Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOL011W (PLB3)68667434220.0
Scas_644.870461123580.0
Scas_611.164657723050.0
YMR008C (PLB1)66457821960.0
CAGL0E02321g70459821970.0
CAGL0J11770g65959321670.0
Kwal_56.2251064158021110.0
Sklu_1900.165857620950.0
KLLA0C05940g64058320410.0
Scas_685.367757020420.0
YMR006C (PLB2)70658519960.0
CAGL0J11748g69556518190.0
Scas_92.0d2362117731e-98
AAL027W5924165632e-63
Kwal_0.1735074165398e-61
Sklu_2442.195844335221e-57
KLLA0F12232g6804554547e-48
YNL012W (SPO1)6314264431e-46
CAGL0H03575g5143984362e-46
Scas_695.105533784092e-42
KLLA0B02068g116777731.3
YPL217C (BMS1)118377721.7
Scas_690.1*63647693.0
AFL113C116347684.1
Kwal_56.2413946347684.5
Scas_707.31598123684.8
Sklu_2418.427343665.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL011W
         (674 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...  1322   0.0  
Scas_644.8                                                            912   0.0  
Scas_611.1                                                            892   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   850   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   850   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   839   0.0  
Kwal_56.22510                                                         817   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        811   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   790   0.0  
Scas_685.3                                                            791   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   773   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   705   0.0  
Scas_92.0d                                                            302   1e-98
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   221   2e-63
Kwal_0.173                                                            212   8e-61
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     205   1e-57
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   179   7e-48
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   175   1e-46
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   172   2e-46
Scas_695.10                                                           162   2e-42
KLLA0B02068g complement(179493..182996) similar to sgd|S0006138 ...    33   1.3  
YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein i...    32   1.7  
Scas_690.1*                                                            31   3.0  
AFL113C [3082] [Homologous to ScYPL217C (BMS1) - SH] (223522..22...    31   4.1  
Kwal_56.24139                                                          31   4.5  
Scas_707.3                                                             31   4.8  
Sklu_2418.4 YJR111C, Contig c2418 8325-9146 reverse complement         30   5.5  

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score = 1322 bits (3422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/674 (95%), Positives = 645/674 (95%)

Query: 1   MIRPLCSKIIISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAW 60
           MIRPLCSKIIISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAW
Sbjct: 1   MIRPLCSKIIISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAW 60

Query: 61  LEKRNKVTSVALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTG 120
           LEKRNKVTSVALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTG
Sbjct: 61  LEKRNKVTSVALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTG 120

Query: 121 AGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQND 180
           AGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQND
Sbjct: 121 AGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQND 180

Query: 181 DSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSL 240
           DSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSL
Sbjct: 181 DSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSL 240

Query: 241 NRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPS 300
           NRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPS
Sbjct: 241 NRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPS 300

Query: 301 LNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFIT 360
           LNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFIT
Sbjct: 301 LNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFIT 360

Query: 361 RLARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVL 420
           RLARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVL
Sbjct: 361 RLARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVL 420

Query: 421 PLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNL 480
           PLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNL
Sbjct: 421 PLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNL 480

Query: 481 GLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGF 540
           GLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGF
Sbjct: 481 GLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGF 540

Query: 541 EIATRNNFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVE 600
           EIATRNNFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVE
Sbjct: 541 EIATRNNFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVE 600

Query: 601 KDVHHXXXXXXXXXXXXGQEESLYAGXXXXXXXXXXXXXXXXXEIPSATATLEKKAATNS 660
           KDVHH            GQEESLYAG                 EIPSATATLEKKAATNS
Sbjct: 601 KDVHHSFINVNSFNSSIGQEESLYAGSSASQSSSSSSSSSSSSEIPSATATLEKKAATNS 660

Query: 661 GSHLSGISVKFSAM 674
           GSHLSGISVKFSAM
Sbjct: 661 GSHLSGISVKFSAM 674

>Scas_644.8
          Length = 704

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/611 (69%), Positives = 508/611 (83%), Gaps = 16/611 (2%)

Query: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCP--------DDINLVREATSISQNESAWL 61
           +  +++ I      A AW+P++SY P  + C         +D +L+REA SIS NES WL
Sbjct: 6   LYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWL 65

Query: 62  EKRNKVTSVALKDFLTRATANFS-----DSSEVLSKLFNDGNSENLPKIAVAVSGGGYRS 116
           +KR + T   L  FL R+  + +     D++ +LS L    +S + PKI +AVSGGGYRS
Sbjct: 66  QKRMQNTREPLLQFLNRSLTSLNTSSSFDTAALLSSLMG-SDSASQPKIGIAVSGGGYRS 124

Query: 117 MLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNN 176
           MLTGAG+LAAMDNRT GA  HGLGGLLQSTTYLSGASGGNWLVGTLA NNWTSVQ I++N
Sbjct: 125 MLTGAGILAAMDNRTRGAQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDN 184

Query: 177 MQNDDSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNF 236
               DSIWDLS+SIV+PGG NIFK+A+RWDHIS+A++ KQ A ++TSLAD+WGRAL+Y F
Sbjct: 185 FNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKF 244

Query: 237 FPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGS 296
           FPSL RGG+  TWSS+RD PVF   +MPFPISVADGRYPG+KV+NLNATVFEFNPFEMGS
Sbjct: 245 FPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGS 304

Query: 297 WDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINST--H 354
           WDPSLN+F +VK+LGTNVS G P++  +C  GFDN  FIMGTSSTLFNQFLLRINST  H
Sbjct: 305 WDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLH 364

Query: 355 LPSFITRLARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDD 414
           LP FIT+LA HFLKD+SQDFND+A Y PNPFKD  F+D++YT SIV+S SL+LVDGGEDD
Sbjct: 365 LPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDD 424

Query: 415 ENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDT 474
           EN+P+LPLIQ+ERD+DI+FA+DNS DM+LAWPDGSSLVHT+ERQFV+QGQGM+FPYVP T
Sbjct: 425 ENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGT 484

Query: 475 NTFVNLGLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRS 534
           +TFVNLGLN+KPTFFGCDA+NLTDL+YIPPLV+YLPN +YSF SNQSAFKLSY+E QRR+
Sbjct: 485 DTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRA 544

Query: 535 MIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTT 594
           MI NGFEIATRNNFTDDP+F+GC+GCAIIRRKQQ+LN+TLP  C TCF NYCWNGTLDTT
Sbjct: 545 MISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTT 604

Query: 595 PLPDVEKDVHH 605
           PLPD +KD+H+
Sbjct: 605 PLPDNKKDIHN 615

>Scas_611.1
          Length = 646

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/577 (71%), Positives = 491/577 (85%), Gaps = 2/577 (0%)

