Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOL010W (RCL1)36736119030.0
CAGL0E02343g36435516210.0
Sklu_2419.236736016160.0
Scas_644.936435915800.0
KLLA0C05984g36435915650.0
Kwal_56.2250236435815400.0
ACL015W36235514990.0
Kwal_56.2320127989850.013
KLLA0F21032g29788830.020
CAGL0L06732g28888740.26
Kwal_26.702495487750.29
CAGL0E05390g95688720.66
Scas_633.128781636.4
YBR146W (MRPS9)27853619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL010W
         (361 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required fo...   737   0.0  
CAGL0E02343g 225099..226193 highly similar to sp|Q08096 Saccharo...   629   0.0  
Sklu_2419.2 YOL010W, Contig c2419 2010-3113                           627   0.0  
Scas_644.9                                                            613   0.0  
KLLA0C05984g 528906..530000 highly similar to sp|Q08096 Saccharo...   607   0.0  
Kwal_56.22502                                                         597   0.0  
ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH] complement(...   582   0.0  
Kwal_56.23201                                                          37   0.013
KLLA0F21032g 1964630..1965523 highly similar to sp|Q9P4C1 Kluyve...    37   0.020
CAGL0L06732g complement(757868..758734) similar to sp|P38120 Sac...    33   0.26 
Kwal_26.7024                                                           33   0.29 
CAGL0E05390g complement(524480..527350) highly similar to sp|P40...    32   0.66 
Scas_633.1                                                             29   6.4  
YBR146W (MRPS9) [331] chr2 (535216..536052) Mitochondrial riboso...    28   9.9  

>YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required for
           pre-rRNA processing at cleavage sites A0, A1 and A2, has
           similarity to RNA 3'-terminal phosphate cyclase,
           interacts with Bms1p [1104 bp, 367 aa]
          Length = 367

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/361 (100%), Positives = 361/361 (100%)

Query: 1   MSSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVT 60
           MSSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVT
Sbjct: 1   MSSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVT 60

Query: 61  NGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKG 120
           NGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKG
Sbjct: 61  NGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKG 120

Query: 121 ITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITM 180
           ITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITM
Sbjct: 121 ITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITM 180

Query: 181 HEIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPG 240
           HEIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPG
Sbjct: 181 HEIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPG 240

Query: 241 WGITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVY 300
           WGITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVY
Sbjct: 241 WGITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVY 300

Query: 301 MVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT 360
           MVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT
Sbjct: 301 MVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT 360

Query: 361 N 361
           N
Sbjct: 361 N 361

>CAGL0E02343g 225099..226193 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1, start by
           similarity
          Length = 364

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/355 (84%), Positives = 330/355 (92%)

Query: 7   KYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGSVIE 66
           +Y  FQG +NFR RI+ ATLSGKPIKIEKIRS DLNPGL+D+EVSFLRL+E+VTNGSVIE
Sbjct: 4   QYVVFQGPENFRHRIIFATLSGKPIKIEKIRSQDLNPGLRDHEVSFLRLMEAVTNGSVIE 63

Query: 67  ISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITASHN 126
           ISYTGTTVIYRPGII+GG  TH CP SKPVGYFVEPMLYLAPFSKKKFSI+FKGITASHN
Sbjct: 64  ISYTGTTVIYRPGIIIGGPYTHTCPPSKPVGYFVEPMLYLAPFSKKKFSIVFKGITASHN 123

Query: 127 DAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEIDRP 186
           DAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPP GGGEVHLVVDSLIAQPITMHE+DRP
Sbjct: 124 DAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPQGGGEVHLVVDSLIAQPITMHELDRP 183

Query: 187 IISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGITLV 246
           +ISSI GVAYSTRVSPS+VNRMIDGAK+VLKN++CEVNITADVWRGENSGKSPGWGIT+V
Sbjct: 184 VISSIRGVAYSTRVSPSMVNRMIDGAKQVLKNVKCEVNITADVWRGENSGKSPGWGITIV 243

Query: 247 AQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKE 306
           A++K+KGW YFAE+IG +G IPEE+G KVA +L+EEISKSAAV RNQLPLAI YMVIGKE
Sbjct: 244 AETKKKGWCYFAEEIGGSGDIPEEIGSKVAYKLIEEISKSAAVDRNQLPLAITYMVIGKE 303

