Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOL006C (TOP1)76961432820.0
Scas_644.1475361427970.0
Sklu_2419.874261427030.0
Kwal_56.2248476061426640.0
CAGL0J11660g74461426270.0
KLLA0C06116g78561425950.0
CAGL0E02431g71761425780.0
ACL008C73261425280.0
KLLA0F04609g916138750.71
Kwal_56.238251396154750.89
KLLA0C03322g38585711.8
Scas_670.1143281693.1
AGR089C1370102685.4
Kwal_14.133849544667.6
YOR269W (PAC1)49467668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOL006C
         (755 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOL006C (TOP1) [4810] chr15 complement(313078..315387) DNA topoi...  1268   0.0  
Scas_644.14                                                          1082   0.0  
Sklu_2419.8 YOL006C, Contig c2419 11000-13228 reverse complement     1045   0.0  
Kwal_56.22484                                                        1030   0.0  
CAGL0J11660g 1133494..1135728 highly similar to sp|P04786 Saccha...  1016   0.0  
KLLA0C06116g complement(536524..538881) similar to sp|P04786 Sac...  1004   0.0  
CAGL0E02431g complement(230559..232712) highly similar to sp|P04...   997   0.0  
ACL008C [1041] [Homologous to ScYOL006C (TOP1) - SH] (341157..34...   978   0.0  
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    33   0.71 
Kwal_56.23825                                                          33   0.89 
KLLA0C03322g 299405..300562 some similarities with sp|P32524 Sac...    32   1.8  
Scas_670.11                                                            31   3.1  
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    31   5.4  
Kwal_14.1338                                                           30   7.6  
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    30   8.3  

>YOL006C (TOP1) [4810] chr15 complement(313078..315387) DNA
           topoisomerase I, relaxes supercoiled DNA by making
           single-stranded breaks [2310 bp, 769 aa]
          Length = 769

 Score = 1268 bits (3282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/614 (100%), Positives = 614/614 (100%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV
Sbjct: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL
Sbjct: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD
Sbjct: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ
Sbjct: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE
Sbjct: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN
Sbjct: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT
Sbjct: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH
Sbjct: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL
Sbjct: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD
Sbjct: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741

Query: 742 VPIEKIFTKTLREK 755
           VPIEKIFTKTLREK
Sbjct: 742 VPIEKIFTKTLREK 755

 Score = 91.3 bits (225), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 49/70 (70%)

Query: 1  MTIADASKVNHELXXXXXXXVPLSQTLKKRKVASMNSASLQDEAEPYDSDEAXXXXXXXX 60
          MTIADASKVNHEL       VPLSQTLKKRKVASMNSASLQDEAEPYDSDEA        
Sbjct: 1  MTIADASKVNHELSSDDDDDVPLSQTLKKRKVASMNSASLQDEAEPYDSDEAISKISKKK 60

Query: 61 XXXXXXEPVQ 70
                EPVQ
Sbjct: 61 TKKIKTEPVQ 70

>Scas_644.14
          Length = 753

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/614 (84%), Positives = 576/614 (93%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           +IKW TLKHNGV+ PPPY+PLPSHIKLYYDGKPVDLPP+AEEVAGF+ A+LE+DHAKNPV
Sbjct: 126 SIKWTTLKHNGVVIPPPYEPLPSHIKLYYDGKPVDLPPEAEEVAGFYGAMLETDHAKNPV 185

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNFF DFL+VLK +GG  NGI I++F +CDFTKMFDYF+L KE+KK+LTSQEKKQIRL
Sbjct: 186 FQKNFFQDFLEVLKTAGGTKNGITIEKFEKCDFTKMFDYFELLKEEKKKLTSQEKKQIRL 245

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           +REK EE YKFCELDGR+EQVGNFKVEPP LFRGRGAHPKTGKLKRRV PEDI+LNL KD
Sbjct: 246 DREKAEEKYKFCELDGRKEQVGNFKVEPPGLFRGRGAHPKTGKLKRRVQPEDIILNLDKD 305