Query: 22  LAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATA 81
           L   AWSP++SYVP  V+C D+INL+REA S+S +E +WL KR+ +TS AL+ FL R+T+
Sbjct: 16  LQVGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTS 75

Query: 82  NFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGG 141
           NFSD+S ++S+LF+ GNS + P+I VA SGGGYR+ML+GAG++AAMDNRT+GA EHGLGG
Sbjct: 76  NFSDTS-LISQLFS-GNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGG 133

Query: 142 LLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKT 201
           LLQ  TYL+G SGGNWL  TL  NNWTSVQ ILNNM NDDSIWD+S SI+ PGG NI +T
Sbjct: 134 LLQGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILET 193

Query: 202 AKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNA 261
            +RWDHIS+AV++KQ+A +N SLAD+WGRAL+YNFFPSL RGG G TWS++RD  VF+NA
Sbjct: 194 GERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNA 253

Query: 262 EMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLE 321
           EMPFPISVADGRYPGT VINLNATVFEFNPFEMGSWDP+LN+F +VKYLGTNVSNG P+ 
Sbjct: 254 EMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPIT 313

Query: 322 RGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYS 381
            GKC AGFDN GFI GTSSTLFNQFLL INST LPSFIT+LA HFL DLS D+NDIA+YS
Sbjct: 314 EGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYS 373

Query: 382 PNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADM 441
           PNPF+D  F+ S+Y+ SIV S  LFLVDGGED++N+P++PL+QKER++D+IFA+DNSAD 
Sbjct: 374 PNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADT 433

Query: 442 RLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQY 501
             +WPDG+SLV+TYERQF  QG GM+FPYVPD NTFVNLGLNK+PTFFGCDA NLTDL+Y
Sbjct: 434 NQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEY 493

Query: 502 IPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCA 561
           IPPLVVY+PNA +SFN NQS FK+SYS S+R SMIQNGFE ATR NFTDD +F+GC+GCA
Sbjct: 494 IPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCA 553

Query: 562 IIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPD 598
           I+RRKQQ++N TLP EC  CF NYCWNGT+D TP  D
Sbjct: 554 IMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAKD 590

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/578 (68%), Positives = 480/578 (83%), Gaps = 2/578 (0%)

Query: 25  NAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATANFS 84
           NAWSP +SYVP  V+C DDINLVREA+ +S NE+ WL+KR+  T  AL  FL RAT+NFS
Sbjct: 21  NAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNFS 80

Query: 85  DSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQ 144
           D+S +LS LF   NS N+PKIAVA SGGGYR+ML+GAG+LAAMDNRT+GA EHGLGGLLQ
Sbjct: 81  DTS-LLSTLFG-SNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQ 138

Query: 145 STTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKTAKR 204
             TYL+G SGGNWL  TLA NNWTSVQ I++N    +SIWD+S SI+TP GINIFKT  R
Sbjct: 139 GATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSR 198

Query: 205 WDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMP 264
           WD IS+ V+ K++A +N SLAD+WGRALAYNF+PSL+RGG+G TWS++R+  VF+N EMP
Sbjct: 199 WDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMP 258

Query: 265 FPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGK 324
           FPI+VADGRYPGT VINLNAT+FEFNPFEMGSWDP+LN+F +VKYLGTNV+NG P+ +G+
Sbjct: 259 FPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQ 318

Query: 325 CTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYSPNP 384
           C AGFDN GFI  TSSTLFNQFLLR+NST LPSFI  LA  FL+DLS + +DIA+Y+PNP
Sbjct: 319 CIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNP 378

Query: 385 FKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLA 444
           FK+  FL  + T+SI++S+ LFLVDGGED++N+P++PL+QKER++D+IFA+DNSAD    
Sbjct: 379 FKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDY 438

Query: 445 WPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPP 504
           WPDG+SLV+TY+RQF  QG  +SFPYVPD NTFVNLGLNKKPTFFGCDA NLTDL+YIPP
Sbjct: 439 WPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPP 498

Query: 505 LVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIR 564
           L+VY+PN+ +SFN NQS FK+SYS+S+R  MI+NGFE AT  NFTDD +F+GCVGCAIIR
Sbjct: 499 LIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIR 558

Query: 565 RKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVEKD 602
           RKQQ LN TLP EC  CF NYCWNGT+D+  +  V  D
Sbjct: 559 RKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGND 596

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/598 (65%), Positives = 490/598 (81%), Gaps = 19/598 (3%)

Query: 23  AANAWSPTDSYVPGTVSCP-DDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATA 81
            ++ +S  D Y P    CP DDINLVREA+ +SQNE+ WL++R+  T  AL +FL RAT+
Sbjct: 16  GSSGYSVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATS 75

Query: 82  NFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGG 141
           +  + +++  ++F+ G    +P+I +AVSGGGYRSMLTGAG+L+A DNRT GA +HGLGG
Sbjct: 76  SSQNFTQLFHRIFDAGM---VPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGG 132

Query: 142 LLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQND------------DSIWDLSDS 189
           +LQSTTY++G SGGNWLV +L+ NNWTSVQDIL+ M  D            D IWDLSDS
Sbjct: 133 ILQSTTYMTGCSGGNWLVASLSWNNWTSVQDILD-MNYDRKTARKQGKITKDPIWDLSDS 191

Query: 190 IVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTW 249
           IV+PGG+NI KTA+RWDHI+NAV++KQ A +NTSLAD+WGRAL+Y FFP+L RGGI  TW
Sbjct: 192 IVSPGGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTW 251

Query: 250 SSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKY 309
           SS+RD P+FQ  +MP PI+VADGRYPG+  I LNATVFEFNPFEMGSWDPSLN+F +VKY
Sbjct: 252 SSLRDSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKY 311

Query: 310 LGTNVSNGVPLER--GKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFL 367
           LGTNV+NG P+     KC  GFDN  FIMGTSS LFNQFLLRINSTHLP+F+T+ A + L
Sbjct: 312 LGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLL 371

Query: 368 KDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKER 427
           K  + +FND+AVY+PNPFKDT+++  +++TSIVDS+ L+LVDGGEDDENVP++PL+Q++R
Sbjct: 372 KSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDR 431

Query: 428 DVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPT 487
           D+DIIFA+DNSAD +L WPDGSSLVHTYERQFV QGQ ++FP++PDTNTF+NLGLNK+PT
Sbjct: 432 DLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPT 491

Query: 488 FFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNN 547
           FFGC+A N+T L+YIPPLVVY PN+EYSFNSNQSAFKLSYS  Q  +MI NGFEIATRNN
Sbjct: 492 FFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNN 551

Query: 548 FTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVEKDVHH 605
           FTDDPEF+GC+ CAI++RKQ+AL++ LP ECE C   YCW+GT+D TPL ++++DVHH
Sbjct: 552 FTDDPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQDVHH 609

