + AN +NI C +C  ++                  L CGH     C+ +W ++
Sbjct: 1192 TLGQLKTAIANGENISCAVCYSDIYTG-------------SILKCGHFFCKDCVTHWFKK 1238

Query: 393  SQTCPICR 400
            + +CP+C+
Sbjct: 1239 NTSCPMCK 1246

>Scas_573.9
          Length = 1502

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 375  LPCGHILHLSCLKNWMERSQTCPICRL 401
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 377 CGHILHLSCLKNWMERSQTCPICR 400
           CGH     C+  W+ ++ TCP+CR
Sbjct: 64  CGHKFDFECVSMWLTKNTTCPMCR 87

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
           Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 12/55 (21%)

Query: 348 ICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQ--TCPICR 400
           IC IC++ +          N+  + + LPC H  H+SC++ W   S    CP CR
Sbjct: 4   ICGICLESM----------NETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 15/68 (22%)

Query: 335  TVEQLQNSANDDNI--CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMER 392
             + +L+++ ND+ I  C IC+ E+             +    + CGH    SC+  W+  
Sbjct: 1223 NLSRLKDTLNDNQILSCSICLGEV-------------EIGAIIKCGHYFCKSCILTWLRA 1269

Query: 393  SQTCPICR 400
               CPIC+
Sbjct: 1270 HSKCPICK 1277

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 377 CGHILHLSCLKNWMERS--QTCPICRL 401
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>Kwal_26.8030
          Length = 660

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 376 PCGHILHLSCLKNWMERSQTCPICRLPVFD 405
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 32.3 bits (72), Expect = 0.25,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHILHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 77  CNHAFHLHCINKWLQTRNACPLDNQP 102

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 376 PCGHILHLSCLKNWMERSQTCPICR 400
           PC H  H  CL  W  ++  CP+CR
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCR 255

>Kwal_56.23112
          Length = 135

 Score = 32.7 bits (73), Expect = 0.29,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 377 CGHILHLSCLKNWMERSQT---CPICR 400
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharomyces
            cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 377  CGHILHLSCLKNWMERSQTCPI---CRLP-VFD 405
            C H+LHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>Kwal_55.22054
          Length = 111

 Score = 32.0 bits (71), Expect = 0.31,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHILHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWLQTRNACPLDNQP 103

>CAGL0L06336g 713059..714861 some similarities with sp|P32917
           Saccharomyces cerevisiae YDR103w STE5 pheromone signal
           transduction pathway protein, hypothetical start
          Length = 600

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 8/55 (14%)

Query: 346 DNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400
           ++IC +C DE I       +K+  +K   L CGH+ H+ CL  ++  S   PIC+
Sbjct: 37  NHICTLC-DEPI------AYKSGGEKVIELECGHMCHMDCLMLFV-NSTALPICK 83

>Kwal_26.8090
          Length = 520

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 375 LPCGHILHLSCLKNWMERSQTCPICR 400
           +PC H  H  CL  W +    CP+CR
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCR 267

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 36/93 (38%)

Query: 324 NKQLD-DTLVTVTVEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILH 382
           NK +D + +V V V + QN       C IC++E+  +P   T            CGHI  
Sbjct: 133 NKFVDKEKIVRVIVPRGQN-------CPICLNEIPVAPRMVT------------CGHIFC 173

Query: 383 LSCLKNWME----------------RSQTCPIC 399
           +SCL+N+ E                + + CP+C
Sbjct: 174 MSCLENFFEIEEVVKNPETGIKQKKKFKECPLC 206

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 376 PCGHILHLSCLKNWMERSQTCPICRLPVFD 405
           PCGH +H  C   +++ S  CP C + V +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
           cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 31.6 bits (70), Expect = 0.49,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 345 DDNICIIC----MDELIHSPNQQTWKNKNKKPKRL-PCGHILHLSCLKNWMERSQTCPIC 399
           D + C IC    M+  ++   + T+ ++++       C H  HL C+  W++    CP+ 
Sbjct: 40  DVDNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPLD 99

Query: 400 RLP 402
             P
Sbjct: 100 NKP 102

>Kwal_14.1287
          Length = 1518

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 375  LPCGHILHLSCLKNWMERSQTCPICRL 401
            + CGH     C+ +W++   +CP+C++
Sbjct: 1202 IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 375  LPCGHILHLSCLKNWM--ERSQTCP 397
            LPCGH  H  C++ W   E  Q CP
Sbjct: 1308 LPCGHEGHFQCIQEWFLDENEQECP 1332

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 31.2 bits (69), Expect = 0.58,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 5/55 (9%)

Query: 349 CIICMDELIH-----SPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPI 398
           C IC + ++       PN  T            C H  HL C+  W+     CP+
Sbjct: 42  CAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 32.0 bits (71), Expect = 0.59,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 377 CGHILHLSCLKNWMERSQT---CPICR 400
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 31.6 bits (70), Expect = 0.64,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHILHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>Scas_585.5*
          Length = 109

