Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YNL154C (YCK2)54653724430.0
Scas_654.1752355117960.0
CAGL0G06138g53939916890.0
YHR135C (YCK1)53832816880.0
AFR040W54733516840.0
Kwal_33.1459650033116770.0
KLLA0D11044g53640516440.0
CAGL0J05940g48632716230.0
Scas_697.1252932716120.0
Scas_627.447533711681e-156
ADL053C47134011471e-153
YER123W (YCK3)52435511461e-152
Sklu_2359.348835911371e-151
Kwal_47.1731442134211231e-150
KLLA0E13563g47334011231e-149
CAGL0K02299g53836211211e-148
KLLA0D03168g5052938261e-104
Kwal_56.240644752978211e-104
AFL091W4782938191e-103
CAGL0H03553g4952938151e-103
Scas_720.244732918121e-102
Sklu_1892.34742938101e-102
YPL204W (HRR25)4942938081e-102
Scas_690.124882896851e-83
KLLA0C08525g15512221836e-14
YDR490C (PKH1)7662721721e-12
Scas_618.84272121654e-12
KLLA0E03487g6472301657e-12
Kwal_23.632515422321651e-11
AER264C14832321622e-11
AAR009W4532151602e-11
Scas_660.209572311613e-11
CAGL0L03520g14472291561e-10
Sklu_2436.147842391551e-10
Kwal_56.240593532331522e-10
Kwal_26.735514462291542e-10
YJL095W (BCK1)14782751542e-10
YPL203W (TPK2)3802331503e-10
AFR335C10332511506e-10
Kwal_33.138463752281476e-10
Sklu_2437.1610712661497e-10
Sklu_2429.54322161478e-10
AFL090W3462291441e-09
AEL284C4792521452e-09
YDR466W (PKH3)8982411462e-09
YCR073C (SSK22)13312371452e-09
Scas_502.211162611443e-09
CAGL0I07513g10762731443e-09
KLLA0D03190g3722281414e-09
Kwal_0.964272151415e-09
Kwal_56.226939842601425e-09
AFL101C3672141405e-09
Kwal_47.183076212321416e-09
CAGL0K06479g9912491408e-09
CAGL0L11550g10722281408e-09
CAGL0F09075g7462951409e-09
KLLA0F16467g3401581379e-09
KLLA0C12485g9252331401e-08
KLLA0B02332g3612241371e-08
YHR102W (KIC1)10802211401e-08
YGL158W (RCK1)5122501381e-08
AFR377C7262281391e-08
YOL100W (PKH2)10812701391e-08
CAGL0K03399g7032311381e-08
YPL153C (RAD53)8212381381e-08
CAGL0M08404g4622281362e-08
Scas_711.2515152211372e-08
YFR014C (CMK1)4461801352e-08
Kwal_26.76356912291362e-08
CAGL0G09020g3612291333e-08
CAGL0F04741g4422101344e-08
KLLA0F13552g12672821354e-08
Scas_720.9416832381354e-08
KLLA0B12716g7162311344e-08
YKL166C (TPK3)3982281324e-08
Kwal_26.778812672171336e-08
KLLA0F14190g13382221337e-08
YJL164C (TPK1)3972341317e-08
ABL028W7222351329e-08
YOL016C (CMK2)4472181309e-08
CAGL0G04609g9652371311e-07
Scas_690.133542331291e-07
YHR205W (SCH9)8241351311e-07
Sklu_2430.57332351301e-07
KLLA0F23155g4272141291e-07
Scas_613.55172451291e-07
YDR477W (SNF1)6332221292e-07
Scas_689.25*4092141282e-07
Sklu_2232.23741581272e-07
CAGL0K08514g14892511292e-07
Scas_660.286232221282e-07
CAGL0M08910g6121601282e-07
AFR092W14232221282e-07
CAGL0M02299g8932631273e-07
Scas_673.20*7582271273e-07
CAGL0J06072g7731521273e-07
ADR204W3391581243e-07
CAGL0L07326g5062381264e-07
Sklu_2392.68081581264e-07
Scas_700.546982281264e-07
YGR052W3692201245e-07
AFL188C4722391245e-07
Kwal_47.182335981591255e-07
Kwal_14.12734152731245e-07
YNL161W (CBK1)7561541255e-07
YKL101W (HSL1)15182491265e-07
Scas_703.57492351246e-07
KLLA0B07205g4552281236e-07
Scas_721.1246842361247e-07
YPL141C8652761247e-07
YOR061W (CKA2)3391581228e-07
CAGL0B04301g5421391238e-07
CAGL0M02233g7672341238e-07
CAGL0G02035g3391581218e-07
ABL034W14252201249e-07
Kwal_47.167617441351239e-07
CAGL0K07458g7041411239e-07
ADL389W7111351231e-06
CAGL0K12562g16821851231e-06
AEL230W6081591221e-06
AFR035W7191541221e-06
Kwal_26.87967962151211e-06
YNR031C (SSK2)15792531221e-06
Scas_651.183712281202e-06
KLLA0F09020g9281541212e-06
YKL126W (YPK1)6802371212e-06
KLLA0A03806g6021591212e-06
KLLA0D08415g7741391212e-06
Kwal_14.115915211541212e-06
Scas_580.610152281212e-06
Scas_717.696742311212e-06
Kwal_33.145547141581202e-06
KLLA0F24618g5561351202e-06
YBR274W (CHK1)5271091202e-06
KLLA0B03586g7341351202e-06
Scas_707.315981541212e-06
ACR218W15691541202e-06
YBR028C5251471192e-06
YOR231W (MKK1)5081321183e-06
YOR233W (KIN4)8002201193e-06
Scas_654.127371511193e-06
Kwal_33.139846491841193e-06
CAGL0I09504g5282361183e-06
YMR104C (YPK2)6771231174e-06
ADL283W3061681154e-06
KLLA0E21780g10162271175e-06
Scas_616.1014612491175e-06
KLLA0D07810g7181521166e-06
Kwal_33.144347591381166e-06
ABL143C7252231167e-06
Sklu_1843.34861191157e-06
YPL209C (IPL1)3671451147e-06
AEL083W5361471157e-06
CAGL0K10604g4462141148e-06
KLLA0F01507g4721201148e-06
ADR058C2952071138e-06
CAGL0J03872g6612281158e-06
CAGL0K04301g3552371139e-06
Kwal_55.203267502401159e-06
AFR076W8201951159e-06
Scas_648.173401661131e-05
Kwal_56.240913811171131e-05
AEL115C3862121121e-05
Kwal_55.215458652291141e-05
Sklu_2361.38842421131e-05
ACR142W8372311131e-05
CAGL0E05720g3582141121e-05
Sklu_2104.12992071112e-05
KLLA0E01584g4152431112e-05
YDL214C (PRR2)6991071122e-05
CAGL0I05896g7781841122e-05
YFL033C (RIM15)17701781122e-05
Scas_655.28001381122e-05
CAGL0K02167g11623221122e-05
YJL141C (YAK1)8071841122e-05
KLLA0E14828g3101891092e-05
Kwal_27.119192092071072e-05
CAGL0M10153g8671421113e-05
CAGL0F00649g5141801103e-05
Kwal_26.87098292231113e-05
KLLA0F11143g8132281103e-05
YPL140C (MKK2)5061271103e-05
YNL183C (NPR1)7901381103e-05
YHL007C (STE20)9392191103e-05
ACR133C8512231103e-05
CAGL0C05005g10762261103e-05
Scas_640.165051191094e-05
KLLA0F01276g5192301094e-05
YKL171W9282481104e-05
Kwal_26.87034441191084e-05
YDL159W (STE7)5151191094e-05
ABL011C7012351094e-05
CAGL0B02739g6762341094e-05
ACL191C3651601085e-05
YMR139W (RIM11)3701641075e-05
CAGL0J03828g4671331085e-05
YGL179C (TOS3)5602441085e-05
Scas_675.25272251086e-05
Kwal_26.78619551301087e-05
Scas_683.123562251067e-05
ADL315C4342311067e-05
AEL120W773611077e-05
Scas_721.462962071057e-05
ACR249C6431861077e-05
Sklu_2417.133631661058e-05
ABR014W9712181061e-04
Scas_698.373471581051e-04
KLLA0A05819g7041841061e-04
AEL205W7931141051e-04
KLLA0B13607g9892231051e-04
CAGL0H07535g2982091031e-04
Kwal_55.217093401631041e-04
ADR379C4921261041e-04
ACR117W5241271041e-04
Kwal_27.98044731751041e-04
CAGL0H10318g3071621031e-04
KLLA0F20053g4442031042e-04
CAGL0I03498g451961042e-04
Scas_700.354391571032e-04
Scas_700.288962241042e-04
CAGL0J11308g7281381042e-04
CAGL0F03245g10362501042e-04
Scas_627.73491131022e-04
Scas_668.228931301042e-04
Kwal_23.52908191111042e-04
Sklu_2385.24342031032e-04
CAGL0L06820g3661641022e-04
Scas_623.113781651022e-04
Scas_711.15727791032e-04
CAGL0K02673g9151301032e-04
KLLA0C04191g7972411032e-04
KLLA0B09790g2952071012e-04
YOR351C (MEK1)497981022e-04
Kwal_14.24974181231023e-04
YNL298W (CLA4)8421141023e-04
YLR113W (HOG1)4351631013e-04
Scas_477.57031491023e-04
Sklu_2366.54661081013e-04
Scas_613.13*3121731003e-04
CAGL0M08316g9641861023e-04
YDL101C (DUN1)5132381013e-04
KLLA0B13112g7302441013e-04
CAGL0B01925g9441501023e-04
ACL104C9472171014e-04
KLLA0D10527g6452511014e-04
Kwal_23.64588681211014e-04
KLLA0A07403g8791141014e-04
Scas_667.184371701004e-04
CAGL0M03729g861971014e-04
Scas_201.1*27461994e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL154C
         (537 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   945   0.0  
Scas_654.17                                                           696   0.0  
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   655   0.0  
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   654   0.0  
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   653   0.0  
Kwal_33.14596                                                         650   0.0  
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   637   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   629   0.0  
Scas_697.12                                                           625   0.0  
Scas_627.4                                                            454   e-156
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   446   e-153
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   446   e-152
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        442   e-151
Kwal_47.17314                                                         437   e-150
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   437   e-149
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   436   e-148
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   322   e-104
Kwal_56.24064                                                         320   e-104
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   320   e-103
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   318   e-103
Scas_720.24                                                           317   e-102
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           316   e-102
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   315   e-102
Scas_690.12                                                           268   1e-83
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    75   6e-14
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    71   1e-12
Scas_618.8                                                             68   4e-12
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    68   7e-12
Kwal_23.6325                                                           68   1e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    67   2e-11
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    66   2e-11
Scas_660.20                                                            67   3e-11
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    65   1e-10
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         64   1e-10
Kwal_56.24059                                                          63   2e-10
Kwal_26.7355                                                           64   2e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    64   2e-10
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    62   3e-10
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    62   6e-10
Kwal_33.13846                                                          61   6e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      62   7e-10
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        61   8e-10
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    60   1e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    60   2e-09
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    61   2e-09
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    60   2e-09
Scas_502.2                                                             60   3e-09
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    60   3e-09
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    59   4e-09
Kwal_0.96                                                              59   5e-09
Kwal_56.22693                                                          59   5e-09
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    59   5e-09
Kwal_47.18307                                                          59   6e-09
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    59   8e-09
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    59   8e-09
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    59   9e-09
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    57   9e-09
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    59   1e-08
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    57   1e-08
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    59   1e-08
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    58   1e-08
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    58   1e-08
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    58   1e-08
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    58   1e-08
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    58   1e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    57   2e-08
Scas_711.25                                                            57   2e-08
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    57   2e-08
Kwal_26.7635                                                           57   2e-08
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    56   3e-08
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    56   4e-08
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    57   4e-08
Scas_720.94                                                            57   4e-08
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    56   4e-08
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    55   4e-08
Kwal_26.7788                                                           56   6e-08
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    56   7e-08
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    55   7e-08
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    55   9e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    55   9e-08
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    55   1e-07
Scas_690.13                                                            54   1e-07
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    55   1e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           55   1e-07
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    54   1e-07
Scas_613.5                                                             54   1e-07
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    54   2e-07
Scas_689.25*                                                           54   2e-07
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         54   2e-07
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    54   2e-07
Scas_660.28                                                            54   2e-07
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    54   2e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    54   2e-07
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    54   3e-07
Scas_673.20*                                                           54   3e-07
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    54   3e-07
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    52   3e-07
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    53   4e-07
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       53   4e-07
Scas_700.54                                                            53   4e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    52   5e-07
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    52   5e-07
Kwal_47.18233                                                          53   5e-07
Kwal_14.1273                                                           52   5e-07
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    53   5e-07
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    53   5e-07
Scas_703.5                                                             52   6e-07
KLLA0B07205g complement(624606..625973) some similarities with s...    52   6e-07
Scas_721.124                                                           52   7e-07
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    52   7e-07
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    52   8e-07
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    52   8e-07
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    52   8e-07
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    51   8e-07
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    52   9e-07
Kwal_47.16761                                                          52   9e-07
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    52   9e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    52   1e-06
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    52   1e-06
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    52   1e-06
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    52   1e-06
Kwal_26.8796                                                           51   1e-06
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    52   1e-06
Scas_651.18                                                            51   2e-06
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    51   2e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    51   2e-06
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    51   2e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    51   2e-06
Kwal_14.1159                                                           51   2e-06
Scas_580.6                                                             51   2e-06
Scas_717.69                                                            51   2e-06
Kwal_33.14554                                                          51   2e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    51   2e-06
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    51   2e-06
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    51   2e-06
Scas_707.3                                                             51   2e-06
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    51   2e-06
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    50   2e-06
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    50   3e-06
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    50   3e-06
Scas_654.12                                                            50   3e-06
Kwal_33.13984                                                          50   3e-06
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    50   3e-06
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    50   4e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    49   4e-06
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    50   5e-06
Scas_616.10                                                            50   5e-06
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    49   6e-06
Kwal_33.14434                                                          49   6e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    49   7e-06
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         49   7e-06
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    49   7e-06
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    49   7e-06
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    49   8e-06
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    49   8e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    48   8e-06
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    49   8e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    48   9e-06
Kwal_55.20326                                                          49   9e-06
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    49   9e-06
Scas_648.17                                                            48   1e-05
Kwal_56.24091                                                          48   1e-05
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    48   1e-05
Kwal_55.21545                                                          49   1e-05
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            48   1e-05
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    48   1e-05
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    48   1e-05
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             47   2e-05
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    47   2e-05
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    48   2e-05
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    48   2e-05
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    48   2e-05
Scas_655.2                                                             48   2e-05
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    48   2e-05
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    48   2e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    47   2e-05
Kwal_27.11919                                                          46   2e-05
CAGL0M10153g complement(1010688..1013291) some similarities with...    47   3e-05
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    47   3e-05
Kwal_26.8709                                                           47   3e-05
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    47   3e-05
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    47   3e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    47   3e-05
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    47   3e-05
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    47   3e-05
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    47   3e-05
Scas_640.16                                                            47   4e-05
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    47   4e-05
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    47   4e-05
Kwal_26.8703                                                           46   4e-05
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    47   4e-05
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    47   4e-05
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    47   4e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    46   5e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    46   5e-05
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    46   5e-05
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    46   5e-05
Scas_675.2                                                             46   6e-05
Kwal_26.7861                                                           46   7e-05
Scas_683.12                                                            45   7e-05
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    45   7e-05
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    46   7e-05
Scas_721.46                                                            45   7e-05
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    46   7e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      45   8e-05
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    45   1e-04
Scas_698.37                                                            45   1e-04
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    45   1e-04
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    45   1e-04
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    45   1e-04
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    44   1e-04
Kwal_55.21709                                                          45   1e-04
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    45   1e-04
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    45   1e-04
Kwal_27.9804                                                           45   1e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    44   1e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    45   2e-04
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    45   2e-04
Scas_700.35                                                            44   2e-04
Scas_700.28                                                            45   2e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    45   2e-04
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    45   2e-04
Scas_627.7                                                             44   2e-04
Scas_668.22                                                            45   2e-04
Kwal_23.5290                                                           45   2e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         44   2e-04
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    44   2e-04
Scas_623.11                                                            44   2e-04
Scas_711.15                                                            44   2e-04
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    44   2e-04
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    44   2e-04
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    44   2e-04
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    44   2e-04
Kwal_14.2497                                                           44   3e-04
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    44   3e-04
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    44   3e-04
Scas_477.5                                                             44   3e-04
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       44   3e-04
Scas_613.13*                                                           43   3e-04
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    44   3e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    44   3e-04
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    44   3e-04
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    44   3e-04
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    44   4e-04
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    44   4e-04
Kwal_23.6458                                                           44   4e-04
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    44   4e-04
Scas_667.18                                                            43   4e-04
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    44   4e-04
Scas_201.1*                                                            43   4e-04
Scas_671.16                                                            44   4e-04
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    43   4e-04
Scas_651.3                                                             43   5e-04
Scas_689.22                                                            43   5e-04
Scas_544.6                                                             43   5e-04
Kwal_14.1249                                                           43   5e-04
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            43   5e-04
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    43   5e-04
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    42   5e-04
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    43   5e-04
Scas_593.14d                                                           43   6e-04
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    43   6e-04
Scas_713.38                                                            43   6e-04
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    43   7e-04
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    43   7e-04
Kwal_23.3590                                                           42   7e-04
Kwal_33.13112                                                          42   7e-04
Scas_700.34                                                            43   7e-04
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         42   8e-04
Scas_640.14*                                                           42   9e-04
Scas_720.103                                                           42   9e-04
Kwal_56.22788                                                          42   0.001
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    42   0.001
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    42   0.001
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    42   0.001
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    42   0.001
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    42   0.001
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    42   0.001
KLLA0F22297g complement(2083448..2085547) some similarities with...    42   0.001
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            42   0.001
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    42   0.001
Scas_598.6                                                             42   0.001
Scas_629.16                                                            42   0.002
Kwal_56.24584                                                          41   0.002
Scas_685.24                                                            41   0.002
Kwal_55.22001                                                          41   0.002
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        42   0.002
Kwal_26.7276                                                           42   0.002
Kwal_0.155                                                             41   0.002
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    41   0.002
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         41   0.002
Scas_713.21                                                            41   0.002
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    41   0.002
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    41   0.002
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    41   0.002
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    41   0.002
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    41   0.002
Scas_649.30                                                            41   0.002
Scas_707.34                                                            41   0.002
Scas_718.72                                                            41   0.002
Scas_635.1                                                             40   0.003
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    41   0.003
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          41   0.003
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    41   0.003
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    40   0.003
Kwal_27.10581                                                          41   0.003
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    40   0.003
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    41   0.003
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    41   0.003
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    41   0.003
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    40   0.003
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    40   0.003
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         40   0.003
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    41   0.003
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    40   0.003
Scas_653.25                                                            40   0.003
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    40   0.003
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    40   0.003
Kwal_33.14192                                                          40   0.003
Scas_693.17                                                            40   0.004
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    40   0.004
Scas_602.11                                                            40   0.004
Kwal_47.17868                                                          40   0.004
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    40   0.004
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    40   0.004
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    40   0.004
Scas_584.11                                                            40   0.004
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    40   0.005
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    40   0.005
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    40   0.005
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    40   0.005
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    40   0.005
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    40   0.005
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    40   0.005
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    40   0.005
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    40   0.005
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    40   0.005
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    40   0.006
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    40   0.006
Kwal_17.2687                                                           39   0.006
Scas_715.34                                                            40   0.006
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         39   0.007
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    40   0.007
Kwal_27.11542                                                          40   0.007
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    40   0.007
KLLA0D09328g complement(788565..791705) some similarities with s...    40   0.007
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           40   0.007
KLLA0C03938g complement(358851..360632) some similarities with s...    39   0.007
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    40   0.007
Scas_716.33                                                            39   0.007
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    40   0.007
CAGL0K01661g complement(146952..148400) some similarities with t...    39   0.007
Scas_721.132                                                           39   0.007
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    39   0.007
Kwal_56.23841                                                          39   0.007
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    39   0.007
Scas_705.23                                                            39   0.007
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    39   0.008
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    39   0.008
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    39   0.008
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    39   0.008
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    39   0.008
Scas_707.36                                                            39   0.008
KLLA0C16577g complement(1451181..1452695) some similarities with...    39   0.009
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         39   0.009
Scas_661.27                                                            39   0.009
Kwal_56.23717                                                          39   0.009
Scas_677.18                                                            39   0.010
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    39   0.010
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    39   0.010
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    39   0.010
Kwal_26.7682                                                           39   0.010
Scas_619.5*                                                            39   0.010
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    39   0.010
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    39   0.012
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    39   0.012
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    39   0.012
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    38   0.013
Kwal_55.21900                                                          39   0.014
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    38   0.014
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    39   0.014
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    38   0.015
Scas_584.8                                                             39   0.015
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    38   0.016
Kwal_33.14167                                                          39   0.016
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    38   0.016
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          38   0.016
Scas_336.1                                                             38   0.016
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    38   0.016
Kwal_23.4276                                                           38   0.017
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    39   0.017
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            38   0.017
Kwal_14.1416                                                           38   0.017
Kwal_23.5668                                                           38   0.018
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    38   0.019
Scas_568.9*                                                            37   0.020
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    38   0.021
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    38   0.021
Scas_610.7                                                             38   0.023
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    38   0.025
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    38   0.025
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    38   0.025
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    37   0.026
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    38   0.026
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    38   0.026
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    37   0.027
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    37   0.027
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    37   0.028
Kwal_27.11803                                                          37   0.028
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    37   0.029
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    37   0.030
Kwal_47.17252                                                          37   0.031
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    37   0.031
Kwal_47.17345                                                          37   0.031
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          37   0.032
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    37   0.033
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    37   0.033
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    37   0.035
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    37   0.035
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    37   0.036
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    37   0.037
Scas_703.47                                                            37   0.038
Kwal_47.17263                                                          37   0.038
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    37   0.041
Scas_493.2                                                             37   0.043
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    37   0.043
YGR188C (BUB1) [2139] chr7 complement(872047..875112) Serine/thr...    37   0.045
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    37   0.048
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    37   0.048
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      37   0.050
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    37   0.055
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    37   0.065
Scas_618.15                                                            36   0.066
KLLA0E11979g complement(1060048..1061892) some similarities with...    36   0.067
Scas_564.7                                                             37   0.067
Kwal_23.5576                                                           36   0.073
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    36   0.074
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    36   0.076
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    36   0.077
Kwal_23.3992                                                           36   0.082
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    36   0.084
Scas_689.24                                                            36   0.085
Kwal_55.20221                                                          36   0.086
Scas_573.10                                                            36   0.087
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    36   0.087
KLLA0D12100g complement(1031728..1033161) some similarities with...    36   0.095
Kwal_27.11777                                                          35   0.098
Scas_721.61                                                            35   0.10 
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    36   0.10 
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    35   0.10 
Kwal_27.10004                                                          36   0.10 
Kwal_55.20189                                                          36   0.11 
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    35   0.12 
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    35   0.12 
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    35   0.12 
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    35   0.12 
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    35   0.12 
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    35   0.12 
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    35   0.13 
Scas_695.33                                                            35   0.13 
Kwal_27.12559                                                          35   0.13 
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    35   0.14 
Scas_683.6                                                             35   0.14 
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    35   0.14 
Scas_688.14                                                            35   0.14 
Kwal_23.3471                                                           35   0.15 
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    35   0.15 
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    35   0.16 
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    35   0.16 
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    35   0.16 
Scas_568.13                                                            35   0.16 
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    35   0.17 
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            35   0.17 
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            35   0.18 
Scas_548.6                                                             35   0.19 
Scas_692.24                                                            35   0.19 
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    35   0.20 
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    35   0.21 
Sklu_1883.2 YKL171W, Contig c1883 1300-4338                            35   0.21 
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    35   0.22 
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    35   0.24 
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    34   0.24 
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    34   0.25 
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    35   0.26 
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    34   0.28 
KLLA0A06820g complement(615686..618004) some similarities with s...    34   0.29 
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    34   0.32 
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    34   0.32 
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    34   0.33 
Kwal_56.22476                                                          34   0.33 
Scas_678.24                                                            34   0.38 
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    34   0.38 
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    34   0.40 
CAGL0M08360g complement(833220..835520) some similarities with s...    34   0.43 
Kwal_27.9763                                                           33   0.44 
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    33   0.54 
Kwal_33.13831                                                          33   0.56 
Scas_22.1                                                              33   0.57 
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    33   0.61 
Scas_707.7                                                             33   0.62 