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           AP+P APEGH WGEIR+DN+VQWLAMWRENIFNS KYVRLAANSSLKGQSDYKKFEKARQ
Sbjct: 306 APIPEAPEGHHWGEIRNDNSVQWLAMWRENIFNSVKYVRLAANSSLKGQSDYKKFEKARQ 365

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LK +IDAIR+DY + LKS+VMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE
Sbjct: 366 LKDHIDAIRKDYKKQLKSEVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 425

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           HVTLKPPNTV+FDFLGKDSIRFYQEVEVDK+VFKNL IFKRPPKQPGHQLFDRLDPS LN
Sbjct: 426 HVTLKPPNTVVFDFLGKDSIRFYQEVEVDKKVFKNLKIFKRPPKQPGHQLFDRLDPSTLN 485

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           K+LQNYMPGL+AKVFRTYNASKTMQDQLDLIPN+GSVAEK+L+YNAANRTVAILCNHQRT
Sbjct: 486 KHLQNYMPGLSAKVFRTYNASKTMQDQLDLIPNEGSVAEKLLRYNAANRTVAILCNHQRT 545

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VTKGHAQ+V+KAN++I+ELEWQKIR K+A+LQL+ + LKK P YFEEI+D+TKEDEA IH
Sbjct: 546 VTKGHAQSVQKANDKIKELEWQKIRLKKALLQLEPERLKKNPAYFEEIEDMTKEDEAEIH 605

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           +RII+REIEKY +KF RENDKRKFEKEELLPESQLKEWL+ VDE K+++++ELKTG VEL
Sbjct: 606 RRIIEREIEKYHKKFARENDKRKFEKEELLPESQLKEWLDGVDELKKQYKEELKTGVVEL 665

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           K + N+VEKI+ Q+E+L+ RIQT+SIQLKDKEENSQVSLGTSKINYIDPRL+VVFCKKYD
Sbjct: 666 KPTMNTVEKIEKQIERLDNRIQTNSIQLKDKEENSQVSLGTSKINYIDPRLTVVFCKKYD 725

Query: 742 VPIEKIFTKTLREK 755
           VPIEKIFTKTLREK
Sbjct: 726 VPIEKIFTKTLREK 739

>Sklu_2419.8 YOL006C, Contig c2419 11000-13228 reverse complement
          Length = 742

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/614 (82%), Positives = 568/614 (92%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           +IKW TL+HNGVIFPP Y+PLP H+KLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV
Sbjct: 115 SIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 174

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNFFNDFL+VLKE GG  NGI I+   +CDFTKMFD+FQL+KEQKKQL+SQEKKQ++L
Sbjct: 175 FQKNFFNDFLEVLKEEGGTGNGITIESLDKCDFTKMFDHFQLEKEQKKQLSSQEKKQLKL 234

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           E+EK EE +KFC LDGRREQVGNF++EP  LFRGRGAHPKTGKLKRRV PED+VLNL KD
Sbjct: 235 EKEKLEEPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKD 294

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           AP+P  P GHKWGEIRHDNTVQWLAMWRENI NSFKYVR AA+SSLKG SDYKKFEKARQ
Sbjct: 295 APIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSLKGISDYKKFEKARQ 354

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LK +IDA+R+DY + LKSKVML+RQ AVA YLIDVFALRAGGEKSEDEADTVGCCSLRYE
Sbjct: 355 LKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSEDEADTVGCCSLRYE 414

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           HVTLKPPNTVIFDFLGKDSIRFYQEV+VDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN
Sbjct: 415 HVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 474

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           K+LQNYMPGLTAKVFRTYNASKTMQDQLDLIPN+G+VAEK+L+YNAANRTVAILCNHQRT
Sbjct: 475 KHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAANRTVAILCNHQRT 534