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/593 (64%), Positives = 483/593 (81%), Gaps = 4/593 (0%)

Query: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTS 69
           ++  +  ++ F     AWSPT+SYVP  V+CP+DINL+R AT +SQ+E  WL+KR+  T 
Sbjct: 6   LVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNTR 65

Query: 70  VALKDFLTRATANF---SDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAA 126
            AL+ FL R T+NF   S +S ++ +LF+  NS N+PKI +A SGGGYR+ML+GAG+++A
Sbjct: 66  EALESFLKRVTSNFTSNSSASNLIDQLFST-NSSNIPKIGIAASGGGYRAMLSGAGMVSA 124

Query: 127 MDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDL 186
           MDNRT+GA EHGLGGLLQ+ TYL+G SGGNWL  TL+ NNWTSVQDI+++  ND +IWD+
Sbjct: 125 MDNRTDGANEHGLGGLLQAATYLAGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSAIWDI 184

Query: 187 SDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIG 246
           S SIV+PGGINIFKT  RWDHIS+AVE KQ A +N SLAD+WGRAL+Y FFP+L RGG+ 
Sbjct: 185 SHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVA 244

Query: 247 LTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFAN 306
             WS +R+  VF+NAEMP PISVADGRYPGT VI+LN+TVFE++PFE+GSWDPSL++F +
Sbjct: 245 YLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTD 304

Query: 307 VKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHF 366
           V+YLGT VS+G P E GKC AGFDN GF+MGTSSTLFNQFLLRIN T +P FI  LA HF
Sbjct: 305 VQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHF 364

Query: 367 LKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKE 426
           LKDLS+D++DIAVY+PNPF+D  +++++ + S+ +S+ LFLVDGGED +NVP++PLIQ+E
Sbjct: 365 LKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQE 424

Query: 427 RDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKP 486
           RD+DI+FA+DNSAD    WPDG+SL+HTY RQF  QGQG++FP VP T+TFVNLGLNKKP
Sbjct: 425 RDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKP 484

Query: 487 TFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRN 546
           TFFGCDA N+TDL+YIPPL+VY+PN+ +S+N N S FKLSYSE +R  +I+NGFE AT N
Sbjct: 485 TFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMN 544

Query: 547 NFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDV 599
           N T D  F GC+GCAI+RRKQQALN+TLP ECETCF NYCWNGT+D TP   V
Sbjct: 545 NLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGV 597

>Kwal_56.22510
          Length = 641

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/580 (65%), Positives = 470/580 (81%), Gaps = 7/580 (1%)

Query: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTS 69
           I+S + A    + A  AWSPTDSYVPG VSC DDINLVR+A+S+S NE+ WL+KR+  T 
Sbjct: 4   ILSLLLAA---ISAVQAWSPTDSYVPGNVSCADDINLVRKASSLSPNETEWLKKRDAYTK 60

Query: 70  VALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDN 129
            AL+ FL RAT+NFS+SS V     N   S  +P+IAVA SGGGYR+ML+GAG+L+AMDN
Sbjct: 61  EALRTFLDRATSNFSNSSLVD----NVWKSGKIPRIAVACSGGGYRAMLSGAGMLSAMDN 116

Query: 130 RTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDS 189
           RT GA EHGLGGLLQSTTYL+G SGGNWLVG+LA NNWTSVQ I++    DD +WD+S+S
Sbjct: 117 RTNGATEHGLGGLLQSTTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNS 176

Query: 190 IVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTW 249
           I+ PGG+NI  +A RWD IS+AVE+K +A +NTSLAD+WGRAL+Y+FFP+L +GG+G TW
Sbjct: 177 ILNPGGVNILTSANRWDQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTW 236

Query: 250 SSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKY 309
           S++RD  VF+N EMPFPISVADGRYPGT++I+LN+T+FEFNPFEMGSWDPSLN+F +VKY
Sbjct: 237 STLRDADVFKNGEMPFPISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKY 296

Query: 310 LGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKD 369
           LGT V NG P+ +G+C AGFDN GF+MGTSSTLFNQFLL++N+T + SF+    + FL+D
Sbjct: 297 LGTEVKNGTPVTQGQCVAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQD 356

Query: 370 LSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDV 429
           LS+D NDIA+Y+PNPF+DT ++D +YT  IV+S++LFLVDGGED EN+P++PLIQ++RDV
Sbjct: 357 LSEDSNDIAIYNPNPFRDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDRDV 416

Query: 430 DIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFF 489
           D+IFA+DNSAD    WP G SL+HTYERQF  QG+ ++FPYVPD +TFVN GLN KP FF
Sbjct: 417 DVIFALDNSADTDEYWPAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFF 476

Query: 490 GCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFT 549
           GCDA N +DL Y PPL+VY+PN   S+NSN S FK+SYS SQR  M QNGFE  TRNN T
Sbjct: 477 GCDATNTSDLAYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLT 536

Query: 550 DDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNG 589
           DD  FMGCV CA++RRKQ++ N+T P EC  CF+NYCW+G
Sbjct: 537 DDSNFMGCVACAVLRRKQESQNMTFPEECTKCFQNYCWDG 576

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/576 (66%), Positives = 465/576 (80%), Gaps = 11/576 (1%)

Query: 20  FLLA-ANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTR 78
           FLL+   AWSPT+SY PG V+C DDINLVREA  +S +ES WL+KR   T+ AL+DFL R
Sbjct: 9   FLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNR 68

Query: 79  ATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHG 138
           AT NF+D+S ++  LFN   S + P+I VA SGGGYR+ML+GAG+LAAMDNRT G+ EHG
Sbjct: 69  ATENFTDNS-IVKTLFN---SSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHG 124

Query: 139 LGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINI 198
           LGGLLQSTTYL+G SGGNWLVGTLA NNWTSVQ IL+ M  DD IWD+S+SI++PGG N+
Sbjct: 125 LGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPGGTNV 184

Query: 199 FKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVF 258
            +T  RWD IS+AV++KQ+A +N SL D+WGRAL+Y+FFP+L  GG   TWS++R+  VF
Sbjct: 185 LETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVF 244

Query: 259 QNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGV 318
           +NAEMPFPISVADGRYPGT+VINLNATVFEFNPFEMGSWD SL +F NVKYLGT V+NG 
Sbjct: 245 KNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGT 304

Query: 319 PLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINST------HLPSFITRLARHFLKDLSQ 372
           P  +G+C AGFDN GFIMGTSS+LFNQF L+ NST       LPS++ + A  FL  LS+
Sbjct: 305 PETKGQCIAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGLSK 364

Query: 373 DFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDII 432
           D++DIA+Y+PNPFK T ++  +YT SIV+S+ L+LVDGGED +N+P++PL+Q+ER++D+I
Sbjct: 365 DYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVI 424