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/537 (86%), Positives = 467/537 (86%)

Query: 1   MSQVQSPLTATNSGLAVNNNTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGNXXXXX 60
           MSQVQSPLTATNSGLAVNNNTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGN     
Sbjct: 1   MSQVQSPLTATNSGLAVNNNTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGNSSASY 60

Query: 61  XXXXXXXXXTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY 120
                    TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY
Sbjct: 61  SGSQSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY 120

Query: 121 RTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 180
           RTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI
Sbjct: 121 RTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 180

Query: 181 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKK 240
           TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKK
Sbjct: 181 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKK 240

Query: 241 SLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 300
           SLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK
Sbjct: 241 SLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEK 300

Query: 301 KRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWM 360
           KRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWM
Sbjct: 301 KRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWM 360

Query: 361 KLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSKNHQYSSPDHHHHYNXXXXXXXXX 420
           KLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSKNHQYSSPDHHHHYN         
Sbjct: 361 KLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSKNHQYSSPDHHHHYNQQQQQQQAQ 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXNRYQLQPDDSHYDEEREASKLDPTSYEAYXXXXXX 480
                                    NRYQLQPDDSHYDEEREASKLDPTSYEAY      
Sbjct: 421 AQAQAQAQAKVQQQQLQQAQAQQQANRYQLQPDDSHYDEEREASKLDPTSYEAYQQQTQQ 480

Query: 481 XXXXXXXXXXXXXXXXFANTGANGQTNKYPYNAQPTANDEQNAKNAAQDRNSNKSSK 537
                           FANTGANGQTNKYPYNAQPTANDEQNAKNAAQDRNSNKSSK
Sbjct: 481 KYAQQQQKQMQQKSKQFANTGANGQTNKYPYNAQPTANDEQNAKNAAQDRNSNKSSK 537

>Scas_654.17
          Length = 523

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/551 (65%), Positives = 394/551 (71%), Gaps = 51/551 (9%)

Query: 1   MSQVQSPLTATNSGLAVNN--NTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGNXXX 58
           MS  Q+  TA N+ +A++N  NT N+ M + SN+RL+NG LP +         N      
Sbjct: 1   MSHHQNSTTA-NTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMT-------PANQTPAST 52

Query: 59  XXXXXXXXXXXTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD 118
                      TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD
Sbjct: 53  ASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD 112

Query: 119 EYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQ 178
           EYRTYKIL GTPG+PQ YYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQ
Sbjct: 113 EYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQ 172

Query: 179 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYRE 238
           MITLIEDLHAHDLIYRDIKPDNFL+GRPG  DANK+HLIDFGMAKQYRDPKTKQHIPYRE
Sbjct: 173 MITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYRE 232

Query: 239 KKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
           KKSLSGTARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIG
Sbjct: 233 KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 292

Query: 299 EKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYD 358
           EKKR TNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLS LDDLG++ADG+YD
Sbjct: 293 EKKRTTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYD 352

Query: 359 WMKLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSK------------NHQYSSPDH 406
           WMKLNGGRGWDL+INKKPNLHGYGHPNPPNEKSKRHR+K              Q +SP H
Sbjct: 353 WMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVAGGNPQQRQTNSPLH 412

Query: 407 HHHYNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRYQLQPDDSHYDEEREASKL 466
             H+                                            +  D ++  ++L
Sbjct: 413 TAHHTPQPPQLQPLQQNQH-----------------------------TENDMQQNEAQL 443

Query: 467 DPTSYEAYXXXXXXXXXXXXXXXXXXXXXXFANTGANGQTNKYPYNAQPTANDEQNAKNA 526
           DPTSYEAY                          GAN    KY + AQPTA  +      
Sbjct: 444 DPTSYEAYQQQTQQKYAQQQKKSQLHQQHTATKQGANINNGKYQHQAQPTAVKQPQRGQQ 503

Query: 527 AQDRNSNKSSK 537
            QD +S+ S+K
Sbjct: 504 QQDESSDHSAK 514

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/399 (80%), Positives = 347/399 (86%), Gaps = 20/399 (5%)

Query: 1   MSQVQ-SP-LTATNSGLAVNNNTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGNXXX 58
           MS+ Q SP +TA N+ +AVNN T N   P  +     NGT  PS   SSN+         
Sbjct: 1   MSRYQNSPAVTAANTAMAVNNLT-NGGYPAMNANAPYNGT--PSNRSSSNMT-------- 49

Query: 59  XXXXXXXXXXXTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD 118
                      TIVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKD
Sbjct: 50  ------SRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKD 103

Query: 119 EYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQ 178
           EYRTYKI+AGTP +PQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQ
Sbjct: 104 EYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQ 163

Query: 179 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYRE 238
           MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPD NK+HLIDFGMAKQYRDPKTKQHIPYRE
Sbjct: 164 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRE 223

Query: 239 KKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
           +KSLSGTARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIG
Sbjct: 224 RKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 283

Query: 299 EKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYD 358
           EKKR TNVYDL+ G P+QFGRYLEIVR+LSFEETPDY+GYR LLLSVLDD+ ++ADG YD
Sbjct: 284 EKKRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYD 343

Query: 359 WMKLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSK 397
           WMKLNGGRGWDL+INKKPNLHGYGHPNPPN+K +RH++K
Sbjct: 344 WMKLNGGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNK 381

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/328 (93%), Positives = 318/328 (96%)

Query: 70  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           TIVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQL+DEY+TYKIL GT
Sbjct: 63  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGT 122

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
           P IP  YYFGQEGLHNILVIDLLGPSLEDLFDWCGR+FSVKTVVQVAVQMITLIEDLHAH
Sbjct: 123 PNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAH 182

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           DLIYRDIKPDNFLIGRPGQPDAN +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 183 DLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 242

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           SINTHLGREQSRRDDMEA+GHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR TNVYDL
Sbjct: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWD 369
           AQGLP+QFGRYLEIVR+LSFEE PDYEGYR LLLSVLDDLGETADGQYDWMKLN GRGWD
Sbjct: 303 AQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWD 362

Query: 370 LSINKKPNLHGYGHPNPPNEKSKRHRSK 397
           L+INKKPNLHGYGHPNPPNEKS++HR+K
Sbjct: 363 LNINKKPNLHGYGHPNPPNEKSRKHRNK 390

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/335 (91%), Positives = 320/335 (95%)

Query: 70  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           TIVGLH+KIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEYRTYKILAGT
Sbjct: 63  TIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGT 122

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            G+PQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH
Sbjct: 123 SGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 182

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           DLIYRDIKPDNFLIGRP QPDANKVHLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 183 DLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYM 242

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           SINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TNVYDL
Sbjct: 243 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDL 302

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWD 369
           +QGLP+QFGRYLEIVRNL FEETPDY+GYR LLLS L++LG   DG+YDWMKLNGGRGWD
Sbjct: 303 SQGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLEELGLEYDGEYDWMKLNGGRGWD 362

Query: 370 LSINKKPNLHGYGHPNPPNEKSKRHRSKNHQYSSP 404
           L+INKKPNLHGYGHPNPPNEK +RHRSK  Q S+P
Sbjct: 363 LTINKKPNLHGYGHPNPPNEKGRRHRSKYPQPSAP 397

>Kwal_33.14596
          Length = 500

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/331 (91%), Positives = 319/331 (96%)

Query: 70  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           TIVGLHY+IGKKIGEGSFGVLFEGTNMING+PVAIKFEPRK+EAPQLKDEYRTYKILAGT
Sbjct: 26  TIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGT 85

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            GIPQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH H
Sbjct: 86  AGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTH 145

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           DLIYRDIKPDNFLIGRPG PD NKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 146 DLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 205

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           SINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR+TNVYDL
Sbjct: 206 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDL 265

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWD 369
           AQGLP+QFGRYLE+VR+L+FEETPDYEGYR L LS+LDD+   ADG+YDWMKLNGGRGWD
Sbjct: 266 AQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWD 325

Query: 370 LSINKKPNLHGYGHPNPPNEKSKRHRSKNHQ 400
           L+INKKPNLHGYGHPNPPN+K++RHRSK  Q
Sbjct: 326 LNINKKPNLHGYGHPNPPNDKNRRHRSKYAQ 356

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/405 (76%), Positives = 336/405 (82%), Gaps = 9/405 (2%)

Query: 1   MSQVQSPLTATNSGLAVNNNTMNSQMPNRSNVRLVNGT-----LPPSLHVSSNLNHNTGN 55
           MS    P   T + L   +  MN    N  + ++++G+      P   +V + L +    
Sbjct: 1   MSITAGPKVTTTAALVNTDRKMN----NHHSTQVLHGSGQHGMQPSGNNVLNGLANGATG 56

Query: 56  XXXXXXXXXXXXXXTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ 115
                         TIVGLHYKIGKKIGEGSFGVLFEG NMIN +PVAIKFEPRKT+APQ
Sbjct: 57  LQSSASSTSTRDDSTIVGLHYKIGKKIGEGSFGVLFEGVNMINNVPVAIKFEPRKTDAPQ 116

Query: 116 LKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV 175
           LKDEYRTYKIL+G+ GIPQ YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFS+KTVV V
Sbjct: 117 LKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSIKTVVHV 176

Query: 176 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIP 235
           A+QMITLIE+LH HDLIYRDIKPDNFLIGRP QPDAN VHLIDFGMAK YRDPKTKQHIP
Sbjct: 177 AIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLIDFGMAKLYRDPKTKQHIP 236

Query: 236 YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYE 295
           YREKKSLSGTARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKA NNK KYE
Sbjct: 237 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAANNKLKYE 296

Query: 296 KIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADG 355
           KIGEKKR TNVYDL+QGLP+QFGRYLEIVRNL FEETPDYEGYR LLLSVLD+LG+  DG
Sbjct: 297 KIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYEGYRKLLLSVLDELGQKLDG 356

Query: 356 QYDWMKLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSKNHQ 400
           +YDWMKLNGGRGWDL+INKKPNLHGYGHP PPNEKSKRHR+K +Q
Sbjct: 357 EYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSKRHRNKFNQ 401

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/327 (88%), Positives = 311/327 (95%)

Query: 70  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           TI GLHY+IGKKIGEGSFGVLFEGTN+ING+PVA+KFEPRKTEAPQLKDEYRTYKILAGT
Sbjct: 35  TIAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGT 94

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
           PG+PQ YYFGQEGLHNILV+DLLGPSLEDLFDWCGR+FS KTVVQVAVQMITLIEDLHAH
Sbjct: 95  PGVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAH 154

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           DLIYRDIKPDNFL+GRPGQPD N +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 155 DLIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 214

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           SINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKR T+VYDL
Sbjct: 215 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDL 274

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWD 369
           A G P+QF RYLEIVRNL F+ETPDYEGYR LL S LDD+GET DG+YDWM+LNGGRGWD
Sbjct: 275 ANGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWD 334

Query: 370 LSINKKPNLHGYGHPNPPNEKSKRHRS 396
           L+INKKPNLHGYGHPNPP +KS R+R+
Sbjct: 335 LTINKKPNLHGYGHPNPPGDKSHRNRN 361

>Scas_697.12
          Length = 529

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/327 (91%), Positives = 313/327 (95%)

Query: 70  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           TIVGLHY+IGKKIGEGSFGVLFEG NMING PVAIKFEPRKTEAPQLKDEYRTYKILAGT
Sbjct: 42  TIVGLHYRIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEYRTYKILAGT 101

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
           P IP  YYFGQEGLHNILVIDLLGPSLEDLFDWC RRFSVKTVVQVAVQMITLIEDLHA+
Sbjct: 102 PNIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMITLIEDLHAN 161

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           DLIYRDIKPDNFLIGRPGQPD N +HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 162 DLIYRDIKPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 221

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           SINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKR TNVYDL
Sbjct: 222 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTNVYDL 281

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWD 369
           AQGLP+QF RYLE+VRNLSFEETPDY GYR LLLS LDDLG++ADG+YDWMKLNGG+GWD
Sbjct: 282 AQGLPVQFARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWMKLNGGKGWD 341

Query: 370 LSINKKPNLHGYGHPNPPNEKSKRHRS 396
           L+INKKPNLHGYGHP PPNEKS+RHR+
Sbjct: 342 LNINKKPNLHGYGHPTPPNEKSRRHRT 368

>Scas_627.4
          Length = 475

 Score =  454 bits (1168), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 255/337 (75%), Gaps = 18/337 (5%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGL---PVAIKFEPRKTEAPQLKDEYRTYKILA 127
           IVG+HY +G KIGEGSFGV+FEG N++      PVAIKFEPR ++APQL+DE+R+YKIL 
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 128 GTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
              GIP  YYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFS+KT   +A QMI  I+D+H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 188 AHDLIYRDIKPDNFLIGR-------------PGQPDANKVHLIDFGMAKQYRDPKTKQHI 234
            HDLIYRDIKPDNFLI +                 D N ++L+DFGMAKQ+RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 235 PYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKY 294
           PYRE+KSLSGTARYMSINTH GREQSRRDD+E++GHVFFYFLRG LPWQGLKA NNK KY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 295 EKIGEKKRLTNVYDLAQG--LPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGET 352
           EKIG  K+  N  DL     +P QF  YL+  R+L FE+ PDY+    L+   L++L   
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 353 ADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNPPNE 389
            DG YDWM LN G+GWD+ INK+ NLHGYG+PNP N+
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRNQ 346

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  446 bits (1147), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 257/340 (75%), Gaps = 22/340 (6%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMING-----LPVAIKFEPRKTEAPQLKDEYRTYKI 125
           +VG+HY +G KIGEGSFG++FEG NM+ G      PVAIKFEPR+++APQL+DE+R Y+I
Sbjct: 9   VVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLRDEFRAYRI 68

Query: 126 LAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185
           L G  GIP+ YYFGQEG+HNIL+IDLLGPSLEDLF+WCGRRFSVKT   +A QMI  +  
Sbjct: 69  LNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAKQMIERVRA 128

Query: 186 LHAHDLIYRDIKPDNFLIGR----------------PGQPDANKVHLIDFGMAKQYRDPK 229
           +H  DLIYRDIKPDNFLI                      DAN ++++DFGMAKQYRDPK
Sbjct: 129 IHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGMAKQYRDPK 188

Query: 230 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPN 289
           TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E++GHVFFYFLRG LPWQGLKAPN
Sbjct: 189 TKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPN 248

Query: 290 NKQKYEKIG-EKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDD 348
           NK KYEKIG  K++L     +++ +P+QF  YL+  R+L F+E PDY+    L+ SV+ D
Sbjct: 249 NKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLISLMDSVMHD 308

Query: 349 LGETADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNPPN 388
           L    +  YDWM LN   GW++++NK+ NLHGYG+P+P N
Sbjct: 309 LNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRN 348

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  446 bits (1146), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/355 (60%), Positives = 255/355 (71%), Gaps = 43/355 (12%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGL-----------------PVAIKFEPRKTEA 113
           IVG+HY +G KIGEGSFGV+FEG N+++                   PVAIKFEPR ++A
Sbjct: 9   IVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDA 68

Query: 114 PQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV 173
           PQL+DE+R Y+IL G  GIP  YYFGQEG+HNIL+IDLLGPSLEDLF+WCGR+FSVKT  
Sbjct: 69  PQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTC 128

Query: 174 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR----------------PGQPDANKVHLI 217
            VA QMI  +  +H HDLIYRDIKPDNFLI +                    D N ++++
Sbjct: 129 MVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMV 188

Query: 218 DFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLR 277
           DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E++GHVFFYFLR
Sbjct: 189 DFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLR 248

Query: 278 GQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLA--QGLPIQFGRYLEIVRNLSFEETPDY 335
           G LPWQGLKAPNNK KYEKIG  K+  N  DL     +P QF  YL+  R+L F+E PDY
Sbjct: 249 GSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDY 308

Query: 336 EGYRMLLLSVLDDLGE----TADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNP 386
           +     L+S++DD         DG YDWM LNGG+GW++ IN++ NLHGYG+PNP
Sbjct: 309 D----YLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNP 359

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  442 bits (1137), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 214/359 (59%), Positives = 259/359 (72%), Gaps = 37/359 (10%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGL--------------------PVAIKFEPRK 110
           +VG+HY +G KIGEGSFGV+FEG N++N                      PVAIKFEPR+
Sbjct: 9   VVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPVAIKFEPRR 68

Query: 111 TEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVK 170
           ++APQL+DE+R Y+IL G  GIP  YYFGQEG+HN+L+IDLLGPSLEDLF+WCG RFSVK
Sbjct: 69  SDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGHRFSVK 128

Query: 171 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGR------PGQ----------PDANKV 214
           T   VA QMI  +  +H  DLIYRDIKPDNFLI         GQ           D N +
Sbjct: 129 TTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSSSNGDPNLI 188

Query: 215 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFY 274
           +++DFGMAKQYRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E++GHVFFY
Sbjct: 189 YVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFY 248

Query: 275 FLRGQLPWQGLKAPNNKQKYEKIG-EKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETP 333
           FLRG LPWQGLKAPNNK KYEKIG  K+RL+    L+ G+P QF  YL+  RNL F+E P
Sbjct: 249 FLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCRNLKFDEDP 308

Query: 334 DYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNPPNEKSK 392
           DY+    L+   L+  G   DG YDWM LN G+GW++ +N++ NLHGYG+P P ++K+K
Sbjct: 309 DYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPTPRDQKAK 367

>Kwal_47.17314
          Length = 421

 Score =  437 bits (1123), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/342 (60%), Positives = 250/342 (73%), Gaps = 19/342 (5%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMIN--GLPVAIKFEPRKTEAPQLKDEYRTYKILAG 128
           IVG+HY +G KIGEGSFGV+FEG N++N    PVAIKFEPR+TEAPQL+DE+R YKIL G
Sbjct: 8   IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEFRAYKILNG 67

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
             GIP+ +YFGQEG+HN+L+IDLLGPSLEDLF+WCGRRFSVKT   +A QMI  ++ +H 
Sbjct: 68  LEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMIRRVQSIHQ 127

Query: 189 HDLIYRDIKPDNFLIGR----------------PGQPDANKVHLIDFGMAKQYRDPKTKQ 232
            DLIYRDIKPDNFLI                      + N V+++DFGMAKQYRDPKTKQ
Sbjct: 128 RDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNPNLVYVVDFGMAKQYRDPKTKQ 187

Query: 233 HIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQ 292
           HIPY+E+KSLSGTARYMSINTH GREQSRRDD+E++GHVFFYFLRG LPWQGLK  N K 
Sbjct: 188 HIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQGLKVANTKL 247

Query: 293 KYEKIGEKKRLTNVYDLAQ-GLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGE 351
           KYEKIG  K+     DL +  +P QF  YL   R+L FEE PDY+    L+   L + G 
Sbjct: 248 KYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMTQALQERGY 307

Query: 352 TADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKR 393
             D  YDW+ LN G+GW++ +N++ NLHGYG+P P   ++ R
Sbjct: 308 EEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAAR 349

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  437 bits (1123), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 205/340 (60%), Positives = 251/340 (73%), Gaps = 20/340 (5%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGL---PVAIKFEPRKTEAPQLKDEYRTYKILA 127
           +VG+HY +G KIGEGSFG++FEG N++NG    PVAIKFEPR++++PQL+DE+R Y+IL 
Sbjct: 9   VVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDEFRAYRILN 68

Query: 128 GTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
              GIP  YYF QEG+HNIL+IDLLGPSLEDLF+WC R+FSVKT   +A QMI  +  +H
Sbjct: 69  DVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQMIDRVRSIH 128

Query: 188 AHDLIYRDIKPDNFLIGR----------------PGQPDANKVHLIDFGMAKQYRDPKTK 231
            HDLIYRDIKPDNFLI                      DAN ++++DFGMAKQ+RDP TK
Sbjct: 129 EHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAKQFRDPNTK 188

Query: 232 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNK 291
           QHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E++GHVFFYFLRG LPWQGLKA NNK
Sbjct: 189 QHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKALNNK 248

Query: 292 QKYEKIG-EKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLG 350
            KYEKIG  K+RL     L   +P QF  YL   R+L F++ PDY+    L+  ++ + G
Sbjct: 249 AKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLMTQIMQENG 308

Query: 351 ETADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNPPNEK 390
              DG YDWM LNGG+GW++ +NK+ NLHGYG+P P N K
Sbjct: 309 YEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTK 348

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  436 bits (1121), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/362 (57%), Positives = 252/362 (69%), Gaps = 46/362 (12%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMIN---------------------------GLPVA 103
           +VG+HY +G KIGEGSFGV+FEG N++N                           G PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 104 IKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWC 163
           IKFEPR ++APQL+DE+R Y+IL G+ GIP  YYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI-----------------GRP 206
           GR+FS+KT   +A QMI  +  +H HDLIYRDIKPDNFLI                  + 
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 207 GQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 266
              D N ++++DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 267 AMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYD--LAQGLPIQFGRYLEIV 324
           ++GHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  +  L+  +P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 325 RNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWDLSINKKPNLHGYGHP 384
           R+L F+E PDY+    L+  VL   G   DG YDWM LN G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 385 NP 386
            P
Sbjct: 377 QP 378

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  322 bits (826), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 206/293 (70%), Gaps = 6/293 (2%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 192 IYRDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           I+RDIKPDNFL  +GR G    + VH+IDFG++K+YRD ++  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYA 180

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           S+NTHLG EQSRRDD+E++G+V  YF +G LPWQGL+A   +QKY++I EKK    V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQL 240

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362
            QGLP++F  Y+   RNL F+E PDY     L   +   L    D  +DW  L
Sbjct: 241 CQGLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDLFIKLEYHNDHLFDWTML 293

>Kwal_56.24064
          Length = 475

 Score =  320 bits (821), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 206/297 (69%), Gaps = 14/297 (4%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  Y+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 192 IYRDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           I+RDIKPDNFL  +GR G    + VH+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           S+NTHLG EQSRRDD+E++G+V  YF +G LPWQGLKA   +QKY++I EKK   NV  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQL 240

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQ----YDWMKL 362
             GLP++F  Y+   RNL F+E PDY    + L  +  DLG   D      +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDY----LYLARLFKDLGIKLDYHNDHLFDWTML 293

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  320 bits (819), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 207/293 (70%), Gaps = 6/293 (2%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 192 IYRDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           I+RDIKPDNFL  +GR G    + VH+IDFG++K++RD +T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYA 180

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           S+NTHLG EQSRRDD+E++G+V  YF +G LPWQGL+A   +QKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQL 240

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362
             GLPI+F  Y+   RNL F+E PDY     L   +   L    D  +DW  L
Sbjct: 241 CVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLEYHNDHLFDWTML 293