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VTKGHA  V+KAN++I+ELEWQKIR KRAILQLDK+ LKK  KYFEEI DLTKE+E+ IH
Sbjct: 535 VTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEISDLTKEEESAIH 594

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           KR+I+RE EKY RKF+REN+KRK EK+ELLPE+QL EW+ +VDE K+++EKEL+TG++EL
Sbjct: 595 KRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEKELETGDIEL 654

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           K +  SV+K+K Q+EKLEQRI+TS++QLKD+E+NSQV+LGTSKINYIDPRLSVVFCKKY+
Sbjct: 655 KPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINYIDPRLSVVFCKKYN 714

Query: 742 VPIEKIFTKTLREK 755
           VPIEK+FTK+LREK
Sbjct: 715 VPIEKVFTKSLREK 728

>Kwal_56.22484
          Length = 760

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/614 (80%), Positives = 561/614 (91%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           +IKW TLKHNGVIFPP Y+PLPSHIK+YYDGKPVDLPPQAEEVAGFFAALLESDHA+NPV
Sbjct: 133 SIKWTTLKHNGVIFPPAYEPLPSHIKMYYDGKPVDLPPQAEEVAGFFAALLESDHAQNPV 192

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQ+NFFNDFL VL+ESGGP NG++  +F  CDF+KMFDYFQLQKEQKKQL++QEKK ++ 
Sbjct: 193 FQQNFFNDFLDVLRESGGPRNGVQPVKFEHCDFSKMFDYFQLQKEQKKQLSTQEKKALKK 252

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           E+E+FEE +K+C LDGR+EQVGNF++EPP LFRGRGAHPKTGKLKRRV PED+VLNL K+
Sbjct: 253 EKEEFEEPFKYCYLDGRKEQVGNFRIEPPGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKE 312

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           A VP AP+GHKWGEIRHD+TVQWLAMWRENI NSFKYVR AANSSLKG SD+KKFEKARQ
Sbjct: 313 AVVPKAPDGHKWGEIRHDSTVQWLAMWRENISNSFKYVRFAANSSLKGMSDFKKFEKARQ 372

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           L+ YID IR DYT+NLKSKVMLERQ AVA Y IDVFALRAGGEK+EDEADTVGCCSLRYE
Sbjct: 373 LRGYIDTIRSDYTKNLKSKVMLERQIAVACYFIDVFALRAGGEKAEDEADTVGCCSLRYE 432

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           HVTLKPPNTVIFDFLGKDSIRFYQEVEV KQVFKNLTIFK+ PK+PGHQLFDRLDPSILN
Sbjct: 433 HVTLKPPNTVIFDFLGKDSIRFYQEVEVTKQVFKNLTIFKKAPKKPGHQLFDRLDPSILN 492

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           K+LQNYMPGLTAKVFRTYNASKTMQDQLDLIPN+G+VAEK+LKYNAANRTVAILCNHQRT
Sbjct: 493 KHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLKYNAANRTVAILCNHQRT 552

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VTKGHA +V+KA  RI+ELEWQKIR KRAILQLDK  LK+ PKYF E+ DL KE EA IH
Sbjct: 553 VTKGHAASVQKATERIEELEWQKIRLKRAILQLDKSELKQNPKYFAEVKDLVKEQEAAIH 612

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           KR+I++E EK  +KF REN+KRKF+ EE LPESQLKEWL +VD+ + ++++EL+TGEV+L
Sbjct: 613 KRLIEKEREKVTKKFARENEKRKFDNEEALPESQLKEWLARVDDLENQYKEELETGEVQL 672

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           KSS  +VEK+K Q+EKL+QRI+T+SIQLKDKE+NSQV+LGTSKINYIDPRLSVVFCKKY 
Sbjct: 673 KSSTENVEKLKTQIEKLDQRIETASIQLKDKEDNSQVALGTSKINYIDPRLSVVFCKKYG 732