Query: 433 FAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCD 492
           FA+DNSAD    WP+G SL  TYERQF KQG  ++FPYVPD +TFV LGLNK+PTFFGCD
Sbjct: 425 FALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCD 484

Query: 493 ANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDP 552
           A NLTDL YIPPLVVY+PN + SFNSNQS FKLSYS   RR+MI+NGFE  TRNN TDD 
Sbjct: 485 ATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDS 544

Query: 553 EFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWN 588
           +F+ CV CA+IRRKQQ++N TLP ECE CF NYCWN
Sbjct: 545 DFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/583 (61%), Positives = 463/583 (79%), Gaps = 2/583 (0%)

Query: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTS 69
           ++  + +++  L A NAWSPT+ Y PG V C ++INLVR+A ++S +E+ WL+ R++ T 
Sbjct: 9   LLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTV 68

Query: 70  VALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDN 129
            ALKDFL R    F++ + ++ KL      +  PK+A+A SGGGYR+ML+GAG+++AMDN
Sbjct: 69  PALKDFLQRGFKGFTNDTSIIDKLL--ATQDTAPKVAIACSGGGYRAMLSGAGMISAMDN 126

Query: 130 RTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDS 189
           RT+GA +HGLGGLLQS+TYL+G SGGNWLVGTLA NNWTSVQ I+NNM +D+SIWD+S+S
Sbjct: 127 RTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNS 186

Query: 190 IVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTW 249
           IV PGGINIF +  RWD IS+AVE K+ A +NTS+ D+WGRAL+YNFFPSL+ GG+G TW
Sbjct: 187 IVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTW 246

Query: 250 SSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKY 309
           +++RD  VF+N EMPFPISVA GRYPGT+V+NLNATVFEFNPFEMGSWD +L++F +V+Y
Sbjct: 247 NTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRY 306

Query: 310 LGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKD 369
            GTNV+NG P   GKC AGFDN GF+MGTSS+LFNQFLL++N+T LPSF+  L   FL D
Sbjct: 307 AGTNVTNGTPNVTGKCVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTD 366

Query: 370 LSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDV 429
            S D++DI++++PNPF +   + S+Y+ SI + D+L+LVDGGED +N+P+ PL+Q ER++
Sbjct: 367 ASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREI 426

Query: 430 DIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFF 489
           D+IFA+DNSAD   +WPDG SL  TY RQF  QG+G++FPYVPD NTF NLGLN +PTFF
Sbjct: 427 DVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFF 486

Query: 490 GCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFT 549
           GCDA NLTDL+ IPPLVVY+PN   SFNSN S FK+SYS S+R  MIQNGFE  T  N T
Sbjct: 487 GCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLT 546

Query: 550 DDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLD 592
            D  FMGC+ CAI+RRKQ++LN TLP EC+ CF+ YCWNGT+D
Sbjct: 547 KDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589

>Scas_685.3
          Length = 677

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/570 (64%), Positives = 460/570 (80%), Gaps = 6/570 (1%)

Query: 23  AANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATAN 82
           A  AWSP++ Y P  V+C DD+NL+REA+ +S++E  WL+KRN +T+ +LK FL R+T N
Sbjct: 16  AVQAWSPSNGYAPANVTCADDVNLLREASDLSKDEQDWLKKRNTITAESLKTFLDRSTKN 75

Query: 83  FSDSSE-VLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGG 141
           FSDSS  +L+KLF DG  +N+PKI +A SGGGYR+ML GAG+LAAMDNRT GA +HGLGG
Sbjct: 76  FSDSSSSLLNKLFQDG--DNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGG 133

Query: 142 LLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKT 201
           LLQS+TYL+G SGGNWL  TLA NNWTSVQDI++N+  ++SIWD+ +S+ +   I+    
Sbjct: 134 LLQSSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVENSIWDIDNSLFS---ISEMAN 190

Query: 202 AKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNA 261
           +  W  I+N V++KQ+A +N +LAD+WGRALAYNFFP L  GG G TWS++RD  VF+NA
Sbjct: 191 SSIWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRDSEVFKNA 250

Query: 262 EMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLE 321
           EMPFPI+VADGRYPGT VI+LNATVFEFNPFEMGSWDP+LNSF +VKYLGTNVSNG P++
Sbjct: 251 EMPFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGKPID 310

Query: 322 RGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYS 381
            G+C AGFDNAGF++GTS+TLFN   L   S+ LP  ++ L  +F   L+  +NDIA+YS
Sbjct: 311 AGQCVAGFDNAGFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADTYNDIAIYS 370

Query: 382 PNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADM 441
           PNPF+D   + S+++ +IVDSD LFLVDGGED E +P++PL+Q++R +D++FA+D ++D 
Sbjct: 371 PNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFALDFNSDT 430

Query: 442 RLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQY 501
             +WPDGSSLV TY+RQF  QG+GMSFPYVPDT TF+  GLN KPTFFGCDA NLTDL+Y
Sbjct: 431 TTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAKNLTDLEY 490

Query: 502 IPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCA 561
           IPPL+VY+PN+ YSFNSN S  +LSY+ SQR  MIQNGFE ATR NFTDDPEF+GC+GCA
Sbjct: 491 IPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEFLGCIGCA 550

Query: 562 IIRRKQQALNITLPPECETCFKNYCWNGTL 591
           I+RRKQQ+LN TLP ECE CF NYCWNGTL
Sbjct: 551 IMRRKQQSLNETLPSECEQCFTNYCWNGTL 580

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/585 (61%), Positives = 463/585 (79%), Gaps = 4/585 (0%)

Query: 17  ISQFLLAANAWSPT-DSYVPGTVSCP-DDINLVREATSISQNESAWLEKRNKVTSVALKD 74
           IS   LAA++ S T D Y P  + CP DD +LVR A+ +S  E+ WL+KR+  T  AL  
Sbjct: 13  ISGLSLAADSSSTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHS 72

Query: 75  FLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGA 134
           FL+RAT+NFSD+S +LS LF+  NS N+PKI +A SGGGYR+ML GAG++AAMDNRT+GA
Sbjct: 73  FLSRATSNFSDTS-LLSTLFSS-NSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGA 130

Query: 135 YEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPG 194
            EHGLGGLLQS+TYLSG SGGNWL GTLA NNWTSVQ+I+++M   DSIW+++ SIV PG
Sbjct: 131 NEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPG 190

Query: 195 GINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRD 254
           G N+  T +RW+ I   V++K +A +N SL+D+W RAL+YNFFPSL   G  LTWSS+RD
Sbjct: 191 GSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRD 250

Query: 255 FPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNV 314
             VF+N EMP PI+VADGRYPGT VINLNAT+FEF PFEMGSWDPSLN+F +VKYLGTNV
Sbjct: 251 VDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNV 310

