Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOL012C (HTZ1)1341015108e-68
KLLA0C05918g132984812e-63
Kwal_56.225171341014813e-63
Scas_644.7131984752e-62
ACL017C1331014752e-62
Sklu_1188.11341014733e-62
Scas_482.11101022926e-35
YDR225W (HTA1)1321022937e-35
Scas_721.831321022937e-35
Sklu_890.11311022921e-34
CAGL0K11440g1311012921e-34
YBL003C (HTA2)1321022912e-34
CAGL0C04411g1311012912e-34
Sklu_1763.11321022902e-34
Kwal_27.109991321022903e-34
Kwal_27.115991311022894e-34
AEL003C1311022868e-34
KLLA0F13332g130992861e-33
KLLA0E17413g130992861e-33
AGR184W1751022854e-33
Kwal_56.2340110975650.34
CAGL0I08635g13983621.1
CAGL0C01243g38337621.5
Sklu_1211.184349603.2
YER159C (BUR6)14273574.7
Scas_576.1*9042565.6
Kwal_23.601436444569.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL012C
         (133 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL012C (HTZ1) [4804] chr15 complement(303579..303983) Histone-r...   201   8e-68
KLLA0C05918g complement(522995..523393) similar to sp|Q12692 Sac...   189   2e-63
Kwal_56.22517                                                         189   3e-63
Scas_644.7                                                            187   2e-62
ACL017C [1032] [Homologous to ScYOL012C (HTZ1) - SH] (330555..33...   187   2e-62
Sklu_1188.1 YOL012C, Contig c1188 570-974 reverse complement          186   3e-62
Scas_482.1                                                            117   6e-35
YDR225W (HTA1) [1061] chr4 (915522..915920) Histone H2A, nearly ...   117   7e-35
Scas_721.83                                                           117   7e-35
Sklu_890.1 , Contig c890 480-875 reverse complement                   117   1e-34
CAGL0K11440g complement(1111362..1111757) highly similar to sp|P...   117   1e-34
YBL003C (HTA2) [191] chr2 complement(235359..235757) Histone H2A...   116   2e-34
CAGL0C04411g 426015..426410 highly similar to sp|P04911 Saccharo...   116   2e-34
Sklu_1763.1 YDR225W, Contig c1763 299-697 reverse complement          116   2e-34
Kwal_27.10999                                                         116   3e-34
Kwal_27.11599                                                         115   4e-34
AEL003C [2503] [Homologous to ScYBL003C (HTA2) - SH] (631732..63...   114   8e-34
KLLA0F13332g 1230744..1231136 some similarities with sp|P04911 S...   114   1e-33
KLLA0E17413g 1539714..1540106 some similarities with sp|P04911 S...   114   1e-33
AGR184W [4495] [Homologous to ScYDR225W (HTA1) - SH] complement(...   114   4e-33
Kwal_56.23401                                                          30   0.34 
CAGL0I08635g complement(842539..842958) no similarity, hypotheti...    28   1.1  
CAGL0C01243g 128629..129780 highly similar to sp|P07172 Saccharo...    28   1.5  
Sklu_1211.1 YBR237W, Contig c1211 147-2678                             28   3.2  
YER159C (BUR6) [1588] chr5 complement(491525..491953) Alpha subu...    27   4.7  
Scas_576.1*                                                            26   5.6  
Kwal_23.6014                                                           26   9.1  

>YOL012C (HTZ1) [4804] chr15 complement(303579..303983)
           Histone-related protein, involved in silencing, required
           for GAL gene induction [405 bp, 134 aa]
          Length = 134

 Score =  201 bits (510), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL
Sbjct: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92

Query: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSK
Sbjct: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSK 133

>KLLA0C05918g complement(522995..523393) similar to sp|Q12692
           Saccharomyces cerevisiae YOL012c HTZ1 evolutionarily
           conserved member of the histone H2A F/Z family of
           histone variants, start by similarity
          Length = 132

 Score =  189 bits (481), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 95/98 (96%), Positives = 97/98 (98%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+KRYLKR+A GRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL
Sbjct: 33  FPVGRVKRYLKRNAAGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92

Query: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKK 130
           QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKK
Sbjct: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKK 130

>Kwal_56.22517
          Length = 134

 Score =  189 bits (481), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGRIKRYLKR+A GRTRVGSK+AIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL
Sbjct: 33  FPVGRIKRYLKRNAAGRTRVGSKSAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92

Query: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIRGDDELD+L+RATIASGGVLPHINKALLLKVE+KG K
Sbjct: 93  QLAIRGDDELDTLVRATIASGGVLPHINKALLLKVERKGVK 133

>Scas_644.7
          Length = 131

 Score =  187 bits (475), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 93/98 (94%), Positives = 97/98 (98%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGRIKRYLKR+A+G+ RVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL
Sbjct: 32  FPVGRIKRYLKRNASGKVRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 91