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  318 bits (815), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 204/293 (69%), Gaps = 6/293 (2%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 192 IYRDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           I+RDIKPDNFL  +GR G    + VH+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           S+NTHLG EQSRRDD+E++G++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362
             GLP++F  Y+   RNL F+E PDY     L   +   L    D  +DW  L
Sbjct: 241 CAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_720.24
          Length = 473

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/291 (52%), Positives = 203/291 (69%), Gaps = 2/291 (0%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+F+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 192 IYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI 251
           I+RDIKPDNFL+G   +   + VH+IDFG++K+YRD  T +HIPYRE KSL+GTARY S+
Sbjct: 125 IHRDIKPDNFLMGTGRR--GSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASV 182

Query: 252 NTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQ 311
           NTHLG EQSRRDD+E++G++  YF +G LPWQGLKA   KQKY++I EKK   +V  L  
Sbjct: 183 NTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETLCA 242

Query: 312 GLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362
           GLPI+F  Y+   RNL F+E PDY     L   +   L    D  +DW  L
Sbjct: 243 GLPIEFADYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C R+FS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 192 IYRDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           I+RDIKPDNFL  +GR G    + VH+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           S+NTHLG EQSRRDD+E++G+V  YF +G LPWQGLKA   +QKY++I EKK   +V  L
Sbjct: 181 SLNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQL 240

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362
             GLP++F  Y+   RNL F+E PDY     L   +   L    D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  315 bits (808), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R Y+ L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 132 IPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
           IP   +FG+EG +N +VIDLLGPSLEDLF++C RRFS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 192 IYRDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           I+RDIKPDNFL  +GR G    + VH+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDL 309
           S+NTHLG EQSRRDD+E++G+V  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETL 240

Query: 310 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362
             GLP++F  Y+   +NL F+E PDY     L   +   L    D  +DW  L
Sbjct: 241 CSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_690.12
          Length = 488

 Score =  268 bits (685), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 192/289 (66%), Gaps = 3/289 (1%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILA-GTP 130
           VG  Y++G++IG GSFG ++ G ++I+G  +AIK E  +T  PQL+ E R Y  ++ G+ 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 190
           GIP    F +   ++ LV+DLLGPSLEDLF++C R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 191 LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 250
            ++RDIKP+NFL+G   +  AN V+LIDFG++K+YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLGTGRR--ANIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 251 INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLA 310
           +NTH G EQSRRDD+E++G+V  YF +G LPWQGL+A   KQKY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 311 QGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDW 359
           +GLP QF  Y+  VR+L +++ PDY     L  ++ + L  T D  +DW
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDYVYLEQLFKNLSEQLNYTNDYLFDW 291

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 104/222 (46%), Gaps = 29/222 (13%)

Query: 82   IGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEYRTYKILAGTPGIPQE 135
            IG GSFG ++   N+  G  +A+K       +  K   P LK+E R  +IL   P I Q 
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NHPNIVQ- 1322

Query: 136  YYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMITLIEDLHAHD 190
             Y+G E +H    NI +    G SL  L +    R   + V QV  +Q++  +  LH   
Sbjct: 1323 -YYGVE-VHRDKVNIFMEFCEGSSLASLLE--HGRIEDEMVTQVYTLQLLEGLACLHQSG 1378

Query: 191  LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS-----LSGT 245
            +++RDIKP+N L+ R G      +  +DFG AK      +K+       KS     + GT
Sbjct: 1379 VVHRDIKPENILLDRNGV-----IKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGT 1433

Query: 246  ARYMSINTHLGREQSR--RDDMEAMGHVFFYFLRGQLPWQGL 285
              YM+  T  G+   +   DD+ ++G V    + G+ PW  L
Sbjct: 1434 PMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 121/272 (44%), Gaps = 49/272 (18%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILA-----GTP 130
           +K G+++G+GS+  +   T   +G   A+K   ++    Q K +Y T + LA     GT 
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 131 GIPQEYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRRFSVKTVVQVAVQMITL 182
           GI + ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQY-RDPK-TKQHIP---- 235
           ++ LH   +I+RDIKP+N L+      D N KV L DFG AK    +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 236 YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYE 295
           Y + KS  GTA Y+S           R D+ A G + +  L G+ P+   KA N    ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 296 KIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNL 327
           K+ + +     Y    G P       +IV++L
Sbjct: 348 KVMKIQ-----YAFTAGFP-------QIVKDL 367

>Scas_618.8
          Length = 427

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEYRTYKILAGT 129
           Y+ GK +G GSFGV+ E T   N   VAIK       E  + +   L DE    K L   
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHHP 86

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 187
             +  + +F  E    I ++  L    E LFD   +  RFS    V++ +Q+++ +E +H
Sbjct: 87  NIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQILSAVEYIH 143

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA- 246
           + D+++RD+KP+N L     + + +++ + DFG+AK+    K  + + ++   SL   A 
Sbjct: 144 SRDIVHRDLKPENLL--YLTEKEDSELVIADFGIAKEL---KKGEQLIFKAAGSLGYVAP 198

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRG 278
             ++++ H      +  D+ ++G + +  L G
Sbjct: 199 EVLTVDGH-----GKPCDIWSIGVITYTLLSG 225

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 102/230 (44%), Gaps = 22/230 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYK-----ILA--G 128
           +   +++G GS+  +++  +   G   AIK   +K    + K +Y T +     +LA   
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 129 TPGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
            PGI + YY   +  +   V+D   G  L  L    GR F+         Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 247
              +++RD+KP+N L+   G     K+ + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLSSEG-----KLMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 248 YMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>Kwal_23.6325
          Length = 1542

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 110/232 (47%), Gaps = 29/232 (12%)

Query: 72   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVA---IKFEPRKTEA---PQLKDEYRTYKI 125
            V + ++  + +G G+FG +F   N+  G  +A   IK + RK+     P +K+E    ++
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 126  LAGTPGIPQEYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 180
            L   P + Q  Y+G E +H    N+ +    G SL  L +    R   + V Q+ A+QM+
Sbjct: 1305 L-NHPNVVQ--YYGVE-VHRDKVNLFMEYCEGGSLAQLLE--HGRIEDEMVTQIYALQML 1358

Query: 181  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKK 240
              +  LH   +++RDIKP+N L+   G      +  +DFG A+      TK      E K
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILLDFNGV-----IKYVDFGAARSLAANGTKAPNVGAEGK 1413

Query: 241  -----SLSGTARYMSINTHLGREQSR--RDDMEAMGHVFFYFLRGQLPWQGL 285
                 S+ GT  YMS  +  G ++ +    D+ ++G V    + G+ PW  L
Sbjct: 1414 ADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 107/232 (46%), Gaps = 32/232 (13%)

Query: 72   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVA---IKFEPRKTEA---PQLKDEYRTYKI 125
            V + ++    IG GSFG ++   N+  G  +A   IKF  RKT     P ++DE    ++
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEM 1246

Query: 126  LAGTPGIPQEYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 180
            L   P + Q  Y+G E +H    NI +    G SL  L      R   + V QV ++QM+
Sbjct: 1247 L-NHPNVVQ--YYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQML 1300

Query: 181  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTK-----QHIP 235
              +  LH   + +RDIKP+N L+   G      +  +DFG AK      +K     QH+ 
Sbjct: 1301 EGLAYLHESGVDHRDIKPENILLDFNG-----IIKYVDFGAAKVLASNGSKKLNLEQHM- 1354

Query: 236  YREKKSLSGTARYMSINTHLGREQSR--RDDMEAMGHVFFYFLRGQLPWQGL 285
              E + + GT  YMS     G    +   DD+ ++G V    + G+ PW  L
Sbjct: 1355 --EGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 106/215 (49%), Gaps = 22/215 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT----EAPQLKDEYRTYKILAGTPG 131
           Y  GK +G G+FGV+ +  N      VAIK   ++     E   L DE    + L   P 
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKL-DHPN 114

Query: 132 IPQ--EYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 187
           I +  +++  +E  + +  +   G    +LFD   ++  F+    V++ VQM+T +E +H
Sbjct: 115 IVKFKDWFESREKFYIVTQLATGG----ELFDRILKKGKFTETDAVKIVVQMLTAVEYMH 170

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 247
           + ++++RD+KP+N L   P   D +++ + DFG+AKQ     ++  + +R     +G+  
Sbjct: 171 SQNVVHRDLKPENVLYLDPS--DESQLVISDFGIAKQL---SSESQLIHRA----AGSMG 221

Query: 248 YMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           Y++          +  D+ ++G + +  L G  P+
Sbjct: 222 YVAPEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Scas_660.20
          Length = 957

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 106/231 (45%), Gaps = 21/231 (9%)

Query: 76  YKIGKKIGEGSFGVLFEG-----TNMINGLPVAIKFEP-RKTEAPQLKDEYRTYKILAGT 129
           +   +++G GS+  +++      T  I  + V  K    ++++   +  E  T  +LA  
Sbjct: 11  FIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKA 70

Query: 130 --PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 186
             PGI + YY   +  +   V+D L G  L  L     + FS        VQ++  +E +
Sbjct: 71  HHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFI 129

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H+  +I+RD+KP+N L+ R G     K+ + DFG A          +   +   S  GTA
Sbjct: 130 HSQGVIHRDLKPENVLLDRDG-----KLMITDFGAAYTTTAGNNDAN---KSSSSFVGTA 181

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            Y+S    L  + S   D+ A+G + F F+ G  P++G    N  + +EKI
Sbjct: 182 EYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG---ENELKTFEKI 229

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 104/229 (45%), Gaps = 41/229 (17%)

Query: 79   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 124
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              LK E  T K
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVK----QVEVPKYGTQNELVKDMVEALKSEVATLK 1209

Query: 125  ILAGTPGIPQEYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 181
             L     I Q  Y G E   NI  + L    G S+  L    GR F  K +  +  Q+++
Sbjct: 1210 DLDHL-NIVQ--YLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLS 1265

Query: 182  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
             ++ LH+  +++RD+K DN L+   G        + DFG++K+ ++  +   +  R    
Sbjct: 1266 GLKYLHSKGILHRDMKADNLLLDEDGI-----CKISDFGISKKSKNIYSNSDMTMR---- 1316

Query: 242  LSGTARYMS---INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
              GT  +M+   ++T  G   S + D+ ++G V      G+ PW  L+ 
Sbjct: 1317 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1361

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 111/239 (46%), Gaps = 28/239 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMI---NGLP---VAIKFEPRKTEAPQLKDEYRTYK----- 124
           +   +++G GS+  +++  +     +GLP    AIK   +K    + K +Y T +     
Sbjct: 10  FIFKEQLGHGSYSTVYKALDKARNNSGLPQHFYAIKVCSKKHIIRENKVKYVTIEKNTLN 69

Query: 125 ILA--GTPGIPQEYYF--GQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQM 179
           +LA    PGI + YY    QE L+   V+D   G  L  L    G  F          Q+
Sbjct: 70  LLAQGNNPGIVKLYYTFHDQENLY--FVLDYAPGGELLHLLQRYGT-FDEVWSKHFMCQL 126

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
           + ++E +H+  +I+RD+KP+N L+ + G     ++ + DFG A       T       E+
Sbjct: 127 VDVVEYIHSKGVIHRDLKPENVLLSKDG-----RLMVTDFGAASVVTTDGTSSDNSVSER 181

Query: 240 -KSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
             S  GTA Y+S    L  +     D+ A+G + + F++G  P++G    N  Q +EKI
Sbjct: 182 AASFVGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQTFEKI 237

>Kwal_56.24059
          Length = 353

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 109/233 (46%), Gaps = 28/233 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 129
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKEQVIRMKQIEHTNDERRMLK-LVDH 100

Query: 130 PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
           P + + +   Q+  +  +V+D + G  L  L     +RF        A ++I  +E LH+
Sbjct: 101 PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
           HD+IYRD+KP+N L+ R G      + + DFG AK+  D  T          +L GT  Y
Sbjct: 160 HDIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 204

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 301
           ++      +  ++  D  ++G + F  L G  P+         + YEKI + K
Sbjct: 205 IAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>Kwal_26.7355
          Length = 1446

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 106/229 (46%), Gaps = 41/229 (17%)

Query: 79   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 124
            G+ IG+GSFG +F G N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVK----QVEVPRYGSQDETTLSVLEALRSEVATLK 1204

Query: 125  ILAGTPGIPQEYYFGQEG---LHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 181
             L  T  I Q  Y G E    ++++ +  + G S+  L    G +F    +  +AVQ++ 
Sbjct: 1205 DLDHT-NIVQ--YLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLR 1260

Query: 182  LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
             +  LH+  +++RD+K DN L+   G        + DFG++K+  +  +   +  R    
Sbjct: 1261 GLSYLHSKKILHRDMKADNLLLDVDGI-----CKISDFGISKKSNNIYSNSDMTMR---- 1311

Query: 242  LSGTARYMS---INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
              GT  +M+   ++T  G   S + D+ ++G V      G+ PW  L+ 
Sbjct: 1312 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1356

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 120/275 (43%), Gaps = 43/275 (15%)

Query: 79   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEY-- 136
            G+ IG+GSFG ++   N+  G  +A+K    + E P+   +     IL+    +  E   
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQNEA--ILSTVEALRSEVST 1231

Query: 137  -----------YFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSVKTVVQVAVQMITL 182
                       Y G E  +NI  + L    G S+  L    GR F    +  +  Q++  
Sbjct: 1232 LKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKG 1290

Query: 183  IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 242
            +  LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R     
Sbjct: 1291 LAYLHSKGILHRDMKADNLLLDQDGI-----CKISDFGISRKSKDIYSNSDMTMR----- 1340

Query: 243  SGTARYMS---INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGE 299
             GT  +M+   ++T  G   S + D+ ++G +      G+ PW  L+         KIG+
Sbjct: 1341 -GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV---VAAMFKIGK 1394

Query: 300  KKRLTNVYDLAQGLPIQFGR-YLEIVRNLSFEETP 333
             K    + +    L  Q GR +L+    ++ E+ P
Sbjct: 1395 SKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 110/233 (47%), Gaps = 28/233 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 129
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVKMKQVEHTNDERRMLK-LVEH 127

Query: 130 PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
           P + + +   Q+  +  +V+D + G  L  L     +RF        A ++I  +E LHA
Sbjct: 128 PFLIRMWGTFQDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHA 186

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
           H++IYRD+KP+N L+ R G      + + DFG AK+       Q + +    +L GT  Y
Sbjct: 187 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV------QTVTW----TLCGTPDY 231

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 301
           ++      +  ++  D  ++G + +  L G  P+         + YEKI + K
Sbjct: 232 IAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILQGK 281

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 111/251 (44%), Gaps = 27/251 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKIL--AG 128
           +K G+ +G+GS+  +   T + +G   A K   ++    Q K +Y      T + L  + 
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 185
            PG+ + Y+  Q+   N+  +    P+ +  F    +RF   S +       Q++  I  
Sbjct: 260 VPGVIKLYFTFQDEA-NLYFLLEYAPNGD--FLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY-RDPKTKQHIPYREKKSLSG 244
           LH   +I+RD+KP+N L+ +       K+ L DFG AK   R+ + K +      KS  G
Sbjct: 317 LHKQGIIHRDVKPENILLDK-----TMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVG 371

Query: 245 TARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLT 304
           TA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+     + 
Sbjct: 372 TAEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKV-----MR 423

Query: 305 NVYDLAQGLPI 315
             Y    G P+
Sbjct: 424 VQYAFTAGFPM 434

>Kwal_33.13846
          Length = 375

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTP 130
           + I + +G GSFG +    +  NG   A+K   ++T     +     DE R   +++  P
Sbjct: 65  FHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSH-P 123

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            I + +   Q+  H  +++D + G  L  L     +RF        A ++   +E LHA 
Sbjct: 124 FIIRMWGTFQDAEHVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHAQ 182

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           D+IYRD+KP+N L+ + G      V + DFG AK   D      + Y    +L GT  Y+
Sbjct: 183 DIIYRDLKPENVLLDKNGH-----VKITDFGFAKFVPD------VTY----TLCGTPDYI 227

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +      +  ++  D  + G + F  L G  P+      N  + YE I
Sbjct: 228 APEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMKTYENI 272

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 120/266 (45%), Gaps = 43/266 (16%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILAGTP 130
           +K G+ +G+GS+  +   T+  +G   A+K     +  R+ +   +  E  T + L  + 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 131 GIPQEYYFGQEGLHNILVI------DLLG--PSLEDLFDWCGRRFSVKTVVQVAVQMITL 182
           G+ + Y+  Q+      ++      D L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY-RDPKTKQHIPYREKKS 241
           I+ +H + +++RDIKP+N L+      +  KV L DFG AK   RD K+  ++  ++ +S
Sbjct: 294 IDFIHKNGVVHRDIKPENILLD-----EHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSRS 347

Query: 242 LSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 301
             GTA Y+S         + + D+ A G + +  + G+ P+   KA N    ++K+ + +
Sbjct: 348 FVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKVQ 404

Query: 302 RLTNVYDLAQGLPIQFGRYLEIVRNL 327
                Y    G P+       ++R+L
Sbjct: 405 -----YAFTAGFPL-------VIRDL 418

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 104/216 (48%), Gaps = 22/216 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKILAGT--P 130
           Y  GK +G GSFGV+ +   +  G  VA+K   +K       QL+  Y    IL     P
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLNHP 105

Query: 131 GIPQ--EYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 186
            I +  +++  +E  + +  +   G    +LFD   ++  F+    V++ VQ++  +E L
Sbjct: 106 NIVKFKDWFESKEKFYIVTQLATGG----ELFDRILQKGKFTEVDAVKIVVQILKAVEYL 161

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H+ ++++RD+KP+N L     + D +++ L DFG+AK+ ++     H         +G+ 
Sbjct: 162 HSRNIVHRDLKPENLL--YLDKSDNSQLVLGDFGIAKELKNDGDLIH-------KAAGSM 212

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
            Y++          +  D+ ++G + +  L G  P+
Sbjct: 213 GYVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 108/229 (47%), Gaps = 28/229 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 129
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVL-KKQQVIRMKQIEHTNDERRMLKVVEH- 93

Query: 130 PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
           P + + +   Q+  +  +V+D + G  L  L     +RF        A ++   +E LHA
Sbjct: 94  PFLIRMWGTFQDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHA 152

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
           H++IYRD+KP+N L+ R G      + + DFG AK+  D  T          +L GT  Y
Sbjct: 153 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 197

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           ++      +  ++  D  ++G + F  L G  P+  +      + YEKI
Sbjct: 198 IAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV---TPIKTYEKI 243

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 108/252 (42%), Gaps = 37/252 (14%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKF--------EPRKTEAPQLKDEYRTYKILA 127
           YK+G+ I  GSF V+    +   G  VA+K+        E  +  A  + +EY   + L 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 128 GTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-----AVQMITL 182
               I Q   F ++    + V++    +  DL+D+  +    +  +++       Q+ + 
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFI-KAIRERPTMRINFHSFLFQLCSA 123

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 242
           I   H+ D+ +RDIKP+N L+   GQ     V L DFG+++          I    K   
Sbjct: 124 ISYCHSKDVSHRDIKPENVLMDDRGQ-----VKLTDFGLSQ----------IGSVSKDYC 168

Query: 243 SGTARYMSINTHLGRE--QSRRDDMEAMGHVFFYFLRGQLPWQGLK--APNNKQKYEK-I 297
            GT +Y++  T L RE   +   D  ++G   F  + G  P++     AP     +++ I
Sbjct: 169 IGTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFI 227

Query: 298 GEKKRLTNVYDL 309
            +  R    Y L
Sbjct: 228 RDPHRFVESYYL 239

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 108/241 (44%), Gaps = 28/241 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPV-AIKFEPRKTEAPQLKDEYRTYK-----ILAGT 129
           +   +++G GS+  +F+  +  +   + AIK   +K    + K +Y T +     +LA  
Sbjct: 11  FIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQK 70

Query: 130 --PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 186
              GI + YY   +  +   V+D   G  L  L    G  F+         Q+I  +E +
Sbjct: 71  HHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGT-FNDIWTRHFTAQLIDALEFI 129

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPY---------- 236
           H+H +I+RD+KP+N L+ R G     ++ + DFG A       +     +          
Sbjct: 130 HSHGIIHRDLKPENVLLDRDG-----RLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDN 184

Query: 237 REKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEK 296
           +   S  GTA Y+S    L  +     D+ A+G + + F++GQ P++G    N  + +EK
Sbjct: 185 QNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRG---ENELKTFEK 241

Query: 297 I 297
           I
Sbjct: 242 I 242

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 103/237 (43%), Gaps = 34/237 (14%)

Query: 72   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEYRTYKI 125
            V + ++    IG G+FG ++   N+ NG  +A+K          K   P +K+E    ++
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEM 1089

Query: 126  LAGTPGIPQEYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 180
            L   P I Q  Y+G E +H    NI +    G SL  L D    R   + V QV   +++
Sbjct: 1090 L-NHPNIVQ--YYGVE-VHRDKVNIFMEYCEGGSLASLLD--HGRIEDEMVTQVYTFELL 1143

Query: 181  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQH------- 233
              +  LH   +++RDIKP+N L+   G      +  +DFG A+     +T+         
Sbjct: 1144 EGLAYLHQSGVVHRDIKPENILLDFNG-----IIKYVDFGTARTVVGSRTRTVRNAAVQD 1198

Query: 234  --IPYREKKSLSGTARYMSINTHLGREQSRR---DDMEAMGHVFFYFLRGQLPWQGL 285
              +  +    + GT  YM+  T  G     +   DD+ A+G V      G+ PW  L
Sbjct: 1199 FGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>Scas_502.2
          Length = 1116

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 116/261 (44%), Gaps = 32/261 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILA-----GTP 130
           +K G+ +G+G++  +   T+  +G   A+K   ++    Q K +Y   + LA      + 
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHA 188
            I + ++  Q+      +++   P+  DL     +  S+  +       Q+I  I+ +H+
Sbjct: 234 SIIRLFFTFQDEASLYFLLEY-APN-GDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY--RDPKTKQHIPYREKKSLSGTA 246
             +I+RDIKP+N L+ +       KV + DFG AK    + P T   +  R  KS  GTA
Sbjct: 292 KGIIHRDIKPENILLDKDM-----KVKITDFGTAKILDNKPPGTSYDLLTRS-KSFVGTA 345

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNV 306
            Y+S           R D+ A G + F  + G+ P+   KA N    ++K+ + +     
Sbjct: 346 EYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 397

Query: 307 YDLAQGLPIQFGRYLEIVRNL 327
           Y    G P        +VR+L
Sbjct: 398 YAFTAGFPT-------VVRDL 411

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 115/273 (42%), Gaps = 53/273 (19%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKILAGTP 130
           +K G+ +G+G++  +   T   +G   A+K   ++    Q K +Y        + L  + 
Sbjct: 182 FKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSR 241

Query: 131 GIPQEYYFGQE--GLHNIL----------VIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQ 178
           GI + ++  Q+   L+ +L          V+   G   ED    C R +S         Q
Sbjct: 242 GIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSED----CTRYYSA--------Q 289

Query: 179 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIP--- 235
           +I  I+ LH+  +I+RDIKP+N L+ +       KV + DFG AK        +  P   
Sbjct: 290 IIDGIKYLHSKGIIHRDIKPENILLDKDM-----KVKITDFGTAKILEPKNEDEDNPEFN 344

Query: 236 -YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKY 294
                KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    +
Sbjct: 345 LLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF---KATNEYLTF 401

Query: 295 EKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNL 327
           +K+ + +     Y    G P+       +VR+L
Sbjct: 402 QKVMKVQ-----YAFTAGFPV-------VVRDL 422

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEP-----RKTEAPQLKDEYRTYKILAGTP 130
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE R  K L   P
Sbjct: 62  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLK-LVEHP 120