Query: 315 SNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDF 374
           +NG P+ + +C +G+DNAGF++ TS++LFN+F L  +++     I   A  ++ +LSQD 
Sbjct: 311 TNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDD 370

Query: 375 NDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFA 434
           +DIA+Y+ NPFKDT+F+D +YT+SIVD+D LFLVDGGED +N+P++PLI+KERD+D++FA
Sbjct: 371 DDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFA 430

Query: 435 VDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDAN 494
           +D S +   +WP G  + +TYERQ+ KQG+GM+FPYVPD NTF+NLGL  KPTFFGCDA 
Sbjct: 431 LDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAK 490

Query: 495 NLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEF 554
           NLTDL+YIPPLVVY+PN ++SFN NQS  K++Y+ ++R  MI+NGFE AT  NFTDD  F
Sbjct: 491 NLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNF 550

Query: 555 MGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTPLPDV 599
           +GC+GCAIIRRKQ++LN TLPPEC  CF +YCWNGTL T+  P++
Sbjct: 551 LGCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPEL 595

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/565 (58%), Positives = 430/565 (76%), Gaps = 6/565 (1%)

Query: 32  SYVPGTVSCPDDINLVREAT-SISQNESAWLEKRNKVTSVALKDFLTRATANFSDSSEVL 90
           SY P  VSCPD+ N +R A   +S  E  WL+KR+ +T  AL+ FL RA AN S  +E+ 
Sbjct: 21  SYTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS--TEIT 78

Query: 91  SKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLS 150
           S LFND  +EN+PK+ +AV+GGGYR+M  GAG  AAMDNRT+GA EHGLGGLLQ+ TY++
Sbjct: 79  SALFND--TENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMA 136

Query: 151 GASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKTAKRWDHISN 210
           G SGGNWL GTLA NN+TSVQ IL      D+IW++++S + P   +  KT  RW  I +
Sbjct: 137 GLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGS 196

Query: 211 AVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISVA 270
            V+ K++A +N ++ D+W RALAY +FP+L   G GLTWSS+RD  +F N EMP PISVA
Sbjct: 197 QVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVA 256

Query: 271 DGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFD 330
           DGRYPGT VINLNATVFE  PFE+GSWDPSLN+F+++KYLGT V++G P E  +C  GFD
Sbjct: 257 DGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-ETERCINGFD 315

Query: 331 NAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYSPNPFKDTKF 390
           +A FIMGTSS+LFN+F +  +S    +++  L+   +K + ++ NDIA+Y+PNPFK +K+
Sbjct: 316 DASFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKY 375

Query: 391 LDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGSS 450
           +DS+YTTSIVDSDSLFLVDGGED + +P +PL+++ERD+DIIFA+D   +    +P G  
Sbjct: 376 VDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGP 435

Query: 451 LVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPPLVVYLP 510
           ++ TYERQF KQG+GM+FPYVPD  TFVNLGL  KP+F+GCDANNLTDL+YIPPL+VY+P
Sbjct: 436 MMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIP 495

Query: 511 NAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQAL 570
           N+ +SF SN S FKL+Y+ S+R  MI+N FE  TRNN T+D +++ CVGCAIIRRKQQ+L
Sbjct: 496 NSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSL 555

Query: 571 NITLPPECETCFKNYCWNGTLDTTP 595
           N+TLP  C+ CF NYCWNGT+D TP
Sbjct: 556 NLTLPDICDKCFTNYCWNGTIDNTP 580

>Scas_92.0d
          Length = 236

 Score =  302 bits (773), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 174/211 (82%)

Query: 243 GGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLN 302
           GG   TWS++R+  VF+NAEMPFPISVADGRYPGT+VINLNATVFEFNPFEMGSWD SL 
Sbjct: 19  GGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLR 78

Query: 303 SFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRL 362
           +F NVKYLGT V+NG P  +G+C AGFDN GFIMGTSS+LFNQFLL++N+T LPSFI +L
Sbjct: 79  AFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFLLQLNTTGLPSFIYKL 138

Query: 363 ARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPL 422
           A  FL  LS D++DIA+Y+PNPFK T  +  +YT SIV+S+ L+LVDGGED +N+P++PL
Sbjct: 139 ANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQNIPLVPL 198

Query: 423 IQKERDVDIIFAVDNSADMRLAWPDGSSLVH 453
           +Q+ER++D+IFA+DNSAD    WP+G    H
Sbjct: 199 LQEERELDVIFALDNSADTNQYWPNGFEFHH 229

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  221 bits (563), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/416 (35%), Positives = 206/416 (49%), Gaps = 53/416 (12%)

Query: 208 ISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPFPI 267
           + + V  K+   +  S  D WGRAL    +  +N   I           +  N E P PI
Sbjct: 195 LHSEVRPKKIMGFPVSFTDYWGRALWKKIY--VNESMISSMSELFARSEITNNYEAPLPI 252

Query: 268 SVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTA 327
            +A+      K  +L   VFEF PFE GSW+  L  F N+KYLG+N + GV      C  
Sbjct: 253 IIAN-----CKNEDLVNAVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGVA---QSCVQ 304

Query: 328 GFDNAGFIMGTSSTLFNQFLLRI------NSTHLPSFITRLARHF---LKDLSQDF---- 374
           GFD+ GFI  TSS+LFN  L+        +S      I  L   F   LK+    F    
Sbjct: 305 GFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNKPNSFFGTR 364

Query: 375 NDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFA 434
           +D A++ PNPF     +DS  T    +SD L+LVDGGED EN+P+ P +Q ER VD+IFA
Sbjct: 365 SDFALFQPNPFYRYPGVDSPLT----NSDKLYLVDGGEDGENIPLRPFLQPERQVDLIFA 420

Query: 435 VDNSADMRLAWPDGSSLVHTYERQFVKQGQGMS------------FPYVPDTNTFVNLGL 482
           +D+S+  R+ +P G  L + Y+      G                 PY+P    F   GL
Sbjct: 421 LDSSSG-RINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAKGL 479

Query: 483 NKKPTFFGC--------DANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRS 534
            K+P  FGC        +A+       +PP+V Y  N   ++NSN S FKL Y+ S+ + 
Sbjct: 480 LKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSEVQG 539

Query: 535 MIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQALNIT--LPPECETCFKNYCWN 588
           M++NG  + T +N T    +  CVGC +++R    +N +  LPP C+ CF+ YC+N
Sbjct: 540 MLENGASLFTHDNNT---AYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN 592

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 37/133 (27%)

Query: 117 MLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNN 176
           MLT +G L  M +R          GL    +Y++  SGG+W +  L L N+ +++++   
Sbjct: 1   MLTSSGFLLGMHSR----------GLFNCASYIASISGGSWTLMRLLLTNF-NIEELKE- 48