Query: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKK 130
           QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVE+K
Sbjct: 92  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEQK 129

>ACL017C [1032] [Homologous to ScYOL012C (HTZ1) - SH]
           (330555..330956) [402 bp, 133 aa]
          Length = 133

 Score =  187 bits (475), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGRIKRYLK++A G+TRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL
Sbjct: 33  FPVGRIKRYLKKNAAGKTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92

Query: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKK  K
Sbjct: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKTHK 133

>Sklu_1188.1 YOL012C, Contig c1188 570-974 reverse complement
          Length = 134

 Score =  186 bits (473), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGRIKRYLK++A G+TRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL
Sbjct: 33  FPVGRIKRYLKKNAAGKTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92

Query: 93  QLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIRGDDELD+LIRATI++GGVLPHINKALLLKVE+KG K
Sbjct: 93  QLAIRGDDELDTLIRATISAGGVLPHINKALLLKVERKGGK 133

>Scas_482.1
          Length = 110

 Score =  117 bits (292), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 76/102 (74%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 5   FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 63

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K +K
Sbjct: 64  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATK 105

>YDR225W (HTA1) [1061] chr4 (915522..915920) Histone H2A, nearly
           identical to Hta2p [399 bp, 132 aa]
          Length = 132

 Score =  117 bits (293), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 76/102 (74%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K +K
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATK 127

>Scas_721.83
          Length = 132

 Score =  117 bits (293), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 76/102 (74%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K +K
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATK 127

>Sklu_890.1 , Contig c890 480-875 reverse complement
          Length = 131

 Score =  117 bits (292), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 76/102 (74%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 26  FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 84

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K +K
Sbjct: 85  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSGKATK 126

>CAGL0K11440g complement(1111362..1111757) highly similar to
           sp|P04911 Saccharomyces cerevisiae YDR225w HTA1 or
           sp|P04912 Saccharomyces cerevisiae YBL003c HTA2, start
           by similarity
          Length = 131

 Score =  117 bits (292), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 2/101 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGS 132
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K S
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPS 126

>YBL003C (HTA2) [191] chr2 complement(235359..235757) Histone H2A,
           nearly identical to Hta1p [399 bp, 132 aa]
          Length = 132

 Score =  116 bits (291), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 76/102 (74%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K +K
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTAK 127

>CAGL0C04411g 426015..426410 highly similar to sp|P04911
           Saccharomyces cerevisiae YDR225w HTA1 or sp|P04912
           Saccharomyces cerevisiae YBL003c HTA2, start by
           similarity
          Length = 131

 Score =  116 bits (291), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 2/101 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRRGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGS 132
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K S
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPS 126

>Sklu_1763.1 YDR225W, Contig c1763 299-697 reverse complement
          Length = 132

 Score =  116 bits (290), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 76/102 (74%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L++    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRKGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K +K
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATK 127

>Kwal_27.10999
          Length = 132

 Score =  116 bits (290), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 75/102 (73%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + RVGS A +Y+TAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 27  FPVGRVHRLLRRGNYAQ-RVGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 85

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K  K
Sbjct: 86  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKPGK 127

>Kwal_27.11599
          Length = 131

 Score =  115 bits (289), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 75/102 (73%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L+R    + RVGS A +Y+TAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 26  FPVGRVHRLLRRGNYAQ-RVGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 84

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K  K
Sbjct: 85  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSGKPGK 126

>AEL003C [2503] [Homologous to ScYBL003C (HTA2) - SH]
           (631732..632127) [396 bp, 131 aa]
          Length = 131

 Score =  114 bits (286), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 75/102 (73%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L++    + R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 26  FPVGRVHRLLRKGNYAQ-RIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 84

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I+  LL K   K +K
Sbjct: 85  QLAIRNDDELNKLLGNVTIAQGGVLPNIHANLLPKKSAKATK 126

>KLLA0F13332g 1230744..1231136 some similarities with sp|P04911
           Saccharomyces cerevisiae YDR225w HTA1 histone H2A,
           hypothetical start
          Length = 130

 Score =  114 bits (286), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/99 (62%), Positives = 72/99 (72%), Gaps = 2/99 (2%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L R      R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 26  FPVGRVHRLL-RKGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 84

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKK 130
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K
Sbjct: 85  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSSK 123

>KLLA0E17413g 1539714..1540106 some similarities with sp|P04911
           Saccharomyces cerevisiae YDR225w HTA1 histone H2A,
           hypothetical start
          Length = 130

 Score =  114 bits (286), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/99 (62%), Positives = 72/99 (72%), Gaps = 2/99 (2%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L R      R+GS A +YLTAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 26  FPVGRVHRLL-RKGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 84