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + +   Q+  +  +V+D + G  L  L     +RF        A ++   +E LH+H
Sbjct: 121 FLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSH 179

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           ++IYRD+KP+N L+ R G      + + DFG AK+                +L GT  Y+
Sbjct: 180 NIIYRDLKPENILLDRNGH-----IKITDFGFAKEV----------ITVTWTLCGTPDYI 224

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +      +  ++  D  ++G + F  L G  P+  +      + YEKI
Sbjct: 225 APEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTP---MKTYEKI 269

>Kwal_0.96
          Length = 427

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 100/215 (46%), Gaps = 20/215 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------TEAPQLKDEYRTYKILAGT 129
           Y  GK +G GSFGV+ +   + +G  VAIK   +K       E   L DE    + L   
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDHP 105

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLH 187
             +  + +F  E      ++  L    E LFD   +  +F+ +  V++  Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 247
           + ++++RD+KP+N L     +   +++ L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLY--LTEAADSQLVLGDFGIAKELKNDDELIH-------KAAGSMG 213

Query: 248 YMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           Y++          +  D+ ++G V +  L G  P+
Sbjct: 214 YVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>Kwal_56.22693
          Length = 984

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 116/260 (44%), Gaps = 30/260 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILAGTP 130
           ++ G+ +G+GS+  +    +  +G   A+K     +  R+ +   +  E  T + L    
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 131 GIPQEYYFGQE--GLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
           G+ + Y+  Q+   L+ +L     G  L  +  +     S +  V  + Q++  I+ LH 
Sbjct: 218 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGS--LSQECAVYYSAQILDAIDYLHH 275

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK-KSLSGTAR 247
             +++RDIKP+N L+ +       KV L DFG A+     +T Q     E+ KS  GTA 
Sbjct: 276 KGIVHRDIKPENILLDK-----DMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAE 330

Query: 248 YMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVY 307
           Y+S           + D+ A G + F  + G+ P+   KA N    ++K+ + +     Y
Sbjct: 331 YVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ-----Y 382

Query: 308 DLAQGLPIQFGRYLEIVRNL 327
               G P+       ++R+L
Sbjct: 383 AFTAGFPL-------VIRDL 395

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGT---PG 131
           ++IGK +G+G FG ++   ++ +G   A+K  E +      ++ ++R    +  +   P 
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPN 168

Query: 132 IPQEY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV-QMITLIEDLHAH 189
           + Q Y YF  E    +L+  L+   L       GR      V    V QM   ++ +H  
Sbjct: 169 LTQLYGYFHDEKRVYLLMEYLVNGELYKHLK--GRSHFNDVVASYYVYQMADALDYMHER 226

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           ++++RDIKP+N +IG       N + L DFG +     PK  +      +K+L GT  Y+
Sbjct: 227 NILHRDIKPENIIIGF-----NNTIKLTDFGWS--VITPKGSK------RKTLCGTVDYL 273

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           S      RE + + D+ A+G + +  L G  P++
Sbjct: 274 SPELIRSREYNEKVDVWALGVLTYELLVGSPPFE 307

>Kwal_47.18307
          Length = 621

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 107/232 (46%), Gaps = 23/232 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMIN-GLPVAIKFEPRKTEAPQLKDEYRTYK-----ILA-- 127
           Y    ++G+GS+  ++      N G   AIK   +K    + K +Y T +     +LA  
Sbjct: 10  YVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLAKG 69

Query: 128 GTPGIPQEY--YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185
           G  GI + +  +   E L+ +L   + G  L  L    GR  +      +  Q++  ++ 
Sbjct: 70  GHLGIVKLFCTFHDIENLYFVLEY-VSGGELLALIQRLGR-LTEDLSRHITAQLVDTVDY 127

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245
           +H+  +I+RD+KP+N L+ + G     +V + DFG A    D K +     +   S  GT
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEG-----RVVITDFGAACTAADRKFENT---KRTASFVGT 179

Query: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           A Y+S    L  +     D+ A+G + +   +G+ P++G    N  Q +EKI
Sbjct: 180 AEYVSPELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQTFEKI 228

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 111/249 (44%), Gaps = 35/249 (14%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGL-PVAIKFEPRKTEAPQLKDEYRTYK-----ILA- 127
            +   +++G GS+  +++  +  +   P AIK   ++    + K +Y T +     +LA 
Sbjct: 10  EFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLAR 69

Query: 128 -GTPGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185
              PGI + YY   +  +   V+D   G  L  L    G  F+       A Q++  +E 
Sbjct: 70  GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGT-FTDSWAKHFAAQLVDTLEF 128

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQH--------IP-- 235
           +HA  +I+RD+KP+N L+ + G      + + DFG A    +   K +        IP  
Sbjct: 129 MHARGVIHRDLKPENVLLSKEGI-----LMITDFGAAATQNNFSDKDNTRSNANEGIPKD 183

Query: 236 -------YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAP 288
                    E  S  GTA Y+S    L  + S   D+ A+G + + F++G  P++G    
Sbjct: 184 DVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRG---E 240

Query: 289 NNKQKYEKI 297
           N  + +EKI
Sbjct: 241 NELKTFEKI 249

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 99/228 (43%), Gaps = 33/228 (14%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           +   +K  + IG G FG++++G ++      AIK     +   +++D  R  + LA    
Sbjct: 12  ISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQFLASLKQ 71

Query: 132 IPQ-EYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQVAVQMI 180
           IP    Y+G           L G SL  + ++C            +   K +  +  +++
Sbjct: 72  IPNITRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 122

Query: 181 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKK 240
             ++ +H  ++I+RDIK  N LI   GQ     V L DFG+A Q      +       ++
Sbjct: 123 VALKVIHKDNVIHRDIKAANVLITNEGQ-----VKLCDFGVAAQLNQTSLR-------RQ 170

Query: 241 SLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
           +++GT  +M+    + G     + D+ ++G   +    G  P+  ++A
Sbjct: 171 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 118/295 (40%), Gaps = 44/295 (14%)

Query: 28  NRSNVRLVNGTLPPSLHVSSNLNHNTGNXXXXXXXXXXXXXXTIVGLHYKIGKK------ 81
           N  ++ L    L P++H +SN++H                   +V  HY + KK      
Sbjct: 279 NHEDMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQ 338

Query: 82  -------IGEGSFGVLFEGTNMINGLPVAIKFEPRKT--EAPQLKDEYRTYKILAGTPGI 132
                  +G+G+FG +++          A+K   +K   +  ++        IL  T   
Sbjct: 339 DFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSK 398

Query: 133 PQEYYFG-----QEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIED 185
              +  G     Q      LV D +  S  +LF    R  RF+         +++  +E 
Sbjct: 399 ASPFIVGLKFSFQTPTDLYLVTDYM--SGGELFWHLQREGRFTEDRAKFYIAELVLALEH 456

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
           LH +D++YRD+KP+N L+      DAN  + L DFG++K     +T          +  G
Sbjct: 457 LHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT---------NTFCG 501

Query: 245 TARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
           T  Y++    L     ++  D  ++G + F    G   W    A +N++ Y+KI 
Sbjct: 502 TTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFYAEDNQKMYQKIA 553

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 81/158 (51%), Gaps = 22/158 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y++ KKIG G +  +F+G +++N +P  IK  +P K     +K  YR  K+L    G P 
Sbjct: 51  YEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVK-----MKKIYRELKVLTNLTGGPN 105

Query: 135 EYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDLH 187
                  GL +I+      +  L+   ++++ F      F++        Q++T ++  H
Sbjct: 106 II-----GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYCH 160

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +++RD+KP N +I     P+  K+ LID+G+A+ Y
Sbjct: 161 SMGIMHRDVKPQNVMI----DPNERKLRLIDWGLAEFY 194

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 105/233 (45%), Gaps = 23/233 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKILAGTP 130
           +K G+ +G+GS+  +   T++ +    A+K   ++    Q K +Y      T + L  T 
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHA 188
           GI   Y+  Q+      +++   P+  DL     +  SV  K     A Q+I  +  +H 
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 189 HDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQYRDPKTKQHIPY---REKKSLSG 244
             +I+RD+KP+N L+      D + KV L DFG A+   D  ++  + Y       S  G
Sbjct: 273 KGVIHRDLKPENILL------DVDMKVKLTDFGTAR-LLDSTSEDDLKYDLLTRSNSFVG 325

Query: 245 TARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           TA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 326 TAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKV 375

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 101/224 (45%), Gaps = 41/224 (18%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGT---PG 131
           ++IGK +G+G FG ++   +   GL  A+K  E ++     ++ ++R    + G+     
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKN 159

Query: 132 IPQEYYFGQEGLHNILVIDLL------------GPSLEDLFDWCGRRFSVKTVVQVAVQM 179
           + Q Y F  +     L+++ +            GP  E L  +               QM
Sbjct: 160 LTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASY------------FVYQM 207

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
              ++ +H+ ++++RDIKP+N LIG       N + L DFG +    D +        ++
Sbjct: 208 ANALDYMHSKNILHRDIKPENILIGF-----NNTIKLTDFGWSVYNEDGQ--------KR 254

Query: 240 KSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           K+L GT  Y+S      RE + + D+ A+G + +  L G  P++
Sbjct: 255 KTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPPFE 298

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 101/221 (45%), Gaps = 19/221 (8%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           V   +K  + IG G FGV+++G N+  G   AIK     +++ +++D  R  + LA    
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 132 IPQ-EYYFG---QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
           I     Y+G   ++    I++    G SL  L      +   K +  +  +++  ++ +H
Sbjct: 79  ISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLR--PGKIDEKYIGVIMRELLVALKCIH 136

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 247
             ++I+RDIK  N LI   G      V L DFG+A Q      +       +++++GT  
Sbjct: 137 KDNVIHRDIKAANVLITNEGN-----VKLCDFGVAAQVNQTSLR-------RQTMAGTPY 184

Query: 248 YMSINTHL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
           +M+    + G     + D+ ++G   +    G  P+  ++A
Sbjct: 185 WMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 106/250 (42%), Gaps = 52/250 (20%)

Query: 74  LH-YKIGKKIGEGSFGVLFE--GTNMINGLPVAIKFEPRK----------------TEAP 114
           LH YK+  KIGEG+F  +F+  G N  +  PVAIK   +K                +   
Sbjct: 118 LHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRK 177

Query: 115 QLKDEYRTYKILA-GTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKT 171
           ++ +E   +K+++   P   +   F +   +  LV +L+     ++FD   +   FS   
Sbjct: 178 KVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDL 235

Query: 172 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI---------GRPGQPD----------AN 212
              V  Q+   I+ +H   +++RD+KP+N L          G   + D            
Sbjct: 236 ARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIG 295

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVF 272
            V L+DFG+AK+ R+            K+  GT  Y++      +  S + DM ++G V 
Sbjct: 296 LVKLMDFGLAKKLRN---------NTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVL 346

Query: 273 FYFLRGQLPW 282
           F  L G  P+
Sbjct: 347 FTLLCGYPPF 356

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 104/228 (45%), Gaps = 22/228 (9%)

Query: 80  KKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYK-----IL--AGTPGI 132
           +++G GS+  ++      +    AIK   ++    + K +Y T +     +L  A  PGI
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 133 PQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
            + YY   +  +   V+DL  G  L  L     R FS         Q++  +E +H+  +
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLR-RQRVFSEAWARHYMCQLVDTVEYIHSMGV 132

Query: 192 IYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY--RDPKTKQHIPYREKKSLSGTARYM 249
           I+RD+KP+N L+ + G     ++ + DFG A      D  +    P     S  GTA Y+
Sbjct: 133 IHRDLKPENVLLDKEG-----RLMIADFGAAYTVGQSDAGSDGDKP---ATSFVGTAEYV 184

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           S    L  +     D+ A+G + + FL+G  P++G    N  + +E+I
Sbjct: 185 SPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRG---QNEMETFEQI 229

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 111/270 (41%), Gaps = 47/270 (17%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILAGTP 130
           +K G  IG+G++  +   T++      A K     +  R+ +   +  E    + L  +P
Sbjct: 179 FKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSP 238

Query: 131 GIPQEY---------YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 181
            + + +         YF  E   N   + L+      L + C R +        A Q+I 
Sbjct: 239 SVVRLFSTFQDESSLYFLLEYAPNGDFLSLMK-KYGSLDETCARYY--------AAQIID 289

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIP----YR 237
            I+ LH++ +I+RDIKP+N L+   G+    K+ L DFG AK           P      
Sbjct: 290 AIDYLHSNGIIHRDIKPENILLD--GE---MKIKLTDFGTAKLLNPTNNSVSKPEYDLST 344

Query: 238 EKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
             KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 345 RSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKV 401

Query: 298 GEKKRLTNVYDLAQGLPIQFGRYLEIVRNL 327
            + +     Y    G P+       I+R+L
Sbjct: 402 MKVQ-----YAFTPGFPL-------IIRDL 419

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 100/231 (43%), Gaps = 29/231 (12%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     T  I  L    K +   K+E      E RT       P
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARIDCP 428

Query: 131 GI-PQEYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDL 186
            I P ++ F  QE L+ +L     G    +LF    R  RF +      A +++  ++ L
Sbjct: 429 FIVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTL 484

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H  D+IYRD+KP+N L+   G      + L DFG+ K     + K         +  GT 
Sbjct: 485 HKMDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDEDKTD-------TFCGTP 532

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            Y++    LG+  S+  D   +G + +  L G  P+     P   + Y+KI
Sbjct: 533 EYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP---KMYKKI 580

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 103/238 (43%), Gaps = 33/238 (13%)

Query: 78  IGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIPQE 135
           I + +G+G+F  + +      G   A+K   ++     +    R  ++L     P I + 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRL 259

Query: 136 YYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHAHDLIY 193
             F ++     +V++ +  S  DL D+     +V      +++ Q++T I+ +H+  + +
Sbjct: 260 KGFYEDTESYYMVMEFV--SGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISH 317

Query: 194 RDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 253
           RD+KPDN LI    Q D   V + DFG+AK   +            K+  GT  Y++   
Sbjct: 318 RDLKPDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEV 366

Query: 254 HLGR-------------EQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
             G+             E S   DM +MG + +  L G LP+ G       Q Y++IG
Sbjct: 367 IRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQDQLYKQIG 421

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTP 130
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R   I++  P
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSH-P 210

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            I + +   Q+  H  +V+D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 211 FIIRMWGTFQDSQHVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 269

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           ++IYRD+KP+N L+ + G      + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 270 EIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 314

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 315 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>Scas_711.25
          Length = 1515

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 101/221 (45%), Gaps = 35/221 (15%)

Query: 79   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 124
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQDEAIISTVEALRSEVSTLK 1272

Query: 125  ILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIE 184
             L     +    +  ++ ++++ +  + G S+  L    GR F    +  +  Q++  + 
Sbjct: 1273 DLDHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLA 1331

Query: 185  DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
             LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R      G
Sbjct: 1332 YLHSRGILHRDMKADNLLLDQDGV-----CKISDFGISRKSKDIYSNSDMTMR------G 1380

Query: 245  TARYMS---INTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
            T  +M+   ++T  G   S + D+ ++G +      G+ PW
Sbjct: 1381 TVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPW 1419

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 93/180 (51%), Gaps = 18/180 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKILAGT--P 130
           Y  GK +G G+FGV+ +  N   G  VA+K   +K       QL+  Y    IL     P
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 131 GIP--QEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 186
            I   ++++  ++  + I  +   G    +LFD   ++  F+ +  V++ V++++ ++ +
Sbjct: 97  NIVAFKDWFESKDKFYIITQLAKGG----ELFDRILKKGKFTEEDAVRILVEILSAVKYM 152

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H+ ++++RD+KP+N L     + D + + + DFG+AK+    K+ + + Y+   SL   A
Sbjct: 153 HSQNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKPAGSLGYVA 207

>Kwal_26.7635
          Length = 691

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 99/229 (43%), Gaps = 25/229 (10%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           +++ K IG+GSFG + +     TN +  L    K +   K+E      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLHA 188
            +P ++ F       I++  + G    +LF    R  RFS+        +++  +E LH 
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFING---GELFYHLQREGRFSLSRARLYTAELLCALETLHN 474

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
            D+IYRD+KP+N L+   G      + L DFG+ K     + K +       +  GT  Y
Sbjct: 475 LDVIYRDLKPENILLDHQGH-----IALCDFGLCKLNMKGQDKTN-------TFCGTPEY 522

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           ++    LG+  S+  D   +G + +  + G  P+     P   + Y+KI
Sbjct: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP---KMYKKI 568

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 28/229 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 129
           + I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLK-LVEH 108

Query: 130 PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
           P + + +   Q+  +  +V+D + G  L  L     +RF        A ++   +E LH 
Sbjct: 109 PFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
           H++IYRD+KP+N L+ R G      + + DFG AK+                +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEVETVTW----------TLCGTPDY 212

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           ++      +  ++  D  ++G + +  L G  P+         + YEKI
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKI 258

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 100/210 (47%), Gaps = 16/210 (7%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------TEAPQLKDEYRTYKILAG 128
           +Y  GK +G G+FGV+ +         VA+K   +K       +   L DE    ++L  
Sbjct: 44  NYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKH 103

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
              +  + +F  +    I+    +G  L D     G+ F+ +  V + +Q+++ ++ +H+
Sbjct: 104 PNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK-FTERDAVSITMQILSAVDYMHS 162

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
            ++++RD+KP+N L     + D +++ + DFG+AKQ +D      + ++   SL   A  
Sbjct: 163 KNVVHRDLKPENVLY--IDKSDDSQLVIADFGIAKQLQD---NDDLIFKAAGSLGYVAPE 217

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRG 278
           +  N   G+      D+ ++G + +  L G
Sbjct: 218 VLTNNGHGKPC----DIWSIGVIVYTLLCG 243

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 120/282 (42%), Gaps = 30/282 (10%)

Query: 15  LAVNNNTMNSQMPNRSNVRLVNGTLPPSLHVS---SNLNHNTGNXXXXXXXXXXXXXXTI 71
           +A+ +N+ + Q+P R+N   +N  +      +   S ++  + N                
Sbjct: 10  VAMKDNSSHGQVPYRANNEHLNRVVQSVTDATKRLSQISTASSNANVNNTKTSKRRNRDT 69

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK-TEAPQLKD-------EYRTY 123
           VG  +K+GK +G+GS G +    NM  G   AIK  P+K  ++ Q+K        E    
Sbjct: 70  VG-PWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIM 128

Query: 124 KILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMIT 181
           K+++  P +   Y   +      LV++ +     +LFD+   +  +     +    Q++ 
Sbjct: 129 KLISH-PNVMGLYEVWENKSELYLVLEYVEGG--ELFDYLVSKGKLPESEAIHYFKQIVQ 185

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
            +   H  ++ +RD+KP+N L+ +  +     + + DFGMA      K  +        +
Sbjct: 186 AVAYCHGFNICHRDLKPENLLLDKKKR----SIKIADFGMAALETSDKLLE--------T 233

Query: 242 LSGTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPW 282
             G+  Y S    LGR+      D+ + G + F  L G LP+
Sbjct: 234 SCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPF 275

>Scas_720.94
          Length = 1683

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 104/238 (43%), Gaps = 47/238 (19%)

Query: 82   IGEGSFGVLFEGTNMINGLPVA---IKFEPRKTEA---PQLKDEYRTYKILAGTPGIPQE 135
            IG G+FG ++   N+ NG  +A   IK +  KT     P +K+E    ++L   P I Q 
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEML-NHPNIVQ- 1424

Query: 136  YYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMITLIEDLHAHD 190
             Y+G E +H    NI +    G S+  L +    R   + V QV  ++++  +  LH   
Sbjct: 1425 -YYGVE-VHRDKVNIFMEYCEGGSMASLLE--HGRIEDEMVTQVYTLELLEGLAYLHQAG 1480

Query: 191  LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS--------- 241
            +++RDIKP+N L+   G      +  +DFG A++     TK  +     KS         
Sbjct: 1481 VVHRDIKPENILLDFNG-----IIKYVDFGAARKIAKNGTK--VTNINSKSKDDDEPDEK 1533

Query: 242  -----------LSGTARYM---SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGL 285
                       + GT  YM   SI  +  + +   DD+ + G V    + G+ PW  L
Sbjct: 1534 DTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANL 1591

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 99/231 (42%), Gaps = 29/231 (12%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     TN I  L    K +   K+E      E RT       P
Sbjct: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDNP 440

Query: 131 GI-PQEYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDL 186
            I P ++ F   E L+ +L     G    +LF    R  RF +        +++  +E L
Sbjct: 441 FIVPLKFSFQSSEKLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEAL 496

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H  D+IYRD+KP+N L+   G      + L DFG+ K     + K         +  GT 
Sbjct: 497 HDFDIIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQEKT-------TTFCGTP 544

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            Y++    LG+  ++  D   +G + +  L G  P+     P   + Y+KI
Sbjct: 545 EYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 592

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 100/228 (43%), Gaps = 26/228 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTP 130
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R   I++  P
Sbjct: 88  FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSH-P 146

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            I + +   Q+     +V+D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 147 FIIRMWGTFQDSQQVFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 205

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           D+IYRD+KP+N L+ + G      + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 206 DIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 250

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 251 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKTYENI 295

>Kwal_26.7788
          Length = 1267

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 96/217 (44%), Gaps = 26/217 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ-------LKDEYRTYKILAG 128
           +K+GK +G+GS G +    NM  G   AIK  P KT++ +       ++ E    K+++ 
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVP-KTKSSRTGSLPYGIEREIIIMKLISH 116

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDL 186
            P +   Y   +  L   LV++ +     +LFD+     R   K  +    Q+I      
Sbjct: 117 -PNVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H  ++ +RD+KP+N L+ +  +    ++ + DFGMA      K  +        +  G+ 
Sbjct: 174 HGFNICHRDLKPENLLLDKKNK----RIKIADFGMAALQTSNKLLE--------TSCGSP 221

Query: 247 RYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPW 282
            Y S    +G+       D+ + G + F  L G LP+
Sbjct: 222 HYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 100/222 (45%), Gaps = 27/222 (12%)

Query: 79   GKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEA----PQLKDEYRTYKILAG 128
            G+ IG+GSFG ++   N+  G  +A+K      F  +   A      LK E  T K L  
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 129  TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
               +    +  + G++++ +  + G S+  L    GR F  + +  +  Q++  +  LH+
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLHS 1159

Query: 189  HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
              +++RD+K DN L+   G        + DFG++++        +I      ++ GT  +
Sbjct: 1160 KGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSDMTMRGTVFW 1208

Query: 249  MS---INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
            M+   ++T  G   S + D+ ++G V      G+ PW   + 
Sbjct: 1209 MAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 102/234 (43%), Gaps = 26/234 (11%)

Query: 70  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYK 124
           +IV  +++I + +G GSFG +    +  NG   A+K        R  +     DE R   
Sbjct: 81  SIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDE-RLML 139

Query: 125 ILAGTPGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 183
            +   P I + +   Q+     +++D + G  L  L     +RF        A ++   +
Sbjct: 140 SIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLAL 198

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLS 243
           E LH+ D+IYRD+KP+N L+ + G      + + DFG AK   D      + Y    +L 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLC 243

Query: 244 GTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           GT  Y++      +  ++  D  + G + +  L G  P+      N  + YEKI
Sbjct: 244 GTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYD---SNTMKTYEKI 294

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 101/235 (42%), Gaps = 37/235 (15%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     TN I  L    K +   K+E      E RT       P
Sbjct: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDNP 447

Query: 131 GI-PQEYYF-GQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITL 182
            I P ++ F   E L+ +L   + G  L      E  FD    RF          +++  
Sbjct: 448 FIVPLKFSFQSPEKLYLVLAF-INGGELFFHLQKEGRFDLSRARF-------YTAELLCA 499