Query: 177 MQNDDSIWDLSDSIVTPGGINIFKTAKR-----WDHISNAVESK--------QNADYNTS 223
                  W+++ S++   G+  F+   R     ++  +N+ ES          + D+ + 
Sbjct: 49  -------WNINSSLLE--GVPNFEIKNRDIIQQFEATANSPESITHTSQEVFMDEDFYSE 99

Query: 224 LAD---IWGRALA 233
           L D   IW R+LA
Sbjct: 100 LQDQASIWKRSLA 112

>Kwal_0.173
          Length = 507

 Score =  212 bits (539), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 207/416 (49%), Gaps = 60/416 (14%)

Query: 212 VESKQNADYNTSLADIWGRALAYNFFPSLNRGGI-GLTWSSIRDFPVFQNAEMPFPISVA 270
           V+SK+ + +  S  D WG AL  +  P+   G I      S R    FQ  E+P PI VA
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSISAFADKSQR----FQRYEVPLPIFVA 168

Query: 271 DGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFD 330
           +      K  NL   VFEF PFE GSW  ++  F  ++YLG+ ++ G P    KC  GFD
Sbjct: 169 N-----CKNDNLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTP---QKCIIGFD 219

Query: 331 NAGFIMGTSSTLFNQFLLRINSTHLPSFITR-----------LARHFLKDLSQDFNDI-- 377
             GF+  TSS+LFN  L+ +     PS  TR           L  H    +S+   +I  
Sbjct: 220 EVGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANIMS 279

Query: 378 ----AVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIF 433
               A+Y PNPF    +     +  +   + L+LVDGGED EN+P+ PL+  ER +D+IF
Sbjct: 280 HPEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLDVIF 335

Query: 434 AVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPY-----VPDTNTFVNLGLNKKPTF 488
           A+D+S+D+  ++P+G+ L + Y+  +       + PY     +P +  FV   L  +P  
Sbjct: 336 ALDSSSDV-CSFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSRPVA 394

Query: 489 FGCDANNLTDLQ-----------YIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQ 537
           FGC   +   L             +PP+++Y  NA +SF SN S FKL YS+ +   M++
Sbjct: 395 FGCHMESYPTLNSTNWVRNSSHLELPPILIYHANANHSFASNLSTFKLKYSKIEVEQMLR 454

Query: 538 NGFEIATRNNFTDDPEFMGCVGCAIIRRKQQ-----ALNITLPPECETCFKNYCWN 588
           NG  I +   F D P++  C+ C +++R           + LP  C+ CF  YC+N
Sbjct: 455 NGKHIFS---FDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/433 (30%), Positives = 223/433 (51%), Gaps = 57/433 (13%)

Query: 197 NIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFP 256
           N  +T + + ++   V  K+   ++ S  D WGRAL       L+          + +  
Sbjct: 168 NFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCR 227

Query: 257 VFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSN 316
            F+  ++PFPI V++ +   +K +     VFEF PFE GSWD  LN F  +KYLG+ + +
Sbjct: 228 NFKEFKVPFPIIVSNCKNSPSKTV-----VFEFTPFEFGSWDEYLNEFIKLKYLGSKIVS 282

Query: 317 GVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRI-----NSTH-----LPSFITRLARHF 366
           G      +C  GFD+ GFI  TSS++FN  L+ +     NS+      + + ++      
Sbjct: 283 GKTF---RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLRL 339

Query: 367 LKDL-SQDFN-------DIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVP 418
           +KD+ ++D         D A+Y PNPF     ++++ T      + L+LVDGGE+ EN+P
Sbjct: 340 VKDMGAKDVPNNPLTRPDYALYRPNPFYKLLTVNNELTKE----NHLYLVDGGENGENIP 395

Query: 419 VLPLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTY------ERQFVKQGQGMS----- 467
           + PL+  +R +D+IFA+D+S+D    +P+G+ L + Y      +       +G++     
Sbjct: 396 IRPLLLPQRKLDVIFALDSSSDSN-NYPNGTILRNLYNNFHNGQESLNITREGITSNIDL 454

Query: 468 FPYVPDTNTFVNLGLNKKPTFFGCD----------ANNLTDLQYIPPLVVYLPNAEYSFN 517
            PY+P++ +FV   L  +P  FGC            N  T+   +PP+V+Y  N  +S++
Sbjct: 455 LPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSYS 514

Query: 518 SNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQALNIT--LP 575
           SN S FK SY+ S+   M++NG +I     F  +  +  C+GC II+R+      T  LP
Sbjct: 515 SNTSTFKQSYNSSEIEGMLRNGQDIF---GFDANNTYHKCLGCIIIKREYDRRQTTAELP 571

Query: 576 PECETCFKNYCWN 588
             C  C+++YC+N
Sbjct: 572 EFCHQCYQDYCFN 584

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 23/77 (29%)

Query: 117 MLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALN--NWTSVQDIL 174
           MLTG+G +  M+            GLL    Y+SG SGG+W++ +L L+  N+ S+Q   
Sbjct: 1   MLTGSGFITKMEEY----------GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQK-- 48

Query: 175 NNMQNDDSIWDLSDSIV 191
                    W L DS++
Sbjct: 49  ---------WKLDDSLL 56

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  179 bits (454), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 138/455 (30%), Positives = 215/455 (47%), Gaps = 55/455 (12%)

Query: 170 VQDILNNMQND-DSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIW 228
           V+D  +  +ND D   ++ + ++   G    K    + ++   V  K+ A +  SL D  
Sbjct: 245 VEDFFHQEENDQDKELEVINELMDSFG-KFRKIIGFYINLHRQVRQKKEAGFPISLTDYL 303

Query: 229 GRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFE 288
           G+AL  +  P+  +  +    S+      F+  + P P+ VA+ +   +K   L+  VFE
Sbjct: 304 GQALL-DRLPAQKQDHLK-QLSNFVQSESFKKFDAPIPVFVANAK--TSKGPELHNVVFE 359

Query: 289 FNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLL 348
           F PFE GSW  +++ F + KYLG+    G   +  KC  GFDN GFI  TSS+LFN  L 
Sbjct: 360 FTPFEFGSWHLNVSKFISTKYLGSTALKG---KLTKCVNGFDNLGFITATSSSLFNNALF 416

Query: 349 RINSTHLPSFITRLARHFLKDLSQDF--------NDIAVYSPNPFKDTKFLDSDYTTSIV 400
            I  T   +  +      +K +   F        +D A+Y PNPF    + D +    I 
Sbjct: 417 YIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAIRSDYAIYQPNPF----YKDPEVLNLIS 472

Query: 401 DSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFV 460
           D+  LFLVDGGED EN+P+  L    R  D+IF VD+S+D +   PD + L  TY+    
Sbjct: 473 DTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIVDSSSD-KENLPDMTKLRDTYDDIIH 531