Query: 307 DIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361
           DIGRLRI +EQ+DERFI +LRDIKKIF TEVFLKPVD+  ++D IAT+KGIGFTN
Sbjct: 304 DIGRLRITREQVDERFIQMLRDIKKIFGTEVFLKPVDDIGSDDFIATVKGIGFTN 358

>Sklu_2419.2 YOL010W, Contig c2419 2010-3113
          Length = 367

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/360 (82%), Positives = 333/360 (92%), Gaps = 1/360 (0%)

Query: 2   SSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTN 61
           S+++ +YT FQG++NFRLRI+LATLSGK IK+EKIRS DLNPGLKDYEVSFLRL+E+VTN
Sbjct: 3   SANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTN 62

Query: 62  GSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGI 121
           GS IEISYTGTTVIY+PGII+GG+ TH CPSSKPVGYFVEPMLYLAPFSKKKFSILF+GI
Sbjct: 63  GSAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGI 122

Query: 122 TASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 181
           TASHNDAGIEAIKWG++PVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH
Sbjct: 123 TASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 182

Query: 182 EIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGW 241
            +D P+ISSI GV+YSTRVSPS+VNRMIDGAK VLKN+ CEVNITADVWRG+NSGKSPGW
Sbjct: 183 ALDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGW 242

Query: 242 GITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYM 301
           GITLVA++K KGW YF+E IGDAG +PE++G KVA QLLEEISKS  VGR QLPLAI YM
Sbjct: 243 GITLVAENK-KGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYM 301

Query: 302 VIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361
           VIGKEDIGRLRI KEQIDE+FI LLRDIK++F TEV+LKP DE D++D+IATIKGIGFTN
Sbjct: 302 VIGKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTN 361

>Scas_644.9
          Length = 364

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/359 (83%), Positives = 327/359 (91%), Gaps = 2/359 (0%)

Query: 3   SSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNG 62
           SS P Y TFQGSQNFRLRI+L+TLSGK IKIEKIRS DLNPGLKDYEVSFLRL+ESVTNG
Sbjct: 2   SSKP-YITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60

Query: 63  SVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGIT 122
           SVIEISYTGTT++YRPGII GGA TH CP SKPVGYFVEPMLYLAPFSKKKFSI+FKGIT
Sbjct: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPFSKKKFSIIFKGIT 120

Query: 123 ASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHE 182
           ASH+DAGIEAIKWGL+P++EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMHE
Sbjct: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180

Query: 183 IDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWG 242
           ++RP I+++ GVAYSTRVSPS+VNRMID AKKVL  L C V ITADVWRGENSGKSPGWG
Sbjct: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240

Query: 243 ITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMV 302
           ITLVAQSK KGW YF+E IGDAG +PE++G+ VA +LLEEIS SAAVGRNQL LAIVYMV
Sbjct: 241 ITLVAQSK-KGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMV 299

Query: 303 IGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361
           IGKEDIGRLRI K+QIDE FI LLRDIKK+F TEVFLKPVD+ +++DMIATIKG+GFTN
Sbjct: 300 IGKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTN 358

>KLLA0C05984g 528906..530000 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1 singleton, start
           by similarity
          Length = 364

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/359 (80%), Positives = 326/359 (90%), Gaps = 2/359 (0%)

Query: 3   SSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNG 62
           SS+ +Y TF+GS+NFRLR+V+ATLSGK IKIEKIRS DLNPGLKDYEVSFLRL+E+VTNG
Sbjct: 2   SSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNG 61

Query: 63  SVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGIT 122
           S IEISYTGTTVI+RPGII GG+ TH CP+SKPVGYF EPMLYLAPFSKKKFSILF+GIT
Sbjct: 62  SSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGIT 121

Query: 123 ASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHE 182
           +SHNDAGI+AIKWGLMP+MEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 
Sbjct: 122 SSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA 181

Query: 183 IDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWG 242
           +D+ +ISSI GV+YSTRVSPSLVNRMIDGAKKVLK+  CEVNITADVWRGENSGKSPGWG
Sbjct: 182 LDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWG 241

Query: 243 ITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMV 302
           +TLVA++KQ GW  F+E IGDAG +PE++G  VA  LLEEISKS  VGRNQLPL I+YM+
Sbjct: 242 LTLVAENKQ-GWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMI 300

