Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YNL157W1681135975e-80
Sklu_1881.41301013037e-36
Kwal_33.14612129992993e-35
KLLA0F27907g1501012962e-34
CAGL0G06094g138852882e-33
AFR044C1261032862e-33
YHR132W-A131812821e-32
Scas_697.15142932779e-32
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL157W
         (166 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with sim...   234   5e-80
Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement      121   7e-36
Kwal_33.14612                                                         119   3e-35
KLLA0F27907g complement(2581760..2582212) some similarities with...   118   2e-34
CAGL0G06094g 583297..583713 highly similar to tr|Q9P305 Saccharo...   115   2e-33
AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH] ...   114   2e-33
YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the...   113   1e-32
Scas_697.15                                                           111   9e-32

>YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with
           similarity to Yhr132w-ap and with weak similarity to
           human ENSA alpha-endosulfine and human ARPP-19
           cAMP-regulated phosphoprotein [507 bp, 168 aa]
          Length = 168

 Score =  234 bits (597), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 14  DLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAG 73
           DLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAG
Sbjct: 14  DLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAG 73

Query: 74  IQNNDPINYGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATLIQKE 126
           IQNNDPINYGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATLIQKE
Sbjct: 74  IQNNDPINYGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATLIQKE 126

>Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement
          Length = 130

 Score =  121 bits (303), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 8/101 (7%)

Query: 26  IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNND--PINYG 83
           +DTSK +P E+KLYK+YGKLPSKKD+FKH +Q+RKYFDSGDYAL KAG++++D    + G
Sbjct: 18  VDTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYALSKAGVKSDDLQSDSIG 77

Query: 84  KNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATLIQ 124
            ++LP+TNPS LRE II+RR+S      S+AG VD A   Q
Sbjct: 78  SSHLPVTNPSGLRESIIRRRMS------SSAGSVDAAASQQ 112

>Kwal_33.14612
          Length = 129

 Score =  119 bits (299), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 60/99 (60%), Positives = 77/99 (77%), Gaps = 8/99 (8%)

Query: 26  IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNND--PINYG 83
           +DTSK +P E+KLYKMYGKLPSKKD+FKH +Q+RKYFDSGDYAL KAG++++D    + G
Sbjct: 20  VDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYALNKAGVKSDDLQSDSIG 79

Query: 84  KNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATL 122
            ++LP+TNPS LRE IIKRR+S      S+AG +D   L
Sbjct: 80  NSHLPVTNPSGLRESIIKRRLS------SSAGGMDAQEL 112

>KLLA0F27907g complement(2581760..2582212) some similarities with
           sgd|S0007496 Saccharomyces cerevisiae YHR132wa Pi,
           hypothetical start
          Length = 150

 Score =  118 bits (296), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 9/101 (8%)

Query: 26  IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNND----PIN 81
           +D SK SP E+K+YKMYGKLPSKKD+F+H +Q+RKYFDSGDYAL++AG++++D    P+ 
Sbjct: 37  VDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPV- 95

Query: 82  YGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATL 122
              NNLPLTNPS LRE IIKRR+S   S+A+    VD   L
Sbjct: 96  -ANNNLPLTNPSGLRESIIKRRMS---SSANGPSNVDAQRL 132

>CAGL0G06094g 583297..583713 highly similar to tr|Q9P305
           Saccharomyces cerevisiae YHR132wa, start by similarity
          Length = 138

 Score =  115 bits (288), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 66/85 (77%), Gaps = 3/85 (3%)

Query: 26  IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNNDPI---NY 82
           +D S+ S  E+KLYKMYGKLPSKKDIFKH M  RKYFDSGDYAL+KAG+  +D +   N 
Sbjct: 32  VDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSGDYALKKAGVIRSDDVIDENN 91

Query: 83  GKNNLPLTNPSKLREDIIKRRISTC 107
             NNLP+TNPS LRE II+RR+S+ 
Sbjct: 92  SSNNLPVTNPSGLRESIIRRRMSSS 116

>AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH]
           (511998..512378) [381 bp, 126 aa]
          Length = 126

 Score =  114 bits (286), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (72%), Gaps = 8/103 (7%)

Query: 22  ESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNND--P 79
           ++G +D S  +P E+KLYK+YGKLP KKD+FKH + +RKYFDSGDYAL KAG+++ D   
Sbjct: 14  DTGDVDLSALTPQELKLYKLYGKLPGKKDLFKHKLHERKYFDSGDYALSKAGVKSEDLGS 73

Query: 80  INYGKNNLPLTNPSKLREDIIKRRISTCPSTASTAGVVDNATL 122
              G ++LP+TNPS LRE II+RR+S      S+AG +D+  L
Sbjct: 74  AAVGSSHLPVTNPSGLRESIIRRRMS------SSAGGLDSQNL 110

>YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the
           cAMP-regulated phosphoprotein or endosulfine conserved
           region containing family, has high similarity to
           uncharacterized S. cerevisiae Ynl157p [396 bp, 131 aa]
          Length = 131

 Score =  113 bits (282), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 2/81 (2%)

Query: 26  IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNNDP--INYG 83
           +D SK SP E+KLYKMYGKLPSKKD+ +H MQ R+YFDSGDYAL+KAG+  +D   +N  
Sbjct: 25  VDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQYFDSGDYALKKAGVIKSDDVIVNNS 84

Query: 84  KNNLPLTNPSKLREDIIKRRI 104
            NNLP+TNPS LRE II+RR+
Sbjct: 85  SNNLPVTNPSGLRESIIRRRM 105

>Scas_697.15
          Length = 142

 Score =  111 bits (277), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 69/93 (74%), Gaps = 2/93 (2%)

Query: 14  DLTKLNNGESGTIDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAG 73
           +L    + +   +D SK +P E+KL+KMYGKLPSK+D+ KH MQ+RKYFDSGDYAL+KAG
Sbjct: 17  NLAHTKDKDGNMVDLSKLTPQELKLFKMYGKLPSKRDLLKHKMQERKYFDSGDYALRKAG 76

Query: 74  IQNNDPI--NYGKNNLPLTNPSKLREDIIKRRI 104
           +   D +  +   NN+P+TNPS LRE II+RR+
Sbjct: 77  VIKKDDVMSSNSSNNMPVTNPSGLRESIIRRRL 109

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.130    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,183,906
Number of extensions: 183180
Number of successful extensions: 426
Number of sequences better than 10.0: 15
Number of HSP's gapped: 419
Number of HSP's successfully gapped: 15
Length of query: 166
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 72
Effective length of database: 13,342,017
Effective search space: 960625224
Effective search space used: 960625224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)