Query: 742 VPIEKIFTKTLREK 755
           VPIEK+FTK+LR+K
Sbjct: 733 VPIEKVFTKSLRDK 746

>CAGL0J11660g 1133494..1135728 highly similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I, hypothetical start
          Length = 744

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/614 (78%), Positives = 555/614 (90%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           TIKWV+LKHNGV+FPP Y+PLPSH+KLYYDGKPVDLPP AEEVAGFFA LL +DHAKNPV
Sbjct: 117 TIKWVSLKHNGVLFPPEYEPLPSHVKLYYDGKPVDLPPAAEEVAGFFANLLHTDHAKNPV 176

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNFF DFLQVLKESGG  N I I  F +CDF+KM  YF+L+KE+K+ ++ +EKKQI+L
Sbjct: 177 FQKNFFEDFLQVLKESGGTRNKINITVFKKCDFSKMNQYFELKKEEKRNMSREEKKQIKL 236

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           E++KFEE +KFCELDGR+EQVGNF+VEPPDLFRGRGAHPKTGKLKRRV PEDI+LNLSKD
Sbjct: 237 EKDKFEEKFKFCELDGRKEQVGNFRVEPPDLFRGRGAHPKTGKLKRRVYPEDIILNLSKD 296

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           AP+PPAP+GH WGEIRHDNTVQWLAMW+ENIF SFKYVRLAANSSL GQSD KKFEKAR+
Sbjct: 297 APIPPAPQGHHWGEIRHDNTVQWLAMWKENIFGSFKYVRLAANSSLNGQSDLKKFEKARE 356

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LK YI  IR+DY  + KSK+MLERQKAVA Y IDVFALRAGGEKSEDEADTVGCCSLR+E
Sbjct: 357 LKKYIGDIRKDYRESFKSKIMLERQKAVATYFIDVFALRAGGEKSEDEADTVGCCSLRFE 416

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           HVTLKPPNTVIFDFLGKDSIR++QEVEV+KQVFKNL IFKRPPK+ G  LFDRLDPSILN
Sbjct: 417 HVTLKPPNTVIFDFLGKDSIRYHQEVEVEKQVFKNLKIFKRPPKKDGDDLFDRLDPSILN 476

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPN+G+VAEK+LKYNAANR VAILCNHQR+
Sbjct: 477 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKLLKYNAANRAVAILCNHQRS 536

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VTKGHAQ+VEK N +I+EL WQKIR K+ ILQL+    +K  KYF+EI+D+TK ++ATIH
Sbjct: 537 VTKGHAQSVEKMNQKIEELLWQKIRLKKGILQLEPSRAQKNKKYFKEINDMTKVEQATIH 596

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           KRI+DRE E+ ++KF R+N+K   EK++ LP+++LKEWL+KVD+ +++++ ELKTG+VEL
Sbjct: 597 KRIVDRERERLKKKFERDNEKLVAEKKDPLPKTELKEWLKKVDDLEKQYKTELKTGKVEL 656

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           K++  SVEK++ QVEKLE+RI+TSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKY+
Sbjct: 657 KATMQSVEKLEKQVEKLEERIKTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYN 716

Query: 742 VPIEKIFTKTLREK 755
           VPIEKIFTKTLREK
Sbjct: 717 VPIEKIFTKTLREK 730

>KLLA0C06116g complement(536524..538881) similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I singleton, start by similarity
          Length = 785

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/614 (76%), Positives = 543/614 (88%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           TIKW TLKHNGVIFP  Y+PLP+H+KLYY+GKPVDLPPQAEEVAGFFAA+LESDH K P 
Sbjct: 158 TIKWTTLKHNGVIFPSTYEPLPAHVKLYYNGKPVDLPPQAEEVAGFFAAILESDHVKIPT 217