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 242
           +E LH+ ++IYRD+KP+N L+   G      + L DFG+ K     + K +       + 
Sbjct: 500 LETLHSLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKTN-------TF 547

Query: 243 SGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            GT  Y++    LG+  S+  D   +G + +  L G  P+     P   + Y+KI
Sbjct: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 599

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 106/218 (48%), Gaps = 24/218 (11%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKILAGT-- 129
           +Y  G+ +G GSFGV+ +   +     VAIK   +K       QL+  Y    IL     
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSH 105

Query: 130 PGIP--QEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIED 185
           P I   ++++  ++  + +  +   G    +LFD    R  F+    V++ VQ++  +E 
Sbjct: 106 PNIVSFKDWFESKDKFYIVTQLATGG----ELFDRILSRGKFTEVDAVEIIVQILGAVEY 161

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245
           +H+ ++++RD+KP+N L     + + + + + DFG+AKQ    K ++ + Y+   SL   
Sbjct: 162 MHSKNVVHRDLKPENVLY--VDKSENSPLVIADFGIAKQL---KGEEDLIYKAAGSLGYV 216

Query: 246 A-RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           A   ++ + H      +  D+ ++G + +  L G  P+
Sbjct: 217 APEVLTQDGH-----GKPCDIWSIGVITYTLLCGYSPF 249

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 28/237 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPV-AIKFEPRKTEAPQLKDEYRTYK------ILAG 128
           +K G  +G+GS+  +F  T+  +     A+K   ++    Q K +Y   +      + + 
Sbjct: 118 FKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSV 177

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV---KTVVQVAVQMITLIED 185
           T  I   + F  E   N+  +    P+ +  F    ++F     +  +  + Q+I  I  
Sbjct: 178 TGVINLSFTFQDEA--NLYFLLEYAPNGD--FLSLIKKFGTLNEECTIYYSAQIIDAIGS 233

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQYRDPKTKQHIPY----REKK 240
           +H+H +I+RDIKP+N L+      D N K+ L DFG AK  +    K   P+        
Sbjct: 234 MHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSS 287

Query: 241 SLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           S  GTA Y+S           + D+ A G + +  + G+ P+   KA N    ++K+
Sbjct: 288 SFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF---KATNEYLTFQKV 341

>Scas_690.13
          Length = 354

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 107/233 (45%), Gaps = 28/233 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILAGT 129
           +++ + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVRMKQIEHTNDERRMLK-LVEH 101

Query: 130 PGIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
           P + + +   Q+  +  +V+D + G  L  L     +RF        A ++   +E LH+
Sbjct: 102 PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
           H++IYRD+KP+N L+ R G      + + DFG AK+  D  T          +L G   Y
Sbjct: 161 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGPPDY 205

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 301
           ++      +  ++  D  ++G + F  L G  P+         + YEKI + K
Sbjct: 206 IAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYD---TTPMKTYEKILQGK 255

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 166 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQ 224
           RFS         +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 562

Query: 225 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQ 283
               +T          +  GT  Y++    L     ++  D  ++G + F    G   W 
Sbjct: 563 DLKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WS 610

Query: 284 GLKAPNNKQKYEKIG 298
              A NN++ Y+KI 
Sbjct: 611 PFFAENNQKMYQKIA 625

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 101/235 (42%), Gaps = 37/235 (15%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     TN I  L    K +   K+E      E RT       P
Sbjct: 400 FDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDNP 458

Query: 131 GI-PQEYYF-GQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITL 182
            I P ++ F   E L+ +L   + G  L      E  FD    RF          +++  
Sbjct: 459 FIVPLKFSFQSPEKLYLVLAF-INGGELFYHLQKEGRFDLSRARF-------YTAELLCA 510

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSL 242
           +E LH+ ++IYRD+KP+N L+   G      + L DFG+ K     + K +       + 
Sbjct: 511 LETLHSLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMQDQDKTN-------TF 558

Query: 243 SGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            GT  Y++    LG+  S+  D   +G + +  L G  P+     P   + Y+KI
Sbjct: 559 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 610

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 100/214 (46%), Gaps = 18/214 (8%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKILAGT--P 130
           Y  GK +G G+FGV+ +   + +G  VA+K   +K    ++ QL+  Y    IL     P
Sbjct: 46  YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNHP 105

Query: 131 GIP--QEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
            I   ++++  +E  + +  +   G   + + +    +F     V +  Q++  ++ LH 
Sbjct: 106 NIVRFKDWFESKEKFYIVTQLATGGELFDRILE--KGKFCEVDAVFIVKQILQGVQYLHQ 163

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
            ++++RD+KP+N L     + D + + + DFG+AK+ +D     H         +G+  Y
Sbjct: 164 RNIVHRDLKPENIL--YLNKSDDSPLVIGDFGIAKELKDDNELIH-------KAAGSMGY 214

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           ++          +  D+ ++G + +  L G  P+
Sbjct: 215 VAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPF 248

>Scas_613.5
          Length = 517

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 108/245 (44%), Gaps = 38/245 (15%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYR-TYKILAGT--PG 131
           Y +GK +G G +  + EG N + G  VA+K F P++ +  +   ++R    IL     P 
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHPN 263

Query: 132 IPQEYYF-----GQEGLHNILVIDLL--GPSLEDLF-DWCGRRFSVKTVVQVAVQMITLI 183
           I     F      +  +   LV+D +  G   E +    C R+   K +     Q++  +
Sbjct: 264 IVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKAIFN---QILMGL 320

Query: 184 EDLHAHDLIYRDIKPDNFL--IGRPGQPDAN------------KVHLIDFGMAKQYRDPK 229
           + LH  ++I+RDIKP+N L  I R   P+              +V + DFG+AK   +  
Sbjct: 321 KHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGE-- 378

Query: 230 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW-QGLKAP 288
                  +   +L GT  Y++      +  + + DM + G + +  L G  P+ + L  P
Sbjct: 379 ------MQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGPP 432

Query: 289 NNKQK 293
           + K++
Sbjct: 433 SLKEQ 437

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 25/222 (11%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILAGT 129
           +Y+I K +GEGSFG +    +   G  VA+K   +K  A      +++ E  +Y  L   
Sbjct: 54  NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRH 112

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 187
           P I + Y   +     I+VI+  G    +LFD+  +R   S +   +   Q+I+ +E  H
Sbjct: 113 PHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 247
            H +++RD+KP+N L+      +   V + DFG++    D            K+  G+  
Sbjct: 170 RHKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTDGNF--------LKTSCGSPN 216

Query: 248 YMSINTHLGREQSRRD-DMEAMGHVFFYFLRGQLPWQGLKAP 288
           Y +     G+  +  + D+ + G + +  L  +LP+     P
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIP 258

>Scas_689.25*
          Length = 409

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 25/214 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTP 130
           + I +  G GSFG +    ++ NG   A+K   ++T     +     DE R   + +   
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSV-SVHA 157

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDLHA 188
            I + +   Q+  H  +++D +     +LF    R  RF        A ++   ++ LH+
Sbjct: 158 FIVRLWGTFQDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
            D+IYRD+KP+N L+ R G      + + DFG AK   D      + Y    +L GT  Y
Sbjct: 216 LDIIYRDLKPENLLLDRNGH-----IKVTDFGFAKYVPD------VTY----TLCGTPDY 260

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           ++      +  ++  D  + G + +  L G  P+
Sbjct: 261 IAPEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 22/158 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y+I  KIG G +  +F G +++N     IK  +P K     +K  YR  KIL    G P 
Sbjct: 86  YEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVK-----MKKIYRELKILTNLSGGPN 140

Query: 135 EYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDLH 187
                  GL +I+      +  L+   + ++ F      F++  +     Q++  +E  H
Sbjct: 141 VI-----GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALEYCH 195

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 196 SMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 229

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 102/251 (40%), Gaps = 60/251 (23%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY--------------- 120
           +K+GK +G+GS G +    N+ NG   AIK  P++T   +++D+                
Sbjct: 93  WKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKD 152

Query: 121 ---RTYKILAGTPGIPQEYYFGQEGLHNILVIDLLG-PSLE------------------- 157
              R   I  GT      Y   +E    I+++ L+  P++                    
Sbjct: 153 SSNREDPIKNGTDSALNPYGIERE----IVIMKLISHPNVMGLLEVWENKSELYLVLEYV 208

Query: 158 ---DLFDWCGRR--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 212
              +LFD+   +   S    V    Q+I  +   H+ ++ +RD+KP+N L+ +  +    
Sbjct: 209 DGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKV--- 265

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHV 271
            + + DFGMA           +P +  ++  G+  Y S    +G+       D+ + G +
Sbjct: 266 -IKIADFGMA--------ALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGII 316

Query: 272 FFYFLRGQLPW 282
            F  L G LP+
Sbjct: 317 LFALLTGHLPF 327

>Scas_660.28
          Length = 623

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 25/222 (11%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILAGT 129
           +Y+I K +GEGSFG +    +M  G  VA+K   +K  A      +++ E  +Y  L   
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRH 103

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 187
           P I + Y   +     I+V++  G    +LFD+  +R   S     +   Q+I+ +E  H
Sbjct: 104 PHIIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 247
            H +++RD+KP+N L+      +   V + DFG++    D            K+  G+  
Sbjct: 161 RHKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTDGNF--------LKTSCGSPN 207

Query: 248 YMSINTHLGREQSRRD-DMEAMGHVFFYFLRGQLPWQGLKAP 288
           Y +     G+  +  + D+ + G + +  L  +LP+     P
Sbjct: 208 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIP 249

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 80/160 (50%), Gaps = 16/160 (10%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILAGT 129
           +Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   
Sbjct: 38  NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRH 96

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLH 187
           P I + Y   +     I+VI+  G    +LFD+  +R   S +   +   Q+I+ +E  H
Sbjct: 97  PHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRD 227
            H +++RD+KP+N L+      +   V + DFG++    D
Sbjct: 154 RHKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 188

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 98/222 (44%), Gaps = 27/222 (12%)

Query: 79   GKKIGEGSFGVLFEGTNMINGLPVAIKF----------EPRKTEAPQLKDEYRTYKILAG 128
            G+ IG+GSFG ++ G N+  G  +A+K           E     A  L  E  T K L  
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 129  TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHA 188
               +    +  +  ++++ +  + G S+  L    G  F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYG-HFDEQLIRFLTTQVLEGLAYLHL 1245

Query: 189  HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
              +++RD+K DN L+   G        + DFG++++        +I    + ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLLDNDGV-----CKISDFGISRK------SNNIYSNSEMTMRGTVFW 1294

Query: 249  MS---INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
            M+   ++T  G   S + D+ ++G V      G+ PW  L+ 
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1334

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 107/263 (40%), Gaps = 44/263 (16%)

Query: 34  LVNGTLPPSLHVSSNLNHNTGNXXXXXXXXXXXXXXTIVGLHYKIGKKIGEGSFGVLFEG 93
           ++N   PP+    +N+    GN              T VG +YKI K+IGEGSFG ++  
Sbjct: 1   MINAIQPPTKAEQNNIKAIIGNSYNRLYSQFSSSELTEVG-NYKIQKQIGEGSFGKVYLA 59

Query: 94  TNMINGLPVAIK-------------FEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQ 140
           T+      V +K             F  R+ + P +   Y    +      +  EY  G+
Sbjct: 60  THRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYITKLYEVI-VTETKVWMALEYCPGK 118

Query: 141 EGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 200
           E   ++L    L P+LE     C   F+         Q+   +   H  + ++RD+K +N
Sbjct: 119 ELYDHLLSKSRL-PTLE-----CAELFA---------QITGAVHYAHTLNCVHRDLKLEN 163

Query: 201 FLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-Q 259
            L+ + G        L DFG     R+  TK  +     +++ GT  YM+      +   
Sbjct: 164 VLLDKNGN-----AKLTDFGFT---RESMTKAVL-----ETVCGTTVYMAPEMIQHKPYD 210

Query: 260 SRRDDMEAMGHVFFYFLRGQLPW 282
             + D+ ++G + +  L G LP+
Sbjct: 211 GFKVDIWSLGVILYTLLCGCLPF 233

>Scas_673.20*
          Length = 758

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 95/227 (41%), Gaps = 50/227 (22%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRK----TEAPQLKDEYRTYKI 125
            Y+  K+IGEG+ G+++    +   + VAIK      +PR     TE   LK EY+   I
Sbjct: 480 RYRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQPRLQMIWTEMLVLK-EYQHPNI 538

Query: 126 LAGTPGIPQEYYFGQEGLHNILVIDLL---GPSLEDLFDWCGRRFSVKTVVQVAVQMITL 182
           +          +     LH+ L I +    G SL D+         V        QM T+
Sbjct: 539 IN---------FINSYLLHDTLWIVMEYMDGGSLADI---------VSFFTPTEEQMATI 580

Query: 183 IED-------LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIP 235
             +       LH+  +++RDIK DN L+   G      + + DFG   Q  +  TK    
Sbjct: 581 CRETLFGLNFLHSRGIVHRDIKSDNILLSMNGD-----IKITDFGFCGQLTESNTK---- 631

Query: 236 YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
              + ++ GT  +M+      +E   + D+ ++G +    + G+ P+
Sbjct: 632 ---RTTMVGTPYWMAPEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 69/152 (45%), Gaps = 17/152 (11%)

Query: 82  IGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIPQE 135
           IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAGT  P I   
Sbjct: 376 IGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDSPWIVSL 433

Query: 136 YYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIY 193
           YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I+
Sbjct: 434 YYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGFIH 491

Query: 194 RDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           RDIKPDN LI   G      + L DFG++  +
Sbjct: 492 RDIKPDNILIDIRGH-----IKLSDFGLSTGF 518

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 76/158 (48%), Gaps = 22/158 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y+I  KIG G +  +F G +++N  P  IK  +P K     +K  YR  KIL    G P 
Sbjct: 50  YEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 135 EYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDLH 187
                  GL +I+      +  L+   ++++ F      F++        Q++  ++  H
Sbjct: 105 II-----GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYCH 159

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 105/238 (44%), Gaps = 35/238 (14%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYR---TYKILAGTPG 131
           Y +GK +G G + ++ E  N   G  VA+K F P++ +  +   ++R   T  +    P 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPN 252

Query: 132 IPQEYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 184
           I            +  +   LV++ +     +LFD   ++ S+      A+  Q++T ++
Sbjct: 253 IVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 185 DLHAHDLIYRDIKPDNFL--IGRPGQPDAN------------KVHLIDFGMAKQYRDPKT 230
            LH+ ++I+RDIKP+N L  I R   PD              +V + DFG+AK   + + 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 370

Query: 231 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAP 288
                     +L GT  Y++    + +  + + D+ + G + +  L G  P+     P
Sbjct: 371 TN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 420

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 72/158 (45%), Gaps = 17/158 (10%)

Query: 76  YKIGKKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT-- 129
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 130 PGIPQEYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
           P +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
               I+RDIKPDN LI   G      V L DFG++  +
Sbjct: 517 KLGFIHRDIKPDNILIDIRGH-----VKLSDFGLSTGF 549

>Scas_700.54
          Length = 698

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 101/228 (44%), Gaps = 28/228 (12%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIPQEYYFG 139
           +G+G+F  + +      G   A+K   ++     ++   R  ++L     P I +   F 
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELEVLQQLDHPRIVRLKGFY 288

Query: 140 QEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIK 197
           ++     +V++ +     DL D+     +V  +   +++ Q++  ++ +H+  + +RD+K
Sbjct: 289 EDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRDLK 346

Query: 198 PDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 257
           PDN LI    Q D   V + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 347 PDNILI---EQDDPVLVKITDFGLAKVQGNGSF--------MKTFCGTLAYVAPEVIGGK 395

Query: 258 --------EQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
                   E S   DM +MG + +  L G LP+ G      +Q Y++I
Sbjct: 396 GETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQEQLYKQI 440

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 92/220 (41%), Gaps = 28/220 (12%)

Query: 80  KKIGEGSFGVLFEGTNMINGLPVAIKFEPR-KTEAPQLKDEYRTYKILAGT---PGIPQE 135
           + I  G+F  +++  +  +   VA+K  P+ KT    +K+EY   KIL+     P I   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 136 YYFGQEGLHNILVIDLLGP-SLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL-------H 187
             F  +  + I+V++      L D  D    + S  +   + + M  +I+ L       H
Sbjct: 66  LDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAH 125

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIP----YREKKSLS 243
           +  + +RDIKP+N L+   G      + L D+G A Q   PK+         YR  ++ S
Sbjct: 126 SLGIAHRDIKPENILLTINGD-----IKLADWGHAIQ--SPKSNDFQIGTDNYRAPETFS 178

Query: 244 GTARYMSINTHLGREQ-----SRRDDMEAMGHVFFYFLRG 278
           G         +  R       + + D  ++G   FY + G
Sbjct: 179 GRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFG 218

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 105/239 (43%), Gaps = 35/239 (14%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRT-YKILAG---- 128
            Y  GK++G G + ++ E  N I G  VA+K F P+K +  +   ++R   KIL G    
Sbjct: 154 RYIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHE 213

Query: 129 -TPGIPQEYY--FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLI 183
               + + +     +  +   LV++ +     +LFD   R+  +      A+  Q++  +
Sbjct: 214 NIVKLLERFVEPLSKSQVQTYLVLEKIQDG--ELFDKIVRKTKLHQDETRALFKQILAGL 271

Query: 184 EDLHAHDLIYRDIKPDNFL--IGRPGQPDANK------------VHLIDFGMAKQYRDPK 229
           + LH  ++I+RDIKP+N L  I R   PD  +            V + DFG+AK   +  
Sbjct: 272 KYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE-- 329

Query: 230 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAP 288
                  +   +L GT  Y++         + + D+ + G + +  L G  P+    AP
Sbjct: 330 ------MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAP 382

>Kwal_47.18233
          Length = 598

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 78/159 (49%), Gaps = 16/159 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILAGTP 130
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   P
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 89

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHA 188
            I + Y   +     ++VI+  G    +LFD+  +R   S     +   Q+I+ +E  H 
Sbjct: 90  HIIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRD 227
           H +++RD+KP+N L+      +   V + DFG++    D
Sbjct: 147 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 180

>Kwal_14.1273
          Length = 415

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 108/273 (39%), Gaps = 41/273 (15%)

Query: 81  KIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-------APQLKDEYRTYKIL-AGTPGI 132
           KI  GSF  ++   +      VA+K   + +E       A  +  E    ++L  G P +
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 133 PQEYYFGQEGLHNILVIDLLGPSLEDLFD----WCGRRFSVKTV----VQVAVQMITLIE 184
                F +     + V++       DL+D    W  +R S + V     +V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 185 DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
             H+  + +RDIKP+N L+   G      V L D+G++ + R     +           G
Sbjct: 123 YAHSCGIAHRDIKPENVLLDSAGN-----VKLADWGLSTRMRVSCDTR----------IG 167

Query: 245 TARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQG---LKAPNNKQKYEKIGEKK 301
           T +Y++   +     +   D  ++G    + + G  P++     K+PNN      +    
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPH 227

Query: 302 RLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPD 334
           R  + Y     LP++  R  +    LS     D
Sbjct: 228 RFISEYYF---LPLRAARSAKPAEWLSLPHVSD 257

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 80  KKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIP 133
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  P + 
Sbjct: 356 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 413

Query: 134 QEYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 414 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 471

Query: 192 IYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           I+RDIKPDN LI   G      + L DFG++  +
Sbjct: 472 IHRDIKPDNILIDIRGH-----IKLSDFGLSTGF 500

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 104/249 (41%), Gaps = 56/249 (22%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------TEAPQLKDEYRTYKILA-- 127
           +K+GK +G+GS G +    NM  G   AIK  P+K      +    + + Y +  + +  
Sbjct: 81  WKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNV 140

Query: 128 GTPGIPQEYY--------FGQEGLHNILVIDLLGPS------------------LE---- 157
            +P I    +        +G E    I+++ L+  +                  LE    
Sbjct: 141 SSPSIASREHSNHSQTNPYGIE--REIVIMKLISHTNVMALFEVWENKSELYLVLEYVDG 198

Query: 158 -DLFDWCGRRFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKV 214
            +LFD+   +  +  +  +    Q++  +   H+ ++ +RD+KP+N L+ +  +    ++
Sbjct: 199 GELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNR----RI 254

Query: 215 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFF 273
            + DFGMA           +P +  K+  G+  Y S    +GR       D+ + G V F
Sbjct: 255 KIADFGMA--------ALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLF 306

Query: 274 YFLRGQLPW 282
             L G LP+
Sbjct: 307 ALLTGHLPF 315

>Scas_703.5
          Length = 749

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 104/235 (44%), Gaps = 33/235 (14%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPV-AIKFEPRKTEAPQLKDEYRTYKILA--G 128
           +++ + +G+G+FG +++     T  I  + V + K   +K E      E       A   
Sbjct: 344 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILVTTATKA 403

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGR---RFSVKTVVQVAVQMITLIED 185
           +P I    +  Q      LV D +  S  +LF W  +   RF+ +       +++  +E 
Sbjct: 404 SPFIVGLKFSFQTPTDLYLVTDFM--SGGELF-WHLQKEGRFTEERAKFYIAELVLALEY 460

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
           LH +D++YRD+KP+N L+      DAN  + L DFG++K     +T          +  G
Sbjct: 461 LHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT---------NTFCG 505

Query: 245 TARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
           T  Y++    L     ++  D  ++G + F    G   W    A +N++ Y+KI 
Sbjct: 506 TTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 557

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTP 130
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE     I++  P
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSH-P 203

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            I + +   Q+     +++D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSK 262

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
            +IYRD+KP+N L+ + G      + L DFG AK   D      + Y    +L GT  Y+
Sbjct: 263 GIIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD------VTY----TLCGTPDYI 307

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 308 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYD---SNTIKTYENI 352

>Scas_721.124
          Length = 684

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 98/236 (41%), Gaps = 39/236 (16%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     T  I  L    K +   K+E      E RT       P
Sbjct: 351 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAE-RTVLARIDCP 409

Query: 131 GI-PQEYYFGQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITLI 183
            I P ++ F       +++  + G  L      E  FD    RF        A +++  +
Sbjct: 410 FIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRF-------YAAELLCAL 462

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK--QYRDPKTKQHIPYREKKS 241
           E LH  ++IYRD+KP+N L+   G      + L DFG+ K     D KT          +
Sbjct: 463 ETLHNLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDDDKT---------DT 508

Query: 242 LSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
             GT  Y++    LG+  ++  D   +G + +  L G  P+     P   + Y+KI
Sbjct: 509 FCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 561

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 117/276 (42%), Gaps = 51/276 (18%)

Query: 76  YKIGKKIGEGSFGVLFEG--------TNMINGLP--VAIKFEPRKTEAPQLKDEYRTYKI 125
           Y +G  +GEG FG +  G        +N     P  VAIK   R + +   + E + Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 126 LAGTPGIPQEYYFG-QEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQ 174
           +     +        +E L N   I ++      L   CG          RR       +
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIV------LEYACGGEFYKYIQKKRRLKEMNACR 154

Query: 175 VAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHI 234
           +  Q+I+ +  +H+  L++RD+K +N L+ +    + N V + DFG   ++    ++  +
Sbjct: 155 LFSQLISGVHYIHSKGLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF---CSRNEL 206

Query: 235 PYREKKSLSGTARYMSINTHLGRE--QSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQ 292
                K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW     PNN +
Sbjct: 207 ----MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDD--DPNNPE 260

Query: 293 KYEKIGEKKRLTNVYDLAQGLPIQFGRY-LEIVRNL 327
             + IG       +Y+     P++F  Y L I R+L
Sbjct: 261 GSD-IGR------LYNYINSTPLKFPDYILPIPRDL 289