Query: 303 IGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361
           IGKEDIGRLRI K+QIDERF+ LLRDIKK+F TE+ LKPVD+ +  D+IATIKGIGFTN
Sbjct: 301 IGKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTN 358

>Kwal_56.22502
          Length = 364

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/358 (79%), Positives = 326/358 (91%), Gaps = 1/358 (0%)

Query: 4   SAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGS 63
           S+ +  +FQG +NFRL IVLATLSGKPIKIEKIRS DLNPGL+D+EVSFLRL+E+VTNGS
Sbjct: 2   SSMRINSFQGVRNFRLLIVLATLSGKPIKIEKIRSDDLNPGLRDHEVSFLRLMEAVTNGS 61

Query: 64  VIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITA 123
            IEISYTGTTVIY+PGII+GG+ TH CP  KPVGY+VEPMLYLAPFSKKKFSI+F+G+TA
Sbjct: 62  TIEISYTGTTVIYKPGIIIGGSYTHNCPPGKPVGYYVEPMLYLAPFSKKKFSIIFRGVTA 121

Query: 124 SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEI 183
           SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMH +
Sbjct: 122 SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL 181

Query: 184 DRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGI 243
           D P I+SI GVAYSTRVSPS+VNRMI+GA+ VLKN+ CEV+ITADVWRGENSGKSPGWGI
Sbjct: 182 DTPQIASIRGVAYSTRVSPSMVNRMIEGARNVLKNVGCEVDITADVWRGENSGKSPGWGI 241

Query: 244 TLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMVI 303
           TLVA++K KGW YF+E IG AG +PE++G ++A +LLEEIS SA VGRNQL LAI+YMVI
Sbjct: 242 TLVAETK-KGWKYFSEGIGGAGDVPEDIGAQIAYELLEEISTSAVVGRNQLALAIIYMVI 300

Query: 304 GKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361
           GKEDIGRLRI K QIDE+FI LLR IK+IF TEVFLKPVD+AD++D+IAT+KGIGF+N
Sbjct: 301 GKEDIGRLRITKAQIDEKFIWLLRHIKQIFGTEVFLKPVDDADSDDLIATVKGIGFSN 358

>ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH]
           complement(332683..333771) [1089 bp, 362 aa]
          Length = 362

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 315/355 (88%), Gaps = 2/355 (0%)

Query: 7   KYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGSVIE 66
           KY TF+G+ NFR RIV+ATLSGK +KIEKIRS D+NPGL+D+EVSFLRLIE+VTNGSVIE
Sbjct: 4   KYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGSVIE 63

Query: 67  ISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITASHN 126
           ISYTGTTVIYRPGIIVGG+ TH CP+ K VGY+VEP+LYLAPFSKKKFSI+ +G+T++H 
Sbjct: 64  ISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTSTHQ 123

Query: 127 DAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEIDRP 186
           DAGIEAIKWGLMPVMEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMH ++RP
Sbjct: 124 DAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHALERP 183

Query: 187 IISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGITLV 246
           +IS+I GVAYSTRVSPS+VNRMIDGAK VLK + CE NITADVWRG NSGKSPGWGITLV
Sbjct: 184 LISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGITLV 243

Query: 247 AQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKE 306
           A++K KGW YF E IGDAG +PE++G K A  LLEEIS+SA V R+QLPLAIVYMVIGKE
Sbjct: 244 AETK-KGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIGKE 302

Query: 307 DIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361
           DIGRLRI + Q+DE  ++LLRDIK++F TE  LKP D+ D +D+I TIKGIGFTN
Sbjct: 303 DIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFTN 356

>Kwal_56.23201
          Length = 279

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 272 GEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFIILLRDIKK 331
             +V+ + L+E  +S AVGR +   A VY+V G    G + +N  Q+++ F+     +K 
Sbjct: 141 ASQVSLKTLDEFGRSVAVGRRKTSTAKVYLVRG---TGEILVNGRQLNDYFV----KMKD 193

Query: 332 IFNTEVFLKPVDEADNEDMIATIKGIGFT 360
             +    L+ VD     ++ AT  G G T
Sbjct: 194 RESVAYPLRVVDSIGKYNVFATTSGGGIT 222