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNF +DFLQVLKE+GG  NG++IKEF + DFTK+F+YFQ+QKEQKKQL+ QEKKQ+RL
Sbjct: 218 FQKNFLHDFLQVLKENGGARNGVQIKEFGKLDFTKIFEYFQVQKEQKKQLSPQEKKQLRL 277

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           E+E+ E+ YKFCE+DGR EQVGNF++EPP LFRGRGAHPK GKLKRRV PED+VLNL K+
Sbjct: 278 EKEELEKPYKFCEIDGRVEQVGNFRIEPPGLFRGRGAHPKNGKLKRRVYPEDVVLNLDKE 337

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           AP+P  P+GHKWGEIRHDNTVQWL+MWRENI NSFKYVR AANS+LKG SD+KKFEKAR 
Sbjct: 338 APIPEPPKGHKWGEIRHDNTVQWLSMWRENISNSFKYVRFAANSTLKGMSDFKKFEKARM 397

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LK +ID +R DY   +KS   L+RQ AVA YLIDVFALRAGGEK++DEADTVGCCSLRYE
Sbjct: 398 LKDHIDKVRTDYKSKMKSPKTLDRQMAVATYLIDVFALRAGGEKADDEADTVGCCSLRYE 457

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           HVTL+PPNTV+FDFLGKDSIR+YQEVEVD QVFKNL IFKRPP  PGHQLFDRLDPSILN
Sbjct: 458 HVTLRPPNTVVFDFLGKDSIRYYQEVEVDAQVFKNLKIFKRPPSGPGHQLFDRLDPSILN 517

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           K+LQNYMPGLTAKVFRTYNASKTMQDQLDLIPN+G+VAEKIL+YNAANRTVAILCNHQRT
Sbjct: 518 KHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKILRYNAANRTVAILCNHQRT 577

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VTKGHA +V+KA  RI+ELEWQK+R KRAILQLDK   KK   YF+EIDDLTKE+E TIH
Sbjct: 578 VTKGHASSVQKATERIEELEWQKVRYKRAILQLDKSERKKNQNYFKEIDDLTKEEELTIH 637

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           KRII+RE EKY+RKF REN+KRKF KE+ +P+SQL EWL KVD+ ++ +E+E  TG++EL
Sbjct: 638 KRIIEREREKYKRKFERENEKRKFSKEDPIPDSQLLEWLAKVDDLEKLYERESTTGKIEL 697

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           + S  ++EK+K  VEKLE+RI   S+QLKDKE+NS V+LGTSKINYIDPRLSV FCKK+D
Sbjct: 698 RESLQNLEKLKQNVEKLEKRITNCSLQLKDKEDNSTVALGTSKINYIDPRLSVAFCKKFD 757

Query: 742 VPIEKIFTKTLREK 755
           VPIEK+FTKTLR+K
Sbjct: 758 VPIEKVFTKTLRDK 771

>CAGL0E02431g complement(230559..232712) highly similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I, hypothetical start
          Length = 717

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/614 (76%), Positives = 542/614 (88%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           TIKW TL+HNGV+FPPPY+ LPSH+KLYY+G PVDLP +AEEVAGFFA LLE+ HA+NPV
Sbjct: 90  TIKWTTLEHNGVLFPPPYEALPSHVKLYYEGNPVDLPLEAEEVAGFFAHLLETPHAQNPV 149

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNFF DF  VL ++GG  NGIEI+ F R DF+ M DYF   KE+KK +T+ +KK+IRL
Sbjct: 150 FQKNFFEDFKHVLNDAGGTQNGIEIESFDRMDFSAMHDYFVQLKEEKKSMTAMQKKEIRL 209

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           EREKFEE YKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRR+ PEDIVLNL + 
Sbjct: 210 EREKFEEKYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRIRPEDIVLNLGEG 269

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           AP+PP P GH+WGEIRHDNTVQWLAMWRENIF SFKYVRLAANSSLKGQSD+KKFEKAR+
Sbjct: 270 APIPPPPSGHQWGEIRHDNTVQWLAMWRENIFGSFKYVRLAANSSLKGQSDFKKFEKARE 329

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LK +ID IR++Y  N KSK+M+ERQKAVA+YLIDVFALRAGGEKSE+EADTVGCCSLRYE
Sbjct: 330 LKKHIDRIRKEYRNNFKSKLMVERQKAVAVYLIDVFALRAGGEKSEEEADTVGCCSLRYE 389

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           H+TLKPPNTVIFDFLGKDSIRFYQEV+VD +VFKNL +FK+PPKQPGHQLFDRLDPS+LN
Sbjct: 390 HITLKPPNTVIFDFLGKDSIRFYQEVQVDPKVFKNLALFKKPPKQPGHQLFDRLDPSLLN 449

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           K+LQNYM GLTAKVFRTYNASKTMQ+QLDLIPN+GSVAEK+LKYNAANRTVAILCNHQRT
Sbjct: 450 KFLQNYMTGLTAKVFRTYNASKTMQEQLDLIPNEGSVAEKLLKYNAANRTVAILCNHQRT 509

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           VT GHA++V K+++RI+E +WQK R K+ ILQ++ D +K  P YFE+I+ + KE EA IH
Sbjct: 510 VTAGHAKSVAKSSDRIEEFKWQKERLKKGILQIEPDRIKDTPNYFEDINSIDKEIEAKIH 569

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           +RII+REI+KY  KF RENDKRKFE EE LPE  LKEWL+ V + KQ++ +EL TG V+L
Sbjct: 570 ERIIEREIQKYHNKFKRENDKRKFEGEEPLPEETLKEWLDNVKQLKQQYAEELATGIVQL 629

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           K+S NSVEK++  +E+L+QRI TS +QL+D+E NS+VSLGTSKINYIDPRLSVVFCKKY 
Sbjct: 630 KASMNSVEKLEKAIERLDQRISTSQVQLQDREANSEVSLGTSKINYIDPRLSVVFCKKYG 689

Query: 742 VPIEKIFTKTLREK 755
           VPIEKIFTK+LREK
Sbjct: 690 VPIEKIFTKSLREK 703

>ACL008C [1041] [Homologous to ScYOL006C (TOP1) - SH]
           (341157..343355) [2199 bp, 732 aa]
          Length = 732

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/614 (74%), Positives = 540/614 (87%)

Query: 142 TIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPV 201
           ++KWVTL+HNGV+FPP Y PLPSH++LYY GK V+LP +AEEVAGFFAALL+SDHA+NPV
Sbjct: 105 SVKWVTLRHNGVMFPPEYTPLPSHVRLYYGGKAVELPAEAEEVAGFFAALLQSDHAQNPV 164

Query: 202 FQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRL 261
           FQKNFF DFL VL + GG  NGI+I+EFS+CDF+KM  Y Q Q+ Q KQL+S E+K ++ 
Sbjct: 165 FQKNFFEDFLSVLNKHGGARNGIDIQEFSKCDFSKMHAYIQQQRVQMKQLSSHERKLLKQ 224

Query: 262 EREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLNLSKD 321
           E+ + E   +   L GR+EQV  FK++PPDLFRGRGAHPKTGKLKRRV PED+VLNL KD
Sbjct: 225 EKGQTEGPVQVLLLTGRKEQVDTFKIDPPDLFRGRGAHPKTGKLKRRVQPEDVVLNLDKD 284

Query: 322 APVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFEKARQ 381
           AP+P  P GHKWGEIRHDNTVQWL MWRENI NSFKYVRLAANSSLKG SD+KKFEK+R+
Sbjct: 285 APIPEPPAGHKWGEIRHDNTVQWLCMWRENISNSFKYVRLAANSSLKGMSDFKKFEKSRE 344