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 75/158 (47%), Gaps = 22/158 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y+I  KIG G +  +F G  ++N     IK  +P K     +K  YR  KIL    G P 
Sbjct: 50  YEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 135 EYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDLH 187
                  GL++I+      +  L+   ++++ F      F +  +     Q++  ++  H
Sbjct: 105 VV-----GLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCH 159

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMI----DPTERKLRLIDWGLAEFY 193

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 14/139 (10%)

Query: 171 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKT 230
           TV   A ++   ++ LH+  ++YRD+KP+N L+ + G      + L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGH-----LVLTDFGLSKSSASNAS 325

Query: 231 KQHI-------PYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           ++ +          E  S+ GT  Y +    LG+  +   D  ++G + +  L G+ P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 284 GL--KAPNNKQKYEKIGEK 300
           G   K   NK K +K G K
Sbjct: 386 GANHKVIANKIKNDKQGPK 404

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 98/234 (41%), Gaps = 34/234 (14%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIPQEYYFG 139
           +G G+F  + +      G   A+K   ++     +    R  ++L     P I     F 
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFY 253

Query: 140 QEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIK 197
           ++  +  +V++ +     DL D+     +V  +   +++ Q++  I+ +H+  + +RD+K
Sbjct: 254 EDEANYYMVMEFISGG--DLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDLK 311

Query: 198 PDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG- 256
           PDN LI    Q D   V + DFG+AK   +            K+  GT  Y++     G 
Sbjct: 312 PDNILI---EQDDPVLVKITDFGLAKVQGNGSI--------MKTFCGTLAYVAPEVIGGF 360

Query: 257 -------------REQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
                         E S   DM +MG + F  L G LP+ G      +Q YE+I
Sbjct: 361 TGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSG---STQEQLYEQI 411

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 22/158 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL    G P 
Sbjct: 50  YEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 135 EYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCGRRFSVKTVVQVAVQMITLIEDLH 187
                  GL +I+      +  L+   +++  F      F+++ +     Q++  ++  H
Sbjct: 105 VI-----GLLDIVQDQASKIPALIFEEVKNADFRTLYPSFTLQDLQYYFTQLLIALDYCH 159

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMI----DPAQKKLRLIDWGLAEFY 193

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 96/220 (43%), Gaps = 28/220 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK---------TEAP-QLKDEYRTYKI 125
           +K+GK +G+GS G +    NM +G   AIK  P++         T  P  ++ E    K+
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKL 120

Query: 126 LAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLI 183
           +   P I   Y   +      LV++ +     +LFD+   R  +  +  +    Q++  +
Sbjct: 121 ITH-PNIMALYEVWENKSELYLVLEYVEGG--ELFDYLIARGKLPEQEAIHYFKQIVQGV 177

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLS 243
              H  ++ +RD+KP+N L+ +  +     V + DFGMA              R  ++  
Sbjct: 178 SYCHNFNICHRDLKPENLLLDKKNK----TVKIADFGMA--------ALETTNRLLETSC 225

Query: 244 GTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPW 282
           G+  Y S    +G++      D+ + G + F  L G LP+
Sbjct: 226 GSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>Kwal_47.16761
          Length = 744

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 166 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQ 224
           RF+         +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 431 RFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILL------DANGNIALCDFGLSKA 484

Query: 225 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQ 283
               +T          +  GT  Y++    L     ++  D  ++G + F    G   W 
Sbjct: 485 DLKDRT---------NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WS 532

Query: 284 GLKAPNNKQKYEKIG 298
              A +N++ Y+KI 
Sbjct: 533 PFFAEDNQKMYQKIA 547

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 22/141 (15%)

Query: 157 EDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           E +FD    RF        A +++  ++ LH  D++YRD+KP+N L+   G      + L
Sbjct: 469 EGIFDISRARF-------YASELLLALDSLHKMDVVYRDLKPENILLDSQGH-----IAL 516

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFL 276
            DFG+ K       K         +  GT  Y++    LG+  ++  D   +G + +  L
Sbjct: 517 CDFGLCKLNMKDNEKT-------STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEML 569

Query: 277 RGQLPWQGLKAPNNKQKYEKI 297
            G  P+      N  + Y+KI
Sbjct: 570 TGLPPYYD---ENVSEMYKKI 587

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 64/135 (47%), Gaps = 20/135 (14%)

Query: 166 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQ 224
           RF+ +       +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 401 RFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 454

Query: 225 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQ 283
               +T          +  GT  Y++    L     ++  D  ++G + F    G   W 
Sbjct: 455 DLKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WS 502

Query: 284 GLKAPNNKQKYEKIG 298
              A +N++ Y+KI 
Sbjct: 503 PFFAEDNQKMYQKIA 517

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 85/185 (45%), Gaps = 15/185 (8%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTP 130
           Y I K I +G++G ++     + G   AIK   +     K +   +K E     + +  P
Sbjct: 782 YDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 841

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H +
Sbjct: 842 YVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGC-LPDEWVKQYLSEIIIGVEDMHNN 900

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
            +I+ D+KP+N LI   G      + L DFG+++     K  +HIP  +  SLS      
Sbjct: 901 GIIHHDLKPENLLIDVSGH-----LKLTDFGLSRAGL-VKRHRHIP--KPISLSNADTRS 952

Query: 250 SINTH 254
           +I++H
Sbjct: 953 NIDSH 957

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 78/159 (49%), Gaps = 16/159 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILAGTP 130
           Y++ K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   P
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 97

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDLHA 188
            I + Y   +     I+VI+  G    +LFD+  +R   S     +   Q+I+ +E  H 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRD 227
           H +++RD+KP+N L+      +   V + DFG++    D
Sbjct: 155 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 188

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 80  KKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIP 133
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  P + 
Sbjct: 314 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 371

Query: 134 QEYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 372 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIHKLGF 429

Query: 192 IYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           I+RDIKPDN LI   G      + L DFG++  +
Sbjct: 430 IHRDIKPDNILIDIRGH-----IKLSDFGLSTGF 458

>Kwal_26.8796
          Length = 796

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 93/215 (43%), Gaps = 25/215 (11%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIPQEYYFG 139
           +G+G+F  + +      G   A+K   ++     +    R  ++L     P I     F 
Sbjct: 194 VGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVARELEVLQRLDHPRIVSLKGFY 253

Query: 140 QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 197
           ++   + LV++ +  S  DL D+     SV      ++  Q++  ++ +H+  + +RD+K
Sbjct: 254 EDKDSHYLVMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRDLK 311

Query: 198 PDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 257
           PDN LI R    D   V + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 312 PDNILIER---DDPVLVKITDFGLAKIQGNGTF--------MKTFCGTLAYVAPEVISGK 360

Query: 258 EQSRRD--------DMEAMGHVFFYFLRGQLPWQG 284
               ++        DM ++G + +  L G LP+ G
Sbjct: 361 NSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSG 395

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 108/253 (42%), Gaps = 50/253 (19%)

Query: 72   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEA---PQLKDEYRTYKI 125
            V + ++    IG G+FG ++   ++ NG  +A+K    +  K+     P +K+E    +I
Sbjct: 1262 VSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEI 1321

Query: 126  LAGTPGIPQEYYFGQEGLH----NILVIDLLGPSLEDLFDWCGRRFSVKTVVQV-AVQMI 180
            L   P I    Y+G E +H    NI +    G SL  L +    R   + V QV  +Q++
Sbjct: 1322 L-NHPNIVS--YYGVE-VHRDKVNIFMEYCEGGSLAALLE--HGRIEDEMVTQVYTLQLL 1375

Query: 181  TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTK--------- 231
              +  LH   +++RD+KP+N L+   G      +  +DFG AK+  +  T+         
Sbjct: 1376 EGLAYLHESGIVHRDVKPENILLDFNGV-----IKYVDFGAAKKIANNGTRLASMNKIEN 1430

Query: 232  --------QHIPYREKK--------SLSGTARYM---SINTHLGREQSRRDDMEAMGHVF 272
                     H+   +           + GT  YM   SI     + +   DD+ ++G V 
Sbjct: 1431 ADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVV 1490

Query: 273  FYFLRGQLPWQGL 285
               + G+ PW  L
Sbjct: 1491 LEMITGRRPWANL 1503

>Scas_651.18
          Length = 371

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILAGTP 130
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R    +   P
Sbjct: 59  FQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDE-RLMLSVVSHP 117

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + +   Q+     +++D + G  L  L     +RF        A ++   +E LH+ 
Sbjct: 118 FLVRMWGTFQDFEQVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSM 176

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
           D+IYRD+KP+N L+ + G      + + DFG AK   D      I Y    +L GT  Y+
Sbjct: 177 DIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------ITY----TLCGTPDYI 221

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 222 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---SNTMKTYENI 266

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 12/154 (7%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTP 130
           Y + K I +G++G ++     + G   AIK   +     K +   +K E     + +  P
Sbjct: 702 YDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 761

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + Y   Q   +  LV+  L G  +  L    G     K   Q   ++I+ ++D+H +
Sbjct: 762 YVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGN-LPEKWAKQYICEVISGVDDMHQN 820

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
            +I+ D+KPDN LI   G      + L DFG+++
Sbjct: 821 GIIHHDLKPDNLLIDSLGH-----IKLTDFGLSR 849

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 99/237 (41%), Gaps = 41/237 (17%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     T  +  L    K +   K+E      E RT       P
Sbjct: 347 FDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDCP 405

Query: 131 GI-PQEYYF-GQEGLHNILVIDLLGPSL------EDLFDWCGRRFSVKTVVQVAVQMITL 182
            I P ++ F   E L+ +L   + G  L      E  FD    RF          +++  
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAF-INGGELFYHLQKEGRFDLSRARF-------YTAELLCA 457

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK--QYRDPKTKQHIPYREKK 240
           +++LH  D++YRD+KP+N L+   G      + L DFG+ K     D KT          
Sbjct: 458 LDNLHKLDVVYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDDDKT---------D 503

Query: 241 SLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           +  GT  Y++    LG   ++  D   +G + +  L G  P+     P   + Y+KI
Sbjct: 504 TFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 557

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILAGTP 130
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   P
Sbjct: 35  YQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 93

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSV--KTVVQVAVQMITLIEDLHA 188
            I + Y   +     I+VI+  G    +LFD+  +R  +  +   +   Q+I+ ++  H 
Sbjct: 94  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMPEQEARRFFQQIISAVDYCHR 150

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRD 227
           H +++RD+KP+N L+      +   V + DFG++    D
Sbjct: 151 HKIVHRDLKPENLLLD-----EHLNVKIADFGLSNIMTD 184

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 10/139 (7%)

Query: 158 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           DLF      + S + +     Q++T +E LH+  L +RD+K DN +I   G      V L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVINNQG-----IVKL 562

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYF 275
           IDFG A+ +  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 276 LRGQLPWQGLKAPNNKQKY 294
           +  + PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>Kwal_14.1159
          Length = 1521

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTP 130
           Y + K I +G++G +F     I G   AIK   +     K +   +K E     + +  P
Sbjct: 677 YDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSNKP 736

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + Y   Q   +  LV++ L G  L  L    G     + V Q   ++I  +ED+H  
Sbjct: 737 YVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGS-LPDQWVKQYISEVIYGVEDMHQS 795

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
            +I+ D+KPDN LI + G      + L DFG+++
Sbjct: 796 GIIHHDLKPDNLLIDQRGH-----LKLTDFGLSR 824

>Scas_580.6
          Length = 1015

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 98/228 (42%), Gaps = 33/228 (14%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           V   ++  + IG G FG++++G ++      AIK     ++  +++D  R  + L+    
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 132 IPQ-EYYFGQEGLHNILVIDLLGPSLEDLFDWCG----------RRFSVKTVVQVAVQMI 180
           IP    Y+G           L   SL  + ++C            +   K +  +  +++
Sbjct: 93  IPNITRYYGSY---------LKDTSLWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL 143

Query: 181 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKK 240
             ++ +H  ++I+RDIK  N LI   G      V L DFG+A Q      +       ++
Sbjct: 144 VALKYIHKDNVIHRDIKAANVLITNEGS-----VKLCDFGVAAQLNQSTLR-------RQ 191

Query: 241 SLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
           +++GT  +M+    + G     + D+ ++G   +    G  P+  ++A
Sbjct: 192 TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

>Scas_717.69
          Length = 674

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 96/231 (41%), Gaps = 29/231 (12%)

Query: 76  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTP 130
           + + K IG+GSFG + +     T  I  L    K +   K+E      E RT       P
Sbjct: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVNCP 403

Query: 131 GI-PQEYYF-GQEGLHNILVIDLLGPSLEDLFDWCGR--RFSVKTVVQVAVQMITLIEDL 186
            I P ++ F   E L+ +L     G    +LF    +  RF +        +++  +E L
Sbjct: 404 FIVPLKFSFQSPEKLYLVLACINGG----ELFYHLQKEGRFELSRARFYTAELLCALETL 459

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H  D+IYRD+KP+N L+   G      + L DFG+ K     + K         +  GT 
Sbjct: 460 HNLDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKT-------DTFCGTP 507

Query: 247 RYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            Y++    L +  S+  D   +G + +  L G  P+     P   + Y KI
Sbjct: 508 EYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVP---KMYRKI 555

>Kwal_33.14554
          Length = 714

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 72/158 (45%), Gaps = 17/158 (10%)

Query: 76  YKIGKKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT-- 129
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +LAG+  
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 130 PGIPQEYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
           P +   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
               I+RDIKPDN LI   G      + L DFG++  +
Sbjct: 419 KLGFIHRDIKPDNILIDIRGH-----IKLSDFGLSTGF 451

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 171 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ--YRDP 228
           TV   A ++   ++ LH+  ++YRD+KP+N L+   G      + L DFG++K+  + D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGH-----LVLTDFGLSKKSVFDDA 336

Query: 229 KTKQHIP-YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGL-- 285
            T +      +  S+ GT  Y +     G   ++  D  ++G + +  L G+ P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 286 KAPNNKQKYEKIGEK 300
           K   NK K EK G +
Sbjct: 397 KIILNKIKQEKTGAR 411

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 12/109 (11%)

Query: 178 QMITLIEDLHAHD-LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPY 236
           Q+++ I  LH    + +RDIKP+N L+ + G      + L DFG+A Q+R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTLRVSM 178

Query: 237 REKKSLSGTARYMSINTHLGRE--QSRRDDMEAMGHVFFYFLRGQLPWQ 283
            ++    G+  YM+       E   + R D+ ++G + F  L GQ PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 166 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN-KVHLIDFGMAKQ 224
           RF+         +++  +E LH +D++YRD+KP+N L+      DAN  + L DFG++K 
Sbjct: 422 RFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 475

Query: 225 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQ 283
               +T          +  GT  Y++    +     ++  D  ++G + F    G   W 
Sbjct: 476 DLKDRT---------NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WS 523

Query: 284 GLKAPNNKQKYEKIG 298
              A +N++ Y+KI 
Sbjct: 524 PFFASDNQKMYQKIA 538

>Scas_707.3
          Length = 1598

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTP 130
           Y I K I +G++G ++     I G   AIK   +     K +   +K E     + +  P
Sbjct: 699 YTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKP 758

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + +   Q   +  LV++ L G  L  L    G     + V Q   ++I  ++D+H +
Sbjct: 759 YVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGY-LPDQWVKQYLTEIIVGVDDMHRN 817

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
            +I+ D+KPDN LI   G      V L DFG+++
Sbjct: 818 WIIHHDLKPDNLLIDNLGH-----VKLTDFGLSR 846

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 69/154 (44%), Gaps = 12/154 (7%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTP 130
           Y I K I +G++G ++     I G   AIK   +     K +   +K E     + +  P
Sbjct: 682 YDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKP 741

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + Y   Q   +  LV++ L G  L  L    G     K   Q   ++I  ++D+H  
Sbjct: 742 YVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGN-LPDKWAKQYITEVIIGVDDMHMS 800

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
            +I+ D+KPDN LI   G      V L DFG+++
Sbjct: 801 GIIHHDLKPDNLLIDSNGH-----VKLTDFGLSR 829

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 72/147 (48%), Gaps = 12/147 (8%)

Query: 171 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ-YRDPK 229
           TV   A ++   +  LH   ++YRD+KP+N L+ + G      + L DFG++K+   D  
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGH-----LVLTDFGLSKKSANDSA 307

Query: 230 TKQHIP--YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
             +  P       S+ GT  Y +    LG+  S+  D  ++G + +  L G+ P+ G   
Sbjct: 308 VDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG--- 364

Query: 288 PNNKQKYEKIGEKKRLTNV-YDLAQGL 313
            N+K    KI + K+   + + L++G+
Sbjct: 365 SNHKVIINKIQQNKQGPKIPFYLSEGM 391

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 58/132 (43%), Gaps = 14/132 (10%)

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           G R S K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     V L DFG++ 
Sbjct: 318 GGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQ-----VKLCDFGVSG 372

Query: 224 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           +  +             + +GT+ YM+     G+  S   D+ ++G        G+ P  
Sbjct: 373 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423

Query: 284 GLKAPNNKQKYE 295
             K   N   +E
Sbjct: 424 SEKMAANIAPFE 435

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 97/220 (44%), Gaps = 26/220 (11%)

Query: 76  YKIGKKIGEGSFGVLFEG---TNMINGLP--VAIKFEPRKTEAPQLKDEYRTYKILAGTP 130
           Y IG  +GEG FG +  G    +  N +P  VAIK   R T       E + Y+ +    
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 131 GI--PQEYYFGQEGLHNILVIDLLGPSLE--DLFDWCGRRFSVK--TVVQVAVQMITLIE 184
            +  P   Y  +E L N   I ++   +   + + +  R+  +K  +  ++  Q+I+ + 
Sbjct: 106 HLTHPNIIYL-EEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVN 164

Query: 185 DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
            +H   L++RD+K +N L+ +        + + DFG   ++ +            K+  G
Sbjct: 165 YMHYKGLVHRDLKLENLLLDK-----HENLVITDFGFVNEFFEDNELM-------KTSCG 212

Query: 245 TARYMSINTHLGRE--QSRRDDMEAMGHVFFYFLRGQLPW 282
           +  Y +    +  +  ++R+ D+ + G + +  L G LPW
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>Scas_654.12
          Length = 737

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 80  KKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT--PGIP 133
           K IG+G+FG    V    T  I  +   +K E  K +  QL        +LAG+  P + 
Sbjct: 323 KVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 380

Query: 134 QEYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 381 SLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 438

Query: 192 IYRDIKPDNFLIGRPGQPDANKVHLIDFGMA 222
           I+RDIKPDN LI   G      + L DFG++
Sbjct: 439 IHRDIKPDNILIDIRGH-----IKLSDFGLS 464

>Kwal_33.13984
          Length = 649

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 28/184 (15%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILAGTPGIPQ 134
           Y +   +G+G+FG + +  N++    +A+K    K+E   Q   E +  ++L G      
Sbjct: 278 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQG 337

Query: 135 EYYFGQ--EGL----HNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 185
           E++F +  E      H  LV +LL  +L +L      +F   S+  +   A Q++  +  
Sbjct: 338 EHHFLRMHETFVHKNHLCLVFELLSSNLYELLK--QNQFHGLSISLIRTFARQLLDSLCV 395

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ-------------YRDPKTKQ 232
           L  H LI+ D+KP+N L+    +P+   + +IDFG A +             YR P+   
Sbjct: 396 LKEHKLIHCDLKPENILLVSLDRPE---LKVIDFGSACEETRTLYTYIQSRFYRAPEVIL 452

Query: 233 HIPY 236
            IPY
Sbjct: 453 GIPY 456

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 93/236 (39%), Gaps = 61/236 (25%)

Query: 77  KIGKKIGEGSFGVLFEG-TNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQE 135
           ++G  IGEGSFG +        + + VA+KF    T A                 G+ Q+
Sbjct: 15  ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAES---------------GLSQK 59

Query: 136 YYFGQEGLH-------NIL-VIDL------LGPSLE-----DLFDWCGRRFSVK-TVVQV 175
               +  LH       N+L VID       L   LE     DLFD       V   V Q 
Sbjct: 60  DVSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQF 119

Query: 176 AVQ-MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHI 234
             Q +I  +  LH   + +RDIKP+N L+ + G      + L DFG+A Q+R       +
Sbjct: 120 YFQQLIRALNYLHDVGVAHRDIKPENILLDKKGN-----LKLADFGLASQFRRKDGTLRV 174

Query: 235 --------PYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
                   PY   + LS    Y +I            D+ + G + F  L G++PW
Sbjct: 175 STDQRGSPPYMAPEILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 12/123 (9%)

Query: 166 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           RFS+        +++  ++ LH  D+IYRD+KP+N L+   G      + L DFG+ K  
Sbjct: 438 RFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 492

Query: 226 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGL 285
                K         +  GT  Y++    LG+  ++  D   +G + +  + G  P+   
Sbjct: 493 MKDNDKTD-------TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545

Query: 286 KAP 288
             P
Sbjct: 546 NVP 548

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 76/168 (45%), Gaps = 22/168 (13%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-----EYRTYKI 125
           +  ++Y   KK+GEG++ V++ G    +G  +AIK    + +  Q KD       R  K 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 126 L-----AGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMI 180
           L     A    +  + +  QE L+  LV++ L   LE L       F+   +    +  +
Sbjct: 57  LQEIRHANVIEL-VDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTL 113

Query: 181 TLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
             +   H   +++RD+KP+N L+   GQ     + + DFG+A+    P
Sbjct: 114 RGVHHCHRSFILHRDLKPNNLLLAPDGQ-----LKIADFGLARTLAAP 156

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 99/227 (43%), Gaps = 39/227 (17%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQLKDEYRTYKILAGTPGI 132
           +K  + IG G FGV+++  ++      AIK    +  + E   ++ E +    L  TP I
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 133 PQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV-----------QMIT 181
              +Y+G           L+   L  + ++C    S++T+++  +           +++ 
Sbjct: 76  --THYYGSY---------LIDTKLWVIMEYCAGG-SLRTLLRPGIIEEKYIGVIMREILV 123

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
            +  +H  ++I+RDIK  N LI   G      V L DFG+A Q      K       +++
Sbjct: 124 ALISIHRDNVIHRDIKAANILIANNGS-----VKLCDFGVAAQLSQSMLK-------RQT 171

Query: 242 LSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
           ++GT  +M+    + G     + D+ ++G   +    G  P+  ++A
Sbjct: 172 MAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>Scas_616.10
          Length = 1461

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 99/249 (39%), Gaps = 54/249 (21%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEA------------PQLKDEYRTY 123
           +K+GK +G+GS G +    N+  G   AIK  P+K +                 +     
Sbjct: 101 WKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSNSNI 160

Query: 124 KILAGTP--------------GIPQEYYFGQEGLH-NILVI-------DLLGPSLE---- 157
             LA +P              GI +E    +   H N++ +         L   LE    
Sbjct: 161 STLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVLEYVDG 220

Query: 158 -DLFDWCGRR--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKV 214
            +LFD+   +   S K  V    Q+I  +   H+ ++ +RD+KP+N L+ +  +     +
Sbjct: 221 GELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNK----SI 276

Query: 215 HLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFF 273
            + DFGMA           +P +  ++  G+  Y S    +G+       D+ + G + F
Sbjct: 277 KIADFGMA--------ALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILF 328

Query: 274 YFLRGQLPW 282
             L G LP+
Sbjct: 329 ALLTGHLPF 337

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 19/152 (12%)

Query: 80  KKIGEGSFG----VLFEGTNMINGLPVAIKFEP-RKTEAPQLKDEYRTYKILAGT--PGI 132
           K IG+G+FG    V  + T  I  +   +K E   K +   +K E     +LAG+  P +
Sbjct: 307 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAER---DVLAGSDSPWV 363