 Score = 31.2 bits (69), Expect = 0.65,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 377 CGHILHLSCLKNWMERSQTCPICRLP 402
           C H  HL C+  W++    CP+   P
Sbjct: 76  CNHAFHLHCINKWIKTRDACPLDNQP 101

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 378  GHILHLSCLKNWMERSQTCPICR 400
            GH     C+ +W+E  Q+CP+C+
Sbjct: 1235 GHFYCQECISSWLETKQSCPLCK 1257

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 4/36 (11%)

Query: 372 PKRLPCGHILHLSCLKNWMERSQ----TCPICRLPV 403
           P    CGH     C+ NW+  +     TCP CR  V
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 375 LPCGHILHLSCLKNWMERSQ--TCPICRL---PVFDEKGNV 410
           + C H  HL C++ W   SQ   CP CR+    + D + NV
Sbjct: 21  VTCQHEYHLECIREWHNHSQDFKCPTCRVESNKLLDVENNV 61

>Kwal_27.10419
          Length = 300

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)

Query: 377 CGHILHLSCLKNWMERSQ----TCPICRLPV 403
           CGH     C+ NW+  +     TCP CR P+
Sbjct: 9   CGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 376 PCGHILHLSCLKNWMERSQTCPIC 399
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 20/51 (39%), Gaps = 13/51 (25%)

Query: 349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPIC 399
           C IC D L             K P   PCGH     C++ ++     CP+C
Sbjct: 27  CHICKDFL-------------KNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>Scas_665.1
          Length = 392

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 372 PKRLPCGHILHLSCLKNWM----ERSQTCPICRLPVFD 405
           P    CGH     CLK+W+    ++   CP CR  + D
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD 77

>Kwal_56.23543
          Length = 965

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 13/58 (22%)

Query: 349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTC------PICR 400
           C +C++ +       + +   +K   L CGH++H  CL  + E   +C      P CR
Sbjct: 162 CCLCLEYI-------SCRTVGEKVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing five
            WD domains (WD-40 repeat), which may mediate
            protein-protein interactions, has a region of low
            similarity to a region of S. cerevisiae Sec27p, which a
            coatomer (COPI) complex beta' chain (beta'-COP) of
            secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 377  CGHILHLSCLKNWMERSQTCPI---CRLP-VFD 405
            C H+LH SC + W E    CP    C  P +FD
Sbjct: 1115 CQHVLHSSCARIWWEIGDECPSGCGCNCPEMFD 1147

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 21/60 (35%), Gaps = 17/60 (28%)

Query: 348 ICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNW----MERSQTCPICRLPV 403
           +C IC D +               P   PCGH     CL  W     ++   CP CR  +
Sbjct: 29  VCSICHDYMF-------------VPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>Kwal_23.6285
          Length = 458

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 370 KKPKRLPCGHILHLSCLKNWMERSQTCPIC 399
           K P   PC H     C++ ++ R   CP+C
Sbjct: 45  KSPVLTPCAHTFCSLCIREYLNRELRCPLC 74

>AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH]
           complement(339295..341043) [1749 bp, 582 aa]
          Length = 582

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 13/28 (46%)

Query: 372 PKRLPCGHILHLSCLKNWMERSQTCPIC 399
           P  LPCGH+    C+  W +   +   C
Sbjct: 221 PTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>Scas_392.2
          Length = 376

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 12/118 (10%)

Query: 107 TVAFFGLLLLYLKVFHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIIT 166
           T  F    LL   ++ W +KD    L +      T   ++     F L+ +A+    +  
Sbjct: 133 TTGFLLYQLLKRTIYLWGVKDLPSYLFEKT--EITFLIILIPMDGFVLITVAL----LFI 186

Query: 167 RCISSIYTNQKSDIESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNE 224
           RC+S+     K+ IES  L  ++ + +   L+       Q  +N WE Y ++++  N+
Sbjct: 187 RCLSNQIIGGKTQIESWELERLENLYYRKKLLP------QLLVNLWEIYPNEKTPENK 238

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 22/64 (34%), Gaps = 18/64 (28%)

Query: 345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQ-----TCPIC 399
           D  IC IC D +               P    CGH    +CLK W          +CP C
Sbjct: 26  DTTICSICHDYMF-------------VPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPEC 72

Query: 400 RLPV 403
           R  V
Sbjct: 73  RAIV 76

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,030,206
Number of extensions: 639209
Number of successful extensions: 2481
Number of sequences better than 10.0: 92
Number of HSP's gapped: 2520
Number of HSP's successfully gapped: 93
Length of query: 542
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 435
Effective length of database: 12,891,983
Effective search space: 5608012605
Effective search space used: 5608012605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 64 (29.3 bits)