Query: 461 KQGQGMS------------FPYVPDTNTFV--NLGLNKKPTFFGC-----DANNLTDLQY 501
            + Q                PY+P +   +  N  L+  P  FGC     +   LTD   
Sbjct: 532 VEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFSLS-TPIAFGCHLQSYNTKRLTDTLI 590

Query: 502 --------IPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPE 553
                   +PP+++Y  N   +F SN S FKL+Y++ +   M+ NG  +   NN     E
Sbjct: 591 TKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYNGMLNNGHHLF--NNDDTQGE 648

Query: 554 FMGCVGCAIIRRKQQALNITLPPECETCFKNYCWN 588
           ++ C+GC ++ R+ Q L   +   C+ C +  C+N
Sbjct: 649 YLQCLGCVMLLRQNQEL---VSSFCDACIRKVCYN 680

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 63/133 (47%), Gaps = 22/133 (16%)

Query: 33  YVPGTVSCPDDINL-VREATSISQNESAWLEKRNKVTSVALKDFLTRATANFSDSSEVLS 91
           Y P  V CP D++L   +   +S  E  +L KR +V               F    E L+
Sbjct: 21  YAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTEVIK-----------GKFEKFYEDLA 69

Query: 92  KLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSG 151
               + +S   P+IAVA+SGGG+RSML  +G +  M             GL + T+Y++G
Sbjct: 70  IPGINVDSLQFPRIAVAISGGGFRSMLISSGFVLGMQQH----------GLWECTSYVAG 119

Query: 152 ASGGNWLVGTLAL 164
            SGG+W +  L L
Sbjct: 120 ISGGSWTLLKLVL 132

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  175 bits (443), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 132/426 (30%), Positives = 207/426 (48%), Gaps = 62/426 (14%)

Query: 192 TPGGINIFKTA-KRWDHISNAVESKQNADYNTSLADIWGRA----LAYNFF--PSLNRGG 244
           T   I  FK     +  +   ++ K+   +  S  D WG+A    L  NF   P+ +   
Sbjct: 239 TDAKIETFKKVLDFYKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSF 298

Query: 245 IGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSF 304
             L  SS +    F+   +P PI VA+      K   L+  +FEF PFE GSW+  L  F
Sbjct: 299 SKLVNSSKK----FKECSVPIPIFVAN-----CKNGLLSNVIFEFTPFEFGSWENILRLF 349

Query: 305 ANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLAR 364
             + YLG+ + +G   +  KC   FD+ GFI  TSS++FN  L+ I   +L S  +R A 
Sbjct: 350 VKLPYLGSKIVSG---KAEKCINNFDDLGFITATSSSIFNNVLIFI--WNLASQSSREAM 404

Query: 365 HFL------------------KDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLF 406
             L                  KD S+   D AVY PNPF    +L  +    + + + L+
Sbjct: 405 KALNMVMGIFGLGKEEIFSISKDSSRLETDYAVYQPNPF----YLYPEKDNVLTNKNHLY 460

Query: 407 LVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGM 466
           LVDGGED EN+P+  L+  ER++D+IF +D+S+D+   +P+GS L   +E+      + +
Sbjct: 461 LVDGGEDGENIPLRTLVIPERELDVIFVLDSSSDID-NYPNGSKLKRIFEKL---DEENV 516

Query: 467 SFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLS 526
            + +  +  TF +      P   GC+A   T      P+++Y  NA +   SN S FK++
Sbjct: 517 HYQFPNNVKTFTH------PIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKIT 570

Query: 527 YSESQRRSMIQNGFEIATRNNFTDDPE--FMGCVGCAIIRRKQQAL--NITLPPECETCF 582
           Y++S+  SM+  G     R  F++D +  +  C+GC + +R    L       P C  CF
Sbjct: 571 YNQSEVSSMLPTG-----RGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCF 625

Query: 583 KNYCWN 588
           K+YC++
Sbjct: 626 KDYCYS 631

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 81/159 (50%), Gaps = 28/159 (17%)

Query: 35  PGTVSCPDDINLVREAT-SISQNESAWLEKRNKVTSVALKDFLTRAT-ANFSDSSEVLSK 92
           P  V CP    L+REA   +   E+ +L+K+   T   L  FL   T A FS  S+   +
Sbjct: 20  PFQVQCPSS-PLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFS--SKFYKR 76

Query: 93  LFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGA 152
           +  D      PKI +A+SGGGYRSML G G ++ M++           GL + + Y++G 
Sbjct: 77  VLKDP-----PKIGIAISGGGYRSMLVGTGFISQMNDY----------GLFEYSDYIAGL 121

Query: 153 SGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIV 191
           SGG+W++  L + N+  V+ +L         WDL + ++
Sbjct: 122 SGGSWILMDLVVQNF-EVKSLLQE-------WDLEEDLL 152

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 197/398 (49%), Gaps = 51/398 (12%)

Query: 212 VESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWS-SIRDFPVFQNAEMPFPISVA 270
           + SK+   +  S  D W +AL  N      +    LT+S S+R    F+N  +P PI VA
Sbjct: 143 IRSKRINGFPISFTDYWAQALVQNI--KYRQLPTHLTYSKSVRTSNYFKNYLVPIPIIVA 200

Query: 271 DGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFD 330
           + R    K +     +FEF P+E GSW+  L  F N++YLG+ + NGV     +C  G D
Sbjct: 201 NCRNGFLKNV-----IFEFTPWEFGSWEQVLGLFVNIEYLGSRIINGV---SHQCYKGLD 252

Query: 331 NAGFIMGTSSTLFNQFLLRI-------NSTHLPSFITRLA---------RHFLKDLSQDF 374
           + GFI  TSS++FN  L+ +       +   + +  T LA            L+  SQ  
Sbjct: 253 DLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSSQIT 312

Query: 375 ----NDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVD 430
                D AVY  NPF    +  S+    +  +D L+LVDGGED EN+P+  L+   R+VD
Sbjct: 313 AALDTDYAVYRHNPF----YKYSNIKNELAQNDYLYLVDGGEDGENIPIRTLV--PRNVD 366

Query: 431 IIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFG 490
           +I  +D+S+D +  + +G  L     +   K+G    +P    T+        K+PT  G
Sbjct: 367 MIMIMDSSSDKK-NYANGDKLKIVLNQMKEKEGIYYRYPTKIVTS-------QKRPTIIG 418

Query: 491 CDANNLTDLQYIPPLVVYLPNAEYSFN--SNQSAFKLSYSESQRRSMIQNGFEIATRNNF 548
           C     +D + + P++VY PN+E S    +N S FK+ Y+  +++ +I +G+ + T +  
Sbjct: 419 CKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVTGHG- 476

Query: 549 TDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYC 586
             + ++  C+ C +++R     +I  P +C  C+  YC
Sbjct: 477 --EHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 19/78 (24%)