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKK 130
           QLAIR DDEL+ L+   TIA GGVLP+I++ LL K   K
Sbjct: 85  QLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSSK 123

>AGR184W [4495] [Homologous to ScYDR225W (HTA1) - SH]
           complement(1095987..1096514) [528 bp, 175 aa]
          Length = 175

 Score =  114 bits (285), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 75/102 (73%), Gaps = 2/102 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FPVGR+ R L++    + R+GS A +Y+TAVLEYL AE+LELAGNAA+D K  RI PRHL
Sbjct: 70  FPVGRVHRLLRKGNYAQ-RIGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHL 128

Query: 93  QLAIRGDDELDSLI-RATIASGGVLPHINKALLLKVEKKGSK 133
           QLAIR DDEL+ L+   TIA GGVLP+I+  LL K   K +K
Sbjct: 129 QLAIRNDDELNKLLGNVTIAQGGVLPNIHANLLPKKSAKATK 170

>Kwal_56.23401
          Length = 109

 Score = 29.6 bits (65), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 33  FPVGRIKRYLKRHAT-GRTRVGSKAAIYLTA-VLEYLTAEVLELAGNAAKDLKVKRITPR 90
           FP  +IK+ ++     G+    S+A   +T   LE+  A ++  +G+ AK++  +RI+  
Sbjct: 17  FPPAKIKKIMQTDEDIGKV---SQATPVITGRSLEFFIAMLVNRSGHVAKEMGCRRISGE 73

Query: 91  HLQLAIRGDDELDSL 105
            ++  I  D++ D L
Sbjct: 74  VMKKTIMTDEKFDFL 88

>CAGL0I08635g complement(842539..842958) no similarity, hypothetical
           start
          Length = 139

 Score = 28.5 bits (62), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 33  FPVGRIKRYLKRHAT-GRTRVGSKAAIYLTA-VLEYLTAEVLELAGNAAKDLKVKRITPR 90
           FP  ++K+ ++     G+    S+A   +T   LE+  A +++ +G+ A+   +KRIT  
Sbjct: 50  FPPAKVKKIMQSDEDIGKV---SQATPVITGRSLEFFMALLVKKSGDMARQRGMKRITAD 106

Query: 91  HLQLAIRGDDELDSLIRATIASG 113
            L+  I  D+  D  +R +I +G
Sbjct: 107 VLRDTILEDERFD-FLRESICAG 128

>CAGL0C01243g 128629..129780 highly similar to sp|P07172
           Saccharomyces cerevisiae YIL116w HIS5, start by
           similarity
          Length = 383

 Score = 28.5 bits (62), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 77  NAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASG 113
           ++ KDL +  +T  +L L +  D+ +D++IRA    G
Sbjct: 74  SSFKDLSLPPLTEDNLCLGVGSDESIDAVIRACCVPG 110

>Sklu_1211.1 YBR237W, Contig c1211 147-2678
          Length = 843

 Score = 27.7 bits (60), Expect = 3.2,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 45  HATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQ 93
           H TGRT  G+   + LT +LE   A    LA  + +D +V+   PR +Q
Sbjct: 605 HTTGRTARGTNKGVALTMLLEGELAASYILA-KSIRDSEVENHDPRTIQ 652

>YER159C (BUR6) [1588] chr5 complement(491525..491953) Alpha subunit
           of NC2 (Dr1/Drap1) regulator of class II transcription,
           contains a histone fold domain [429 bp, 142 aa]
          Length = 142

 Score = 26.6 bits (57), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 33  FPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHL 92
           FP  ++K+ ++       +V     +     LE+  A +++ +G  A+    KRIT   L
Sbjct: 53  FPPAKVKKIMQTDED-IGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEIL 111

Query: 93  QLAIRGDDELDSL 105
           +  I  D++ D L
Sbjct: 112 KKTILNDEKFDFL 124

>Scas_576.1*
          Length = 90

 Score = 26.2 bits (56), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 64  LEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSL 105
           LE+  A +++ +G+ A+    KRIT   L+  I  D++LD L
Sbjct: 44  LEFFIALLVKKSGDVARKNGTKRITADVLKQTILTDEKLDFL 85

>Kwal_23.6014
          Length = 364

 Score = 26.2 bits (56), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 34 PVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGN 77
          P+G I  Y+K   T    +   A I L A+L Y T E+ + AG+
Sbjct: 44 PLGLIFGYMKLSITWTFILNFVAIIPLAAMLAYATEELADKAGS 87

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,812,220
Number of extensions: 90290
Number of successful extensions: 265
Number of sequences better than 10.0: 28
Number of HSP's gapped: 237
Number of HSP's successfully gapped: 28
Length of query: 133
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 43
Effective length of database: 13,480,489
Effective search space: 579661027
Effective search space used: 579661027
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)