Query: 133 PQEYYFGQEGLHNILVIDLL--GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 190
              YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H   
Sbjct: 364 VSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEVIHKLG 421

Query: 191 LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMA 222
            I+RDIKPDN LI   G      + L DFG++
Sbjct: 422 FIHRDIKPDNILIDIRGH-----IKLSDFGLS 448

>Kwal_33.14434
          Length = 759

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 65/138 (47%), Gaps = 10/138 (7%)

Query: 158 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I + G      V L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINKHGV-----VKL 543

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYF 275
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 276 LRGQLPWQGLKAPNNKQK 293
           +  + PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 96/223 (43%), Gaps = 21/223 (9%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIP 133
           + + G+K+G G+ G +     + + +  A+K F P+     + K +Y           I 
Sbjct: 389 YSRTGEKLGAGAGGSVKLVRRLKDNVVFAVKEFRPKHEN--ETKRDY--------IKKIT 438

Query: 134 QEYYFGQEGLHNILVIDLLGPSLEDLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLI 192
            EY  G    H+ +++ ++     DLF      R S + +     Q++  I  LH+  L 
Sbjct: 439 SEYCIGSTLRHSNIILQVMEYCDYDLFAIVMSNRMSYEEICCCLKQILIGIGYLHSLGLA 498

Query: 193 YRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 252
           +RD+K DN ++   G      V +IDFG A  +  P +   +   E   + G+  Y++  
Sbjct: 499 HRDLKLDNCVLNSQGI-----VKIIDFGAAVVFTYPHSGTLV---EASGIVGSDPYLAPE 550

Query: 253 THL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKY 294
             +  +   R  D+ +   ++   +  + PW+  K  +N  K+
Sbjct: 551 VCIFSKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKF 593

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           G R S K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     V L DFG++ 
Sbjct: 295 GGRISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLNEIGQ-----VKLCDFGVSG 349

Query: 224 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           +  +             + +GT+ YM+     G+  S   D+ ++G       +G  P+
Sbjct: 350 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPF 399

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 68/145 (46%), Gaps = 18/145 (12%)

Query: 178 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYR 237
           Q+   ++ +H  ++I+RDIKP+N LIG       N + L DFG +    +P      P  
Sbjct: 210 QIANALDYMHKKNIIHRDIKPENILIGF-----NNVIKLTDFGWS--IINP------PEN 256

Query: 238 EKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
            +K++ GT  Y+S      RE     D  A+G + F  L G  P++          Y++I
Sbjct: 257 RRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE---EEMKDTTYKRI 313

Query: 298 G--EKKRLTNVYDLAQGLPIQFGRY 320
              + K  +N+   AQ L ++  +Y
Sbjct: 314 AALDIKMPSNISQDAQDLILKLLKY 338

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 71/147 (48%), Gaps = 14/147 (9%)

Query: 171 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK----QYR 226
           TV   A ++   ++ LH+  ++YRD+KP+N L+      D   + L DFG++K    Q  
Sbjct: 265 TVSFYAAEISCALKFLHSKGIVYRDLKPENCLLD-----DKGHLVLTDFGLSKRGVNQAD 319

Query: 227 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLK 286
            P   + +   E  S+ GT  Y +     G+  ++  D  ++G + +  L G+ P+ G  
Sbjct: 320 SPLGGEQV--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG-- 375

Query: 287 APNNKQKYEKIGEKKRLTNVYDLAQGL 313
             N+K    KI + K +   + L+ G+
Sbjct: 376 -ANHKVILSKIKQDKGIKIPHYLSDGM 401

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 96/214 (44%), Gaps = 15/214 (7%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ-----LKDEYRTYKILAGTP 130
           Y   + +G GSFGV+     + +   VA+K   ++          + DE    + L    
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 131 GIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 190
            +  + +F  E    I+     G  L D     G+ ++ +  V + VQ++  +E LH+ +
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK-YTEEDAVNIVVQILKAVEYLHSQN 183

Query: 191 LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 250
           +I+RD+KP+N L     +   +++ L DFG+A+Q  +      + YR     +G+  Y++
Sbjct: 184 IIHRDLKPENLLYLDKSKD--SRIVLADFGIARQLEND---DDVIYRP----AGSLGYVA 234

Query: 251 INTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQG 284
                     +  D+ ++G + +  L G  P++ 
Sbjct: 235 PEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 12/120 (10%)

Query: 167 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLI----GRPGQPDANKVHLIDFGMA 222
            + + +V +A  + T ++ LH+  +I+RD+KP N L+     R       K  + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 223 KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           + Y           R+    +GT  +++     G + S + D+ A G + ++ + GQLP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 90/207 (43%), Gaps = 24/207 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILAGTP- 130
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 131 -GIPQEYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 186
             I + Y       H + LV + L   L+   +   +      K + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAYC 124

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           HAH +I+RD+KP N LI R G      + L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRIIHRDLKPQNLLINRNGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 247 RYMSINTHLGREQ-SRRDDMEAMGHVF 272
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDVWSIGCIF 199

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 100/228 (43%), Gaps = 37/228 (16%)

Query: 76  YKIGKKIGEGSFGVLFEG-TNMINGLP---------VAIKFEPRKTEAPQLKDEYRTYKI 125
           Y +G  +GEG FG +  G T   +  P         VAIK   R T     + E + Y+ 
Sbjct: 44  YIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYRE 103

Query: 126 LAGTPGIPQEYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCGRRFSVK--TVVQVAV 177
           +     +        +E L N   I ++   LE     + + +  R+  +K  T  ++  
Sbjct: 104 INALKHLTHPNVVRLEEVLQNSKYIGIV---LEYASGGEFYKYIQRKRRLKESTACRLFA 160

Query: 178 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYR 237
           Q+I+ +  +H+ +L++RD+K +N L+ +    + N V + DFG   ++        +P  
Sbjct: 161 QLISGVTYMHSKNLVHRDLKLENLLLDK----NENLV-ITDFGFVNEF--------LPDN 207

Query: 238 E-KKSLSGTARYMSINTHLGREQ--SRRDDMEAMGHVFFYFLRGQLPW 282
           E  K+  G+  Y +    +      +R+ D+ + G + +  L G LPW
Sbjct: 208 EYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 98/237 (41%), Gaps = 31/237 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-KTEAPQLKDEYRTYKILA---GTPG 131
           YK    I  GSF  +++G N      VA+K  P+ K     + +EY   K+L+   G P 
Sbjct: 8   YKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKFSQRGMANEYNVGKLLSKDEGCPF 67

Query: 132 IPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRR--FSVKTVVQVAVQMITL-----I 183
           I     F ++  +  LV +        D  +   ++   +  +++++  Q + L     I
Sbjct: 68  ICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAI 127

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHI---PYREKK 240
           +  H+  + +RDIKP+N LI   G      + L D+G A          +I    YR  +
Sbjct: 128 KYAHSMGIAHRDIKPENILINYHGD-----IKLADWGHAIS-ASSSNDNNIGTDNYRGPE 181

Query: 241 SLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 297
           + S    Y   NT+       R D  +MG    Y L    P++     N K  Y+++
Sbjct: 182 TFSAKVSY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>Kwal_55.20326
          Length = 750

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 102/240 (42%), Gaps = 46/240 (19%)

Query: 79  GKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEA------PQLKDEY--------- 120
           G +IG GSFG ++ G N   G  +A+K    +P    A       ++K +Y         
Sbjct: 461 GARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSAV 520

Query: 121 --------RTYKILAGTPGIPQEY-------YFG--QEGLH-NILVIDLLGPSLEDLFDW 162
                   +    L    G+ +E        Y+G  QEG + NI +  + G S+  + + 
Sbjct: 521 KNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNS 580

Query: 163 CGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMA 222
            G  F    +     Q++  +  LH  D+I+RDIK  N LI   G      V + DFG++
Sbjct: 581 YGP-FEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGC-----VKITDFGIS 634

Query: 223 KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           K+      +Q+    ++ SL G+  +M+         +++ D+ ++G V      G+ P+
Sbjct: 635 KKLSPLNQQQN----KRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPF 690

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 83/195 (42%), Gaps = 47/195 (24%)

Query: 76  YKIGKKIGEGSFGVLF--------------EGTNMINGLPVAIKFE-------------P 108
           YK+ +++G GSFG +               EGT M   +   I+ E              
Sbjct: 38  YKLIQELGNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKT 97

Query: 109 RKTEAPQLKD--EYRTYKILAGTPG---IPQEY-YFGQEGLHNI-LVIDLLGPSLEDLFD 161
             T  P L D    R  K +   P    + Q Y  F  + L+ + +V++ +  ++  L  
Sbjct: 98  MMTRLPTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMK 157

Query: 162 WCGRR-FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQ------------ 208
              RR FS+ T+  +  Q+++ I  +HAH+  +RDIKP+N LI    +            
Sbjct: 158 CRKRRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHY 217

Query: 209 PDANKVHLIDFGMAK 223
           PD   V + D+G+A+
Sbjct: 218 PDNYVVKIADYGLAR 232

>Scas_648.17
          Length = 340

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 75/166 (45%), Gaps = 38/166 (22%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KIL    G P 
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 135 EYYFGQEGLHNILVIDLLG---------PSL--EDLFDWCGRR----FSVKTVVQVAVQM 179
                        VI+LL          P+L  E++ +   R+    F++  +     Q+
Sbjct: 105 -------------VIELLDIVQDPGSKIPALIFEEVKNMDFRQLYPTFTLPDIQFYFTQL 151

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +   H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 152 LIALNYCHSMGIMHRDVKPQNVMI----DPKERKLRLIDWGLAEFY 193

>Kwal_56.24091
          Length = 381

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 57/117 (48%), Gaps = 13/117 (11%)

Query: 167 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYR 226
           F+  T      QM   +  +H+ ++++RDIKP+N L+G       N + L DFG +    
Sbjct: 218 FNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF-----QNTLKLTDFGWS---- 268

Query: 227 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
                 ++   ++K+L GT  Y+S      RE   + D+ A+G + +  L G  P++
Sbjct: 269 ----VSNVGNSKRKTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE 321

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 92/212 (43%), Gaps = 21/212 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY----RTYKILAGTPG 131
           ++I + +G GSFG +    +  NG   A+K   +       + E+    R    +   P 
Sbjct: 76  FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVVSHPF 135

Query: 132 IPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHD 190
           I + +   Q+     +++D + G  L  L     +RF        A ++   +E LH+ D
Sbjct: 136 IIRMWGTFQDAHQVFMIMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLHSKD 194

Query: 191 LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 250
           +IYRD+KP+N L+ + G      + L DFG AK   D      + Y    +L GT  Y++
Sbjct: 195 IIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD------VTY----TLCGTPDYIA 239

Query: 251 INTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
                 +  ++  D  + G + +  L G  P+
Sbjct: 240 PEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>Kwal_55.21545
          Length = 865

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 99/229 (43%), Gaps = 35/229 (15%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG 131
           V   +K  + IG G FGV+++G         AIK     +   +++D  +  + L+    
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQ 74

Query: 132 IPQ-EYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ-----------VAVQM 179
           +P   +Y+G           L    L  + ++C    S++T+++           +  ++
Sbjct: 75  VPNITHYYGSY---------LNDTKLWVIMEYCAGG-SLRTLLRPGKIGEQYIGVIMREL 124

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
           +T +  +H   +I+RDIK  N LI   G      + L DFG+A Q    K +       +
Sbjct: 125 LTALMHIHKDGVIHRDIKAANVLITNDGH-----IKLCDFGVAAQLSQTKIR-------R 172

Query: 240 KSLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
           ++++GT  +M+    + G     + D+ ++G   +    G  P+  ++A
Sbjct: 173 QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 105/242 (43%), Gaps = 49/242 (20%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-------------FEPRKTEAPQLKDEYR 121
           +YKI K IGEGSFG ++   + +    V +K             F  R+ + P +   Y 
Sbjct: 36  NYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKNDPNVVREVFYHRQFDFPHITKLYE 95

Query: 122 TYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 181
              +      +  EY  G+E L+  L++                R S++   ++  Q+++
Sbjct: 96  VI-VTESKVWMALEYCPGKE-LYEYLLMQ--------------HRISLEESGKLFAQIVS 139

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
            +   H+   ++RD+K +N L+ + G     +  + DFG     R+  TK  +     ++
Sbjct: 140 AVYYAHSLQCVHRDLKLENILLDKKG-----RAKITDFGFT---RECATKTML-----ET 186

Query: 242 LSGTARYMSINTHLGREQSR---RDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
           + GT  YM+    L   +S    + D+ ++G + +  + G +P+   +    K K++ I 
Sbjct: 187 VCGTTVYMA--PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFD--EEDETKTKWKIIN 242

Query: 299 EK 300
           E+
Sbjct: 243 EE 244

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 97/231 (41%), Gaps = 30/231 (12%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKIL--AGTPGIPQEYYFG 139
           +G+G+F  + +      G   A+K   ++     +    R  ++L     P I     F 
Sbjct: 223 VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGVTRELEVLRRLNHPRIVSLKGFY 282

Query: 140 QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 197
           ++     L+++ +  S  DL D+     SV      ++  Q++  +  +H   + +RD+K
Sbjct: 283 EDDESYYLLMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLK 340

Query: 198 PDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 257
           PDN LI    Q D   V + DFG+AK  +D  T         K+  GT  Y++     G+
Sbjct: 341 PDNILI---EQDDPVLVKITDFGLAK-IQDNTTFM-------KTFCGTLAYVAPEVIGGK 389

Query: 258 E----------QSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298
                       S   DM ++G + +  L G LP+ G      +Q Y++I 
Sbjct: 390 NPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSG---STQEQLYKQIA 437

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 96/214 (44%), Gaps = 21/214 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ---LKDEYRTYKILAGT--P 130
           +++G+K+G+G FG ++   +  +G   A+K    K E  Q   LK   R   I  G   P
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALK-AIEKNEILQFNLLKQLKREVDIQLGMDHP 158

Query: 131 GIPQEY-YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            I + Y +F  E    +L+   +   L       G  F+         Q+   +  +H  
Sbjct: 159 NIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGP-FNDVLASHYIYQIADALHYMHKK 217

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 249
            +I+RD+KP+N LIG       N V L DFG +    +P+  +      +K+L GT  Y+
Sbjct: 218 RIIHRDVKPENVLIGF-----DNVVKLADFGWS--ILNPEGSK------RKTLCGTIDYL 264

Query: 250 SINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           S      RE   + D+ A+G + +  + G  P++
Sbjct: 265 SPEMITPREYDEQVDVWALGVLAYELVVGVPPFE 298

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 90/207 (43%), Gaps = 24/207 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILAGT-- 129
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPS--TAIREISLLKELRD 64

Query: 130 PGIPQEYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 186
             I + Y       H + LV + L   L+   +   +      K + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYC 124

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           HAH +++RD+KP N LI R G      + L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRILHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 247 RYMSINTHLGREQ-SRRDDMEAMGHVF 272
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 106/243 (43%), Gaps = 45/243 (18%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGT----- 129
           Y  GK++G G + ++ E  N   G  VA+K F P++ +     D+ RT K    T     
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLS 155

Query: 130 ---PGIPQEYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QM 179
              P I +          +  +   LV++ +     +LF+   R+ +++     A+  Q+
Sbjct: 156 IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQL 213

Query: 180 ITLIEDLHAHDLIYRDIKPDNFL--IGRPGQPDA------------NKVHLIDFGMAKQY 225
           +  ++ LH+ ++I+RDIKP+N L  I +   P+              +V + DFG+AK  
Sbjct: 214 LNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT 273

Query: 226 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGL 285
            + K           +L GT  Y++    +    + R DM + G + +  L G  P+   
Sbjct: 274 GEMKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQ 325

Query: 286 KAP 288
            AP
Sbjct: 326 LAP 328

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 178 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYR 237
           Q+I  ++ LH   L +RD+K DN ++ R G      + LIDFG +  +  P + Q I   
Sbjct: 467 QLINGVKYLHDIGLSHRDLKLDNCVVTRRGI-----LKLIDFGASSVFHYPLSSQMI--- 518

Query: 238 EKKSLSGTARYMSINTHLGREQS-RRDDMEAMGHVFFYFLRGQLPWQ 283
           E   + G+  Y+S       E   R  D+ ++G +FF  +  + PW+
Sbjct: 519 EANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCMITRRFPWK 565

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILAGTPGIPQ 134
           Y +   +G+G+FG + +  N+     +A+K    ++E   Q   E +  ++L        
Sbjct: 361 YLVLDILGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNN 420

Query: 135 EYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 185
           +++F +         H  LV +LL  +L +L      +F   S++ +    +Q++  +  
Sbjct: 421 KHHFLRMHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCV 478

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ-------------YRDPKTKQ 232
           L    LI+ D+KP+N L+  P +PD   + +IDFG + +             YR P+   
Sbjct: 479 LKDSKLIHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIIL 535

Query: 233 HIPY 236
            IPY
Sbjct: 536 GIPY 539

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILAGTP 130
           Y I K I +G++G ++     + G   AIK   +     K +   +K E     + +  P
Sbjct: 794 YDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKP 853

Query: 131 GIPQEYYFGQEGLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAH 189
            + + +   Q   +  LV++ L G  L  L    G     +   Q   +++  + D+H +
Sbjct: 854 YVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGY-LPDQWAKQYLTEIVVGVNDMHQN 912

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQH--IPYREKKSLSGT 245
            +I+ D+KP+N LI   G      V L DFG++   R    ++H  +P++   S+S T
Sbjct: 913 GIIHHDLKPENLLIDNAGH-----VKLTDFGLS---RAGLIRRHKFVPHKSSLSISST 962

>Scas_655.2
          Length = 800

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 158 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I   G      V L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKG-----IVKL 582

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYF 275
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 276 LRGQLPWQGLKAPNNKQK 293
           +  + PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 129/322 (40%), Gaps = 74/322 (22%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPG--IP 133
           Y+I K++G G  G +  G +++    VAIK   R  +  +   ++ ++K    T    I 
Sbjct: 141 YEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKER---KFFSFKKPGKTENDKIK 197

Query: 134 QEYYFGQEGLHNILVI------DLLGPSLEDLFDWCGRR-------------------FS 168
           +E    ++  H  +V       DL    +  + ++C R                     S
Sbjct: 198 REIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPPDCLETEAKGPSPLS 257

Query: 169 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGM---AKQY 225
            +   ++   ++  +E LH   +I+RDIKP N L+   G      V + DFG+   A   
Sbjct: 258 FQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGI-----VKISDFGVSLAASSS 312

Query: 226 RDPKTKQHIPYREKKSLSGTARYMSINTHLG----------REQ-------SRRDDMEAM 268
               + + I   E    +GT  + +    LG          RE+       S + D+ A+
Sbjct: 313 NVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCISFKIDIWAL 372

Query: 269 GHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRN-- 326
           G   +  + G LP+    +    + +EKI        V D     P++F +Y ++++N  
Sbjct: 373 GVTLYCLVFGMLPFV---SSFELELFEKI--------VND-----PVKFPKYSDMLKNNQ 416

Query: 327 -LSFEETPDYEGYRMLLLSVLD 347
            L   E  +YE  + LL  +L+
Sbjct: 417 VLQMTEEAEYEAAKDLLTRLLE 438

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILAGTPGIPQ 134
           Y +   +G+G+FG + +  N++    +A+K    +TE   Q   E +  ++L        
Sbjct: 369 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTN 428

Query: 135 EYYFGQ------EGLHNILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLIED 185
           +++F +         H  LV +LL  +L +L      +F   S++ +     Q++  +  
Sbjct: 429 KHHFLRMYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCV 486

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ-------------YRDPKTKQ 232
           L    LI+ D+KP+N L+  P +P+   + +IDFG + +             YR P+   
Sbjct: 487 LKESKLIHCDLKPENILLCAPDKPE---LKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 233 HIPY 236
            IPY
Sbjct: 544 GIPY 547

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-----EYRTYKILAGTP 130
           Y   KK GEG++ V++ GT    G  +A+K    + +  Q KD       R  K L    
Sbjct: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELK 65

Query: 131 GI----PQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 186
            +      + +   + L+  LV++ L   LE +       FS   +    +  +  +   
Sbjct: 66  HVNVIELVDVFMANDNLN--LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPK---TKQHIP--YREKKS 241
           H + +++RD+KP+N L+   GQ     + + DFG+A+    P+   T   +   YR  + 
Sbjct: 124 HRNFILHRDLKPNNLLLAPDGQ-----LKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178

Query: 242 LSGTARYMS 250
           L G   Y S
Sbjct: 179 LFGAKHYTS 187

>Kwal_27.11919
          Length = 209

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 89/207 (42%), Gaps = 24/207 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILAGTP- 130
           YK  +K+GEG++GV+++  ++ +G  V     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 131 -GIPQEYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 186
             I + Y       H + LV + L   L+   +   +        + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYC 124

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           H+H +++RD+KP N LI R G      + L DFG+A+ +        +P R       T 
Sbjct: 125 HSHRILHRDLKPQNLLINRDGN-----MKLADFGLARAF-------GVPLRAYTHEIVTL 172

Query: 247 RYMSINTHLGREQ-SRRDDMEAMGHVF 272
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 142 GLHNILVIDLL-GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 200
           GL   +V++ + G  L D+  +C    +   +  V  +++  +E LH+  +++RDIK DN
Sbjct: 634 GLDLWVVMEYMEGGCLTDVVTYCV--LTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDN 691

Query: 201 FLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS 260
            L+   G      + L DFG   Q  D   K       + ++ GT  +M+      +E  
Sbjct: 692 VLLSMNGD-----IKLTDFGFCAQVNDTVIK-------RTTMVGTPYWMAPEIVSRKEYG 739

Query: 261 RRDDMEAMGHVFFYFLRGQLPW 282
            + D+ ++G +    + G+ P+
Sbjct: 740 PKVDIWSLGIMIIEMIEGEPPY 761

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 77/180 (42%), Gaps = 37/180 (20%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLP----VAIKFEPR---------KTEAPQLKDEYRT 122
           Y+I  KIGEG+F  +F+   + N L     VAIK  P+         KT   Q  +E   
Sbjct: 67  YRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNELNI 126

Query: 123 YKIL--AGTPGI---------PQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKT 171
           +  L  A  P +          + YYF QE +         G     +  +    FS   
Sbjct: 127 HLKLTKANVPNVVKLLEFQVSKKYYYFIQEYIEG-------GEIFNQIVKYT--YFSEDL 177

Query: 172 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTK 231
              V  Q+ T ++ LH +++I+RDIKP+N +     +P   +  +  +   ++  DPKTK
Sbjct: 178 TRHVIRQVATAVKGLHENNIIHRDIKPENLIF----EPIIKEQTIHRYQKLRKSDDPKTK 233

>Kwal_26.8709
          Length = 829

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 92/223 (41%), Gaps = 31/223 (13%)

Query: 76  YKIGKKIGEGSFGVLFEG----TNMINGLP--VAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           Y +G  +GEG FG +  G    +N    +P  VAIK   R T     + E + Y+ +   
Sbjct: 40  YIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINAL 99

Query: 130 -----PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIE 184
                P I +     Q   +  +V++         +    RR       ++  Q+I+ + 
Sbjct: 100 KHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQLISGVY 159

Query: 185 DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLI-DFGMAKQYRDP----KTKQHIPYREK 239
            +H+  L++RD+K +N L+      D N+  LI DFG   ++       KT    P    
Sbjct: 160 YMHSKGLVHRDLKLENLLL------DKNENLLITDFGFVNEFLPENELMKTSCGSPCYAA 213