Query: 382 LKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCSLRYE 441
           LK+YID IR DY +NLKSKVML+RQ AVA YLIDVFALRAGGEKSEDEADTVGCCSLRYE
Sbjct: 345 LKNYIDIIRADYRKNLKSKVMLDRQIAVATYLIDVFALRAGGEKSEDEADTVGCCSLRYE 404

Query: 442 HVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILN 501
           H++LKPPNTV+FDFLGKDSIR+YQEVEVDKQVFKNL+IFKRPPK+PGHQLFDRLDPSILN
Sbjct: 405 HISLKPPNTVVFDFLGKDSIRYYQEVEVDKQVFKNLSIFKRPPKEPGHQLFDRLDPSILN 464

Query: 502 KYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCNHQRT 561
           K+LQNYMPGLTAKVFRTYNASKTMQDQLDLIPN+GSV EK+++YNAANR VAILCNHQRT
Sbjct: 465 KHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGSVTEKMVRYNAANRAVAILCNHQRT 524

Query: 562 VTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDEATIH 621
           V + HAQ+++KA  +I+E +WQKIR K+AILQLD+  LK  PK+F+EI+DLTKE++ +IH
Sbjct: 525 VGRSHAQSMQKATEKIEEYQWQKIRYKKAILQLDESELKANPKFFKEINDLTKEEQMSIH 584

Query: 622 KRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTGEVEL 681
           KR+++RE EKYQ+KF REN+KRKFE EELLPESQL+ WL  V+E  +E+ +EL+TG V +
Sbjct: 585 KRVLEREREKYQKKFARENEKRKFEGEELLPESQLESWLADVEEMGKEYVEELETGLVTV 644

Query: 682 KSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFCKKYD 741
           K +  SVEK+KAQ++KLEQRI+T+SIQ+KDKE+NS V+L TSKI+YIDPRLSV FCKKYD
Sbjct: 645 KPTLQSVEKLKAQIDKLEQRIRTTSIQMKDKEDNSTVALSTSKISYIDPRLSVAFCKKYD 704

Query: 742 VPIEKIFTKTLREK 755
           VP+EK+FTKTLREK
Sbjct: 705 VPLEKVFTKTLREK 718

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 57/138 (41%), Gaps = 18/138 (13%)

Query: 403 LERQKAVAIYLIDVFAL----RAGGEKSEDEADTVGCCSLRYEHVTLKPPNTVIFDFLGK 458
           LERQ     +L + F +       G  + + + T    S      +L P    +  +L  
Sbjct: 780 LERQIPTPNFLTNTFPVEPNTSISGVNTLNTSQTANLFSSTNFGASLDPVENNMDRYLPV 839

Query: 459 DSIRFYQEVEVDKQVFKNLTIFKRPPKQ------PGHQLFDRLDPSILNKYLQNYMPGLT 512
           DS +  Q ++   Q     T  + P         PG  +FD+LD  +  +YL  YM G+T
Sbjct: 840 DSNQNKQSLQQTPQYISTTTPNQIPDSAVDGTYVPG--MFDQLDVQLFGRYLPPYMSGVT 897

Query: 513 AKVFRTYNASKTMQDQLD 530
           A      N SKT ++ LD
Sbjct: 898 A------NDSKTKEEPLD 909

>Kwal_56.23825
          Length = 1396

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 79/154 (51%), Gaps = 16/154 (10%)

Query: 591 ILQLDKDLLKKEPKYFEEIDDLTKEDEATIHKRIIDREIEKYQRKFVRENDKRKFEKEEL 650
           + Q+DK+L ++E  +    D L + +EA   +++ DRE E       R+ D      E  
Sbjct: 821 VQQIDKELSEREHNFQIAADTLHEMEEAL--QKLKDREPEIELDISKRKLDIDSLSSEMK 878