Query: 117 MLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNN 176
           ML   G L  +D            GL   + Y++G SGG+W V  L +N +   + I   
Sbjct: 1   MLLSTGFLRGLDAM----------GLYHYSDYIAGISGGSWSVMDLVVNKFQLGKLI--- 47

Query: 177 MQNDDSIWDLSDSIVTPG 194
                S WDLS S++ PG
Sbjct: 48  -----SGWDLSTSML-PG 59

>Scas_695.10
          Length = 553

 Score =  162 bits (409), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 185/378 (48%), Gaps = 55/378 (14%)

Query: 212 VESKQNADYNTSLADIWGRALAY---NFFPSLNRGGIGLTWSSIRDFPV-FQNAEMPFPI 267
           V +K+   +  S  D WG AL     N     +     +++S + +  + F   E P PI
Sbjct: 184 VRTKKIQGFFVSFTDYWGEALLKRLNNKDKKFSAFANTVSFSKLIESNLKFSKFEAPIPI 243

Query: 268 SVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTA 327
            VA+ R        L   +FEF+PFE GSW+  L  F  + YLG+ + NG       C  
Sbjct: 244 FVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNGTA---KICYK 295

Query: 328 GFDNAGFIMGTSSTLFNQFLL----RINSTHLPSFITRLARHFL------KDLSQDFN-- 375
            FD+ GFI  TSS++FN  L+    +++ + L +  +  A   L      KD ++     
Sbjct: 296 EFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKPLTLS 355

Query: 376 --------DIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKER 427
                   D AVY  NPF    F   +   ++   D L+LVDGGED EN+P+  LI  ER
Sbjct: 356 NTAIAPETDYAVYYHNPF----FRYPNIDNALTKDDHLYLVDGGEDGENIPLRSLIIPER 411

Query: 428 DVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPT 487
            VD+IFA+D+S+D+   + +G+ L+ T  R   K G     P +              P 
Sbjct: 412 KVDVIFAIDSSSDVN-NYANGTKLI-TILRHLEKLGYHYKIPKISKKRI-------NHPL 462

Query: 488 FFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNN 547
            FGC+A +L       P+++Y  N E+S+ SN S FK++Y+E++  +M+QNG +I   N 
Sbjct: 463 IFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNGMDIFNDN- 514

Query: 548 FTDDPEFMGCVGCAIIRR 565
             ++  +  C+GC + +R
Sbjct: 515 --ENIYYQNCLGCILSKR 530

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 18/91 (19%)

Query: 101 NLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVG 160
           N P I VA+SGGGYRSMLTG G +  M  +          GL    +YLSG SGG+W++ 
Sbjct: 7   NPPNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVLM 56

Query: 161 TLALNNWTSVQDILNNMQNDDSIWDLSDSIV 191
            L +NN+ ++  ++NN       WDL++ ++
Sbjct: 57  DLIVNNF-NITKMINN-------WDLTEGLL 79

>KLLA0B02068g complement(179493..182996) similar to sgd|S0006138
           Saccharomyces cerevisiae YPL217c BMS1, start by
           similarity
          Length = 1167

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 257 VFQNAEMPFPISVADGRYPGTKVINLNA--TVFEFNPFEMGSWDPSL--NSFANVKYLGT 312
           V+Q A++ +   V +GRYP  +++NL+   +V +F P +  +  P L  +  +++ +   
Sbjct: 198 VYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLQWRNEHPYLLADRISDLTHPEL 257

Query: 313 NVSNGVPLERGKCTAGF 329
             S G+ ++R     G+
Sbjct: 258 LQSKGMHIDRKVAIYGY 274

>YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein
           involved rRNA processing and 40S ribosomal subunit
           biogenesis, contains a GTP-binding domain, and interacts
           genetically with BMH1 [3552 bp, 1183 aa]
          Length = 1183

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 257 VFQNAEMPFPISVADGRYPGTKVINLNA--TVFEFNPFEMGSWDPSL--NSFANVKYLGT 312
           V+Q A++ +   V +GRYP  +++NL+   +V +F P +  +  P +  + F ++ +   
Sbjct: 198 VYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYMLADRFTDLTHPEL 257

Query: 313 NVSNGVPLERGKCTAGF 329
             + G+ ++R     G+
Sbjct: 258 IETQGLQIDRKVAIYGY 274

>Scas_690.1*
          Length = 636

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 257 VFQNAEMPFPISVADGRYPGTKVINLNA--TVFEFNPFEMGSWDPSL 301
           V+Q A++ +   V +GRYP  +++NL+   +V +F P +  +  P L
Sbjct: 198 VYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYL 244

>AFL113C [3082] [Homologous to ScYPL217C (BMS1) - SH]
           (223522..227013) [3492 bp, 1163 aa]
          Length = 1163

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 257 VFQNAEMPFPISVADGRYPGTKVINLNA--TVFEFNPFEMGSWDPSL 301
           V+Q A++ +   V +GRYP  +++NL+   +V +F P +  +  P L
Sbjct: 198 VYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYL 244

>Kwal_56.24139
          Length = 463

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 257 VFQNAEMPFPISVADGRYPGTKVINLNA--TVFEFNPFEMGSWDPSL 301
           V+Q A++ +   V +GRYP  +++NL+   +V +F P +  +  P L
Sbjct: 198 VYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYL 244

>Scas_707.3
          Length = 1598

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 23/123 (18%)

Query: 369 DLSQDFNDIAVYSPNP------FKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPL 422
           +L+Q+ ND AV +  P      F DT +  S  TTS + +   + +D  +DDE+  +  L
Sbjct: 328 NLTQNTNDGAVTNQFPSLPTENFTDTFYQFSPRTTSNIQNIQTWKLDFPKDDEDPGLSLL 387

Query: 423 IQK-----ERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQ---------GQGMSF 468
           I       +R VD +  +DN+    L   +    V+ Y  Q +++            M F
Sbjct: 388 IHDTIDLAKRKVDAVLRLDNAMTYSLKIQNE---VNNYVLQLIREQIENNRISISHTMDF 444

Query: 469 PYV 471
           PYV
Sbjct: 445 PYV 447

>Sklu_2418.4 YJR111C, Contig c2418 8325-9146 reverse complement
          Length = 273

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%)

Query: 203 KRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGI 245
           K W HI + V  K   + N+S  D+W   +++ + P L+  G+
Sbjct: 166 KHWSHIYSKVSEKVINNLNSSYPDLWYYTISHVYGPLLSFDGV 208

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,479,667
Number of extensions: 1032671
Number of successful extensions: 2648
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2686
Number of HSP's successfully gapped: 40
Length of query: 674
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 566
Effective length of database: 12,857,365
Effective search space: 7277268590
Effective search space used: 7277268590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)