>KLLA0F21032g 1964630..1965523 highly similar to sp|Q9P4C1
           Kluyveromyces marxianus 40S ribosomal protein S9,
           mitochondrial precursor, start by similarity
          Length = 297

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 273 EKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFIILLRDIKKI 332
           ++   + L+E  +S A+GR +   A VY+V G+   G++ +N  Q+++ F+  ++D + +
Sbjct: 160 QRDTLKQLDEFGRSLAIGRRKTSTAKVYVVRGE---GKILVNDRQLNDYFVK-MKDRESV 215

Query: 333 FNTEVFLKPVDEADNEDMIATIKGIGFT 360
                 LK +D     ++ A + G G T
Sbjct: 216 MYP---LKAIDSVGKYNVFAMVSGGGIT 240

>CAGL0L06732g complement(757868..758734) similar to sp|P38120
           Saccharomyces cerevisiae YBR146w MRPS9, hypothetical
           start
          Length = 288

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 273 EKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFIILLRDIKKI 332
           +K   + L+E  +S A+G+ +   A VY+V G+   G++ +N  Q+++ F + ++D + I
Sbjct: 151 QKTQQKELDEFGRSVAIGKRKAATAKVYLVRGE---GKILVNGRQLNDYF-LKMKDRESI 206

Query: 333 FNTEVFLKPVDEADNEDMIATIKGIGFT 360
                 L+ VD     ++ AT +G G T
Sbjct: 207 AYP---LQVVDSLGKYNVFATCRGGGPT 231

>Kwal_26.7024
          Length = 954

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 18/87 (20%)

Query: 270 ELGEKVACQLLEEISKSAAVGRNQLPLA------------IVYMVIGKEDIGRLR-INKE 316
           E+G++  C    EI      GRN   L             +V+M   +E  G+LR +  +
Sbjct: 181 EMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPDVLEVWNVVFMQYNREQNGKLRPLPSK 240

Query: 317 QID-----ERFIILLRDIKKIFNTEVF 338
            +D     ER + +L+D++  ++T+VF
Sbjct: 241 HVDTGMGFERLVSVLQDVRSNYDTDVF 267

>CAGL0E05390g complement(524480..527350) highly similar to sp|P40825
           Saccharomyces cerevisiae YOR335c ALA1 alanyl-tRNA
           synthetase, start by similarity
          Length = 956

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 18/88 (20%)

Query: 270 ELGEKVACQLLEEISKSAAVGRNQLPLA------------IVYMVIGKEDIGRLR-INKE 316
           E+G++  C    EI      GRN   L             +V+M   +E  G L+ +  +
Sbjct: 181 EMGDQGPCGPCSEIHYDRIGGRNAASLVNQDDPDVLEVWNLVFMQFNREQDGSLKSLPAK 240

Query: 317 QID-----ERFIILLRDIKKIFNTEVFL 339
            ID     ER + +L+D++  ++T+VF+
Sbjct: 241 HIDTGMGFERLVSVLQDVRSNYDTDVFM 268

>Scas_633.1
          Length = 287

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 280 LEEISKSAAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFL 339
           L+E  +S AVG  +   A VY+V G    G + +N  Q+++ F + L+D   I      L
Sbjct: 157 LDEFGRSVAVGHRKSAAAKVYVVRG---TGEILVNGRQLNDYF-LKLKDRDSIMYP---L 209

Query: 340 KPVDEADNEDMIATIKGIGFT 360
           + ++   + ++ AT  G G T
Sbjct: 210 RVLNAVGDYNIFATTSGGGST 230

>YBR146W (MRPS9) [331] chr2 (535216..536052) Mitochondrial ribosomal
           protein of the small subunit S9, member of prokaryotic
           ribosomal protein S9 family [837 bp, 278 aa]
          Length = 278

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 271 LGEKVACQLLEEISKSAAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFI 323
           L   +  + L+E  +S AVG+ +   A V++V G    G + +N  Q+++ F+
Sbjct: 139 LSNNIKIKTLDEFGRSIAVGKRKSSTAKVFVVRG---TGEILVNGRQLNDYFL 188

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,529,018
Number of extensions: 493369
Number of successful extensions: 1081
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1082
Number of HSP's successfully gapped: 18
Length of query: 361
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 258
Effective length of database: 13,030,455
Effective search space: 3361857390
Effective search space used: 3361857390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)