Query: 651 LPESQLKEWLEKVDEKKQEFEKELKTGEVELKSSWNSVEKIKAQVEKLEQRIQTSSIQLK 710
             E +L E+L +   +K+   +EL T EV+LKS       +K++  +LE  +Q+   ++K
Sbjct: 879 ASEGRL-EYLLQEKAQKESSNEELSTAEVKLKS-------LKSEYRELENEMQSKKKEMK 930

Query: 711 DKEE------NSQVSLGTSKINYIDPRLSVVFCK 738
             +E       +++ + +S ++ ++ R+++V  K
Sbjct: 931 VLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAK 964

>KLLA0C03322g 299405..300562 some similarities with sp|P32524
           Saccharomyces cerevisiae YJL203w PRP21 pre-mRNA splicing
           factor singleton, hypothetical start
          Length = 385

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 190 ALLESDHAKNPVFQKNFFNDFLQVLKESGGP---LNGIEIKEFSRCDFTKMFDYFQLQKE 246
           A L  DH+ N V   +F N + Q+L E  GP   L G       R  F K  +Y +LQ E
Sbjct: 156 AFLRLDHSLNSVLT-DFINQYEQILSEEYGPIVRLEGPLQSTILRRAFQKA-EYMELQDE 213

Query: 247 QKKQLTSQEK-KQIRL---EREKFE 267
            K+++ +  K  +IR    E EKFE
Sbjct: 214 LKQKMKADIKTSRIRFSAYEWEKFE 238

>Scas_670.11
          Length = 432

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 632 YQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKEL--KTGEVELKSSWNSVE 689
           ++RK    N KR F    LL  +++ E+L ++ E+ Q    +L  + G    K SW++ +
Sbjct: 162 HKRKISEPNMKRSFTFNSLLKMNKMLEYLARISEELQLTSAQLEKQMGVTARKPSWHTTQ 221

Query: 690 KIKAQVEKLEQRIQTSSIQLK 710
            ++   ++L + + T  I++K
Sbjct: 222 -LQIYKDQLNESLSTKRIKIK 241

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH]
           (901443..905555) [4113 bp, 1370 aa]
          Length = 1370

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 12/102 (11%)

Query: 618 ATIHKRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEF------- 670
            T++  I+D + E  + K    +      KE  + E +L+ W  KV+EKK E        
Sbjct: 472 TTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEI 531

Query: 671 ----EKELKTGEVELKSSWNSVEKIKAQVEKLEQRIQTSSIQ 708
               E +LK  E E+ +    +E+++  +   E+ I+T +++
Sbjct: 532 SIIKEADLKL-ESEIANLSQEIEQLRGNISHREESIETLNVE 572

>Kwal_14.1338
          Length = 495

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 587 CKRAILQLDKD----LLKKEPKYFEEIDDLTKEDEATIHKRIID 626
           C++A+ +L +     L+K+ P+YFE I   ++E     H +I+D
Sbjct: 184 CRKALCELYEHFVGYLVKRFPQYFEVILSPSEESAGVFHNKILD 227

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 12/67 (17%)

Query: 661 EKVDEKKQEF--------EKELKTGEVELKSSWNSVEKIKAQVEKLEQRIQTSSIQLKDK 712
           E VD  +QEF        E  +   E+ L   WNS+ +++ ++ +LEQ  +T   Q+KD 
Sbjct: 59  ESVD--RQEFISNNDTSNESMVDIDELLLPKKWNSIVRLQKKIIELEQNTETLVSQIKDL 116

Query: 713 EENSQVS 719
             N+QVS
Sbjct: 117 --NTQVS 121

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,123,664
Number of extensions: 1064634
Number of successful extensions: 7392
Number of sequences better than 10.0: 440
Number of HSP's gapped: 7119
Number of HSP's successfully gapped: 611
Length of query: 755
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 646
Effective length of database: 12,822,747
Effective search space: 8283494562
Effective search space used: 8283494562
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)