Query: 240 KSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
             L  TAR           ++R+ D+ + G + +  L G LPW
Sbjct: 214 PELVVTARPY---------EARKADVWSCGVILYAMLAGYLPW 247

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 101/228 (44%), Gaps = 29/228 (12%)

Query: 73  GLH--YKIGKKI-GEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGT 129
           G+H  Y I   I G+G+F  + +      G   A+K   ++    +     R   +L   
Sbjct: 186 GIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKRELDVLQKL 245

Query: 130 --PGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVV--QVAVQMITLIED 185
             P I +   F ++  +  ++++ +     DL D+     +V      ++  Q++  ++ 
Sbjct: 246 NHPRIVKLKDFFEDNDNYYMLMEFVSGG--DLMDFVAAHGTVGEDAGREITRQVLEAVKY 303

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245
           +H   + +RD+KPDN +I    Q D   + + DFG+AK  ++  T  +       +  GT
Sbjct: 304 MHDQGISHRDLKPDNIMI---EQDDPVLIKITDFGLAK-VQNQNTFLN-------TFCGT 352

Query: 246 ARYMS---INTHLGREQSRRD------DMEAMGHVFFYFLRGQLPWQG 284
             Y++   I+     +++ RD      DM ++G + +  L G LP+ G
Sbjct: 353 LAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSG 400

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           G R S + + ++A  ++  +  LH   +I+RDIKP N L+   G+     + L DFG++ 
Sbjct: 311 GGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGE-----IKLCDFGVSG 365

Query: 224 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           +  +             + +GT+ YM+     G+  S   D+ ++G        G+ P++
Sbjct: 366 EAVNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

Query: 284 GLKAPNN 290
             K   N
Sbjct: 417 SDKITQN 423

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 10/138 (7%)

Query: 158 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           DLF      + S + +     Q++T ++ LH+  L +RD+K DN +I   G      V L
Sbjct: 523 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKG-----IVKL 577

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYF 275
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 578 IDFGAAVVFSYPFSKNLV---EASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACM 634

Query: 276 LRGQLPWQGLKAPNNKQK 293
           +  + PW+  K  +N  K
Sbjct: 635 ILKKFPWKIPKLRDNSFK 652

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 92/219 (42%), Gaps = 46/219 (21%)

Query: 81  KIGEGSFGVLFEGTNMINGLPVAIK-----FEPRK------------TEAPQLKDEYRTY 123
           KIG+G+ G ++    +   + VAIK      +P+K            ++ P + +   +Y
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSY 684

Query: 124 KILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 183
            +L G   +  EY              + G SL D+   C    +   +  V  + ++ +
Sbjct: 685 -VLKGDLWVIMEY--------------MEGGSLTDVVTHC--ILTEGQIGAVCRETLSGL 727

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLS 243
           E LH+  +++RDIK DN L+   G      + L DFG   Q  +   K       + ++ 
Sbjct: 728 EFLHSKGVLHRDIKSDNILLSMEGD-----IKLTDFGFCAQINELNLK-------RTTMV 775

Query: 244 GTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           GT  +M+      +E   + D+ ++G +    + G+ P+
Sbjct: 776 GTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 814

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 96/223 (43%), Gaps = 45/223 (20%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-------------FEPRKTEAPQLKDEYR 121
           +Y+I K++GEGSFG ++  T+ +    V +K             F  R+ E P +   Y 
Sbjct: 36  NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFITKLYE 95

Query: 122 TYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 181
              +      +  EY  G E L++ L++    P      D   R F+         Q+++
Sbjct: 96  VI-VTETRVWMALEYCPGNE-LYDYLLLKQRIP-----LDETRRLFA---------QIVS 139

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
            +   H+   ++RD+K +N L+ + G        L DFG     R+  TK  +     ++
Sbjct: 140 AVFYAHSLQCVHRDLKLENILLDKNGY-----AMLTDFGFT---RECATKTQL-----ET 186

Query: 242 LSGTARYMSINTHLGREQ--SRRDDMEAMGHVFFYFLRGQLPW 282
           + GT  YM+    + RE     + D  ++G + +  L G +P+
Sbjct: 187 VCGTTVYMAPEL-IKREAYDGYKVDTWSLGIILYTMLHGYMPF 228

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 91/226 (40%), Gaps = 40/226 (17%)

Query: 73  GLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGI 132
            + Y++ + IG GS+GV+++ TN      VAIK E    +  +L D      +L     I
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 133 PQEYYFG-QEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQ------------VAVQM 179
               Y G  +  HN+ +I           ++C +  S+K ++                Q 
Sbjct: 78  NIVKYHGFIQKQHNLYII----------LEYCAKG-SLKNLISRNRPMSEHEAKPYVRQT 126

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
           +  +  LH   +I+RDIK  N L+        N V L DFG++ +  +            
Sbjct: 127 LNGLNYLHEQGVIHRDIKAANILLD-----SENVVKLADFGVSTKVNNTAM--------- 172

Query: 240 KSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGL 285
            +L+G+  +M+      R  S   D+ ++G      L G  P+  L
Sbjct: 173 -TLAGSLNWMAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNL 217

>Scas_640.16
          Length = 505

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           G R S K + +++  ++  +  LH   +I+RDIKP N L    GQ     V L DFG++ 
Sbjct: 307 GGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNILFNEKGQ-----VKLCDFGVSG 361

Query: 224 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           +  +             + +GT+ YM+     G+  S   D+ ++G       +G+ P+
Sbjct: 362 EAVNSLA---------TTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTILEVAQGRFPF 411

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 96/230 (41%), Gaps = 46/230 (20%)

Query: 77  KIGKKIGEGSFGVLFEGTNMIN-GLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQE 135
           ++G+ IG+GSF  +   +  ++    +A+KF       P  + +           G+ QE
Sbjct: 16  QLGRTIGKGSFAFVKRASLEVDPSTVIAVKF----IHLPSCEKQ-----------GMSQE 60

Query: 136 YYFGQEGLHN-----ILVIDLLGPSLEDLFDWCGRRFS------------VKTVVQVA-- 176
               +  LH+     + V+ ++  +L D F W     +            +    +VA  
Sbjct: 61  DVLREVKLHSRCSNFVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQF 120

Query: 177 --VQMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQH 233
              Q+I  I  LH    + +RDIKP+N L+ + G      + L DFG+A  ++     + 
Sbjct: 121 YYKQLIKAISYLHDTCGVAHRDIKPENILLDKDGN-----LKLADFGLASLFKRKDGSKR 175

Query: 234 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           I   ++ SL   A  +    +     +   D+ ++G + F  L G+ PW+
Sbjct: 176 ISRDQRGSLPYMAPEI---IYCDGYYADMTDIWSIGVLLFVLLTGETPWE 222

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 107/248 (43%), Gaps = 36/248 (14%)

Query: 10  ATNSGLAVNNNTMNSQ-MPNRSNVRLVN-----------------GTLPPSLHVSSNLNH 51
           A+ S    N++ +NS+  PN SN   VN                  +  PS+   + +N 
Sbjct: 367 ASVSQATANDDNINSRNTPNNSNDTYVNTRPLQRSRHGSIASQFLSSFSPSMTSIAKMNS 426

Query: 52  NTGNXXXXXXXXXXXXXXTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEP 108
           N  +               I+G  +++GK IG G++G++ E  ++  G+   IK   F+ 
Sbjct: 427 NPLSGSAGGSARPDDKGMEILG--HRLGKIIGFGAWGIIRECFDIETGVGRVIKIVKFKG 484

Query: 109 RKTEAPQLKDEYRTYKILAGTPGIPQ---------EYYFGQEGLHNILVIDLLGPSLEDL 159
            +     +  E   ++ L     +P            Y   E +++  + DL+     D 
Sbjct: 485 HQNIKKHVLREVAIWRTLKHNRILPLLDWKLDDNYAMYCLTERINDGTLYDLVIS--WDE 542

Query: 160 FDWCGRRFS--VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLI 217
           F      F+   +  + +++Q+++ ++ +H+  +++ DIK +N L+ + G+    KV L 
Sbjct: 543 FKRSKIPFAERCRLTIFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGKKSDWKVFLC 602

Query: 218 DFGMAKQY 225
           DFGM+  +
Sbjct: 603 DFGMSCHF 610

>Kwal_26.8703
          Length = 444

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           G R   K + ++A  ++  +  L    +I+RDIKP N L+   GQ     V L DFG++ 
Sbjct: 254 GGRIGEKVLGKIAESVLKGLSYLQERKIIHRDIKPQNILLNEAGQ-----VKLCDFGVSG 308

Query: 224 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
              +             + +GT+ YM+     G+  S   D+ ++G       +GQ P+
Sbjct: 309 VAVN---------SLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGQFPF 358

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 15/119 (12%)

Query: 167 FSVKTVVQVAVQMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           F+  T+ ++A  ++  ++ L+  + +I+RDIKP N LI   GQ     + L DFG++K+ 
Sbjct: 302 FNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQ-----IKLCDFGVSKKL 356

Query: 226 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQG 284
            +      +         GT+ YMS     G   S + D+ ++G +    + G+ P  G
Sbjct: 357 INSIADTFV---------GTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGG 406

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 99/235 (42%), Gaps = 43/235 (18%)

Query: 79  GKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQLKDEYRTY----KILAGTPG 131
           G +IG GSFG ++ G N   G  +A+K    EP    A    D+ +++     ++     
Sbjct: 418 GARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASS--DDKKSHPSSNAVVKKLTD 475

Query: 132 IPQE---------------------YYFG--QEGLH-NILVIDLLGPSLEDLFDWCGRRF 167
            PQ+                      Y+G  QEG + NI +  + G S+  + +  G  F
Sbjct: 476 PPQDGGRASSTKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGP-F 534

Query: 168 SVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRD 227
               V     Q +  +  LH  ++I+RDIK  N LI   G      V + DFG++K+   
Sbjct: 535 EEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGS-----VKITDFGISKKLSP 589

Query: 228 PKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
              KQ+    ++ SL G+  +M+         + + D+ ++G V      G+ P+
Sbjct: 590 LNKKQN----KRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVVVEMFTGKHPF 640

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 96/234 (41%), Gaps = 39/234 (16%)

Query: 79  GKKIGEGSFGVLFEGTNMINGLPVAIK--------------------FEPRKTEAPQLKD 118
           G +IG GSFG ++ G N   G  +A+K                     E    +AP    
Sbjct: 392 GARIGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNL 451

Query: 119 EYRTYKILAGTPGIPQEY-------YFG--QEGLH-NILVIDLLGPSLEDLFDWCGRRFS 168
             +    L     + +E        Y+G  QEG + NI +  + G S+  +    G  F 
Sbjct: 452 HRKMIDALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGP-FE 510

Query: 169 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
              +V    Q++  +  LH  ++I+RDIK  N LI   G      V + DFG++K+   P
Sbjct: 511 EPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGC-----VKITDFGISKKL-SP 564

Query: 229 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
             +++    ++ SL G+  +MS         + + D+ + G V      G+ P+
Sbjct: 565 LNQEN--QDKRTSLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPY 616

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 19/160 (11%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---------FEPRKTEAPQLKDEYRTYKI 125
           HYK+   IGEG++G++    +   G  VAIK         F  R     +L   + +++ 
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 126 LAGTPGI--PQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLI 183
           +     I  P  Y   Q+     LV +L+   L+ +        S   +     Q++  +
Sbjct: 72  IISVLDIVRPTSY---QDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRAL 128

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           + LH+  +I+RD+KP N L+       +  + L DFG+++
Sbjct: 129 KSLHSAQVIHRDLKPSNLLLN-----SSCDLKLCDFGLSR 163

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 76/164 (46%), Gaps = 16/164 (9%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-EYRTYKILAGTP 130
           V + +   + +G GSFGV+F          VAIK   +  +  + K+ E    K+L+   
Sbjct: 35  VQISFPTTEVVGHGSFGVVFATVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLSHIN 91

Query: 131 GIPQEYYF----GQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 186
            I  +Y+F     Q+ ++  L+++ +  SL         + +  + +++   M  L + L
Sbjct: 92  IIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSL 151

Query: 187 ----HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYR 226
               H  ++ +RDIKP N L+     P+   + L DFG AKQ +
Sbjct: 152 NYLHHFANVCHRDIKPQNLLVD----PETWSLKLCDFGSAKQLK 191

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 153 GPSLEDLFDWC---GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQP 209
           G SLE ++      G R S K + +++  ++  +  LH   +I+RDIKP N L+   GQ 
Sbjct: 263 GKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQ- 321

Query: 210 DANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMG 269
               V L DFG++ +  +             + +GT+ YM+     G+  S   D+ ++G
Sbjct: 322 ----VKLCDFGVSGEAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTCDVWSLG 368

Query: 270 HVFFYFLRGQLPW 282
                  +G  P+
Sbjct: 369 LTILEVAQGHFPF 381

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 98/244 (40%), Gaps = 48/244 (19%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK----FEPRKTEAPQLKDEYRTYKILAGTP 130
           +++I   +G G +G +    ++  G  VAIK    FE R   + QLK E          P
Sbjct: 49  NFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVE---------NP 99

Query: 131 GIPQEYYFGQEGLH-NILVI-----DLLGPSLEDLFDWCGR---------RFSVKTV--- 172
            + QE    +   H N++ +     D     +  + ++C R         +  +K V   
Sbjct: 100 RVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPS 159

Query: 173 -------VQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
                   +V + +++ +E LH+  + +RDIKP N LI   G      V + DFG+A   
Sbjct: 160 ILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGT-----VKISDFGVAMST 214

Query: 226 RDPKTKQHIPYRE--KKSLSGTARYMS---INTHLGREQSRRDDMEAMGHVFFYFLRGQL 280
               T     + +  K    GT  + +    +T      S   D+ ++G   +  L G+L
Sbjct: 215 ATGSTNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKL 274

Query: 281 PWQG 284
           P+  
Sbjct: 275 PFNA 278

>Scas_675.2
          Length = 527

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 92/225 (40%), Gaps = 38/225 (16%)

Query: 78  IGKKIGEGSFGVLFEGTNMIN-GLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEY 136
           +G  IG+GSFG +      ++  + +A+K+       P  K    T K       I +E 
Sbjct: 17  LGDTIGQGSFGCVMNAHLAVDPSVIIAVKY----VHIPTCKKNGLTEK------DISREV 66

Query: 137 YFGQEGLHNILVIDLLGPSLE--------------DLFDWCGRRFSVKT-VVQVAVQ-MI 180
                   N  V+ L+  ++               DLFD       V + V Q   Q ++
Sbjct: 67  LLHSRCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLV 126

Query: 181 TLIEDLHAHD-LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
             I  LH    + +RDIKP+N L+ + G      + L DFG++ QYR       I   ++
Sbjct: 127 RAISYLHEECGVAHRDIKPENILLDKNGN-----LKLADFGLSSQYRRKDGTLRISTDQR 181

Query: 240 KSLSGTARYMSINTHLGR-EQSRRDDMEAMGHVFFYFLRGQLPWQ 283
               G+  YM+      R   +   D+ ++G + F  L G+ PW+
Sbjct: 182 ----GSPPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWE 222

>Kwal_26.7861
          Length = 955

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 14/130 (10%)

Query: 153 GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 212
           G SL D+   C    +   +  V+ + +  ++ LH+  +I+RDIK DN L+   G+    
Sbjct: 746 GGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNVLLSMSGE---- 799

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVF 272
            + L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ ++G + 
Sbjct: 800 -IKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 851

Query: 273 FYFLRGQLPW 282
              + G+ P+
Sbjct: 852 IEMIEGEPPY 861

>Scas_683.12
          Length = 356

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 100/225 (44%), Gaps = 35/225 (15%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIKFEPR-KTEAPQLKDEYRTYKILAGT-PGIPQEYYFG 139
           I  G+F  +++  +      VA+K  P+ K  +  + +E+   KIL  + P I     F 
Sbjct: 9   IQTGTFSTVYKAWSSQRNEYVALKIMPKSKYSSGGMANEFEIMKILGRSHPNICSMLDFY 68

Query: 140 QEGLHNILVIDLLGPSLEDLFDWC------GRRFSVKTV----VQVAVQMITLIEDLHAH 189
           Q+  + +LV++       DL+D+       G +    T+     +V  Q+ + I   H+ 
Sbjct: 69  QDTNYYVLVLEYC--EYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLRQISSAIMYSHSL 126

Query: 190 DLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQ-HIP---YREKKSLSGT 245
            + +RDIKP+N L+ + G      + L D+G A   RD  +K+ HI    YR  ++   T
Sbjct: 127 GIAHRDIKPENILLTKEGD-----IKLADWGHA--IRDSFSKESHIGTDNYRAPETFDCT 179

Query: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNN 290
             Y           + + D  ++G    Y + GQ P++ L   ++
Sbjct: 180 IEY----------DTFKIDYWSLGVTSLYLIFGQAPFKNLTLSSD 214

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 99/231 (42%), Gaps = 55/231 (23%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMING-LPVAIKFEPRKTEAPQ----LKDEYRTYKILAGT 129
           HY++ + +G+GS+G +    + +N   P+ I  + + T   Q    LK   R  K +   
Sbjct: 72  HYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIK-KITNIFQREVLLKRAIRELKFM--- 127

Query: 130 PGIPQEYYFGQEGLHNILVIDLLGP-------SLEDLFDWCGRR-------FSVKTVVQV 175
                 Y+ G + + +++ ++++           ++L D+   R       FS   +   
Sbjct: 128 -----HYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSNVQFSEFHIKHF 182

Query: 176 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK----QYRDPKTK 231
             Q++  ++ +H+ D+I+RD+KP N L    GQ     + + DFG+A+     + + KT 
Sbjct: 183 TYQILCGVKYIHSADVIHRDLKPGNILCSISGQ-----LKICDFGLARGISPLFTNTKTS 237

Query: 232 QHIP-------YREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYF 275
            HI        YR  + +    RY           ++  DM A+G +   F
Sbjct: 238 NHITNYVATRWYRAPELILSHKRY-----------NKSIDMWAIGCILAEF 277

>AEL120W [2386] [Homologous to ScYKL171W - SH]
           complement(396394..398715) [2322 bp, 773 aa]
          Length = 773

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 169 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
            K  + +A+Q+I+ ++ +H+  +++ D+K +N L+ + G   + K++L DFGM+ QY  P
Sbjct: 477 CKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGS-QSWKLYLCDFGMSCQYGKP 535

Query: 229 K 229
           +
Sbjct: 536 R 536

>Scas_721.46
          Length = 296

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 89/207 (42%), Gaps = 24/207 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILAGTP- 130
           YK  +K+GEG++GV+++  +M  G  V     I+ E      P      R   +L     
Sbjct: 8   YKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPS--TAIREISLLKELKD 65

Query: 131 -GIPQEYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSVKT--VVQVAVQMITLIEDL 186
             I + Y       H + LV + L   L+   +   +  S+ +  + +   Q+   I   
Sbjct: 66  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSLGSDIIKKFMRQLCKGIAYC 125

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           HAH +++RD+KP N LI + G      + L DFG+A+ +        +P R       T 
Sbjct: 126 HAHRILHRDLKPQNLLINKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 173

Query: 247 RYMSINTHLGREQ-SRRDDMEAMGHVF 272
            Y +    LG +Q S   D  ++G +F
Sbjct: 174 WYRAPEVLLGGKQYSTGVDTWSIGCIF 200

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 83/186 (44%), Gaps = 32/186 (17%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILAGTPGIPQ 134
           Y I   +G+G+FG + +  NM     VA+K    KTE   Q   E +  ++L        
Sbjct: 273 YLILDILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLN 332

Query: 135 EYYFGQEGLHN--------ILVIDLLGPSLEDLFDWCGRRF---SVKTVVQVAVQMITLI 183
           +++F +  LH+         LV +LL  +L +L      +F   S+  +     Q++  +
Sbjct: 333 QHHFLR--LHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSL 388

Query: 184 EDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ-------------YRDPKT 230
             L    LI+ D+KP+N L+  P +P+   + +IDFG A +             YR P+ 
Sbjct: 389 CVLKESKLIHCDLKPENVLLVSPDRPE---LKVIDFGSACEEARTVYTYIQSRFYRAPEV 445

Query: 231 KQHIPY 236
              IPY
Sbjct: 446 LMGIPY 451

>Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement
          Length = 363

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 77/166 (46%), Gaps = 19/166 (11%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-EYRTYKILAGTP 130
           + + Y   + +G GSFGV+F  T       VAIK   +  +  + K+ E    K+L+   
Sbjct: 28  INISYPATEVVGHGSFGVVFTTTICETDQVVAIK---KVLQDKRFKNRELEIMKLLSHPQ 84

Query: 131 GIPQEYYFGQ-----EGLHNILVIDLLGPSL-EDLFDWCGRRFSVKTVVQVAVQMITLIE 184
            I  +YYF +       ++  LV++ +  SL + L  +   R S    ++V + M  L +
Sbjct: 85  IIGLKYYFYETDSTTSDVYLNLVLEYMPSSLYQRLRHFVTHR-SNMPAIEVKLYMYQLFK 143

Query: 185 DLH----AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYR 226
            L+       + +RDIKP N L+     P    + L DFG AKQ +
Sbjct: 144 SLNYLHTCARVCHRDIKPQNLLVD----PTTFSLKLCDFGSAKQLK 185

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 88/218 (40%), Gaps = 44/218 (20%)

Query: 81  KIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQ 140
           KIG+G+ G ++    +     VAIK         Q+  E +  K L     I  E    +
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIK---------QMNLEKQPKKEL-----IINEILVMK 733

Query: 141 EGLHNILV--ID--------------LLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIE 184
              HN +V  ID              + G SL D+   C    +   +  V+ + +  + 
Sbjct: 734 GSRHNNIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIAAVSRETLRGLH 791

Query: 185 DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
            LH+  +I+RDIK DN L+   G      + L DFG   Q  +   K       + ++ G
Sbjct: 792 FLHSKGVIHRDIKSDNILLSMDG-----NIKLTDFGFCAQINETNLK-------RTTMVG 839

Query: 245 TARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           T  +M+      +E   + D+ ++G +    + G+ P+
Sbjct: 840 TPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 877

>Scas_698.37
          Length = 347

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 22/158 (13%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           Y+I  KIG G +  +F G +++N +   IK  +P K     L+  +R  KIL    G P 
Sbjct: 58  YEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVK-----LRKIHRELKILWNLTGGPN 112

Query: 135 EYYFGQEGLHN-------ILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLH 187
                 + +H+        +  D+      +L+      F +  V     Q++  +   H
Sbjct: 113 IVEL-LDVVHDEKTRVPAFIFEDVKNVDFRELYP----TFKLSDVQYYFKQLLIALNYAH 167

Query: 188 AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 168 SMGIMHRDVKPQNVMI----DPVQRKLRLIDWGLAEFY 201

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILAGTPGIPQ 134
           Y +   +G+G+FG + +  N+I    +A+K    K+E   Q   E +  ++L        
Sbjct: 332 YLVLDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNN 391

Query: 135 EYYFGQ------EGLHNILVIDLLGPSLEDLF---DWCGRRFSVKTVVQVAVQMITLIED 185
           E++F +         H  LV +LL  +L +L    ++ G   S+  +   + Q++  +  
Sbjct: 392 EHHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHG--LSMTLIKTFSKQLLDSLCV 449

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQ-------------YRDPKTKQ 232
           L    LI+ D+KP+N L+    +PD   + +IDFG A +             YR P+   
Sbjct: 450 LKDSKLIHCDLKPENILLVSNDRPD---LKVIDFGSACEETRTIYTYIQSRFYRAPEVLL 506

Query: 233 HIPY 236
            IPY
Sbjct: 507 GIPY 510

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 169 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
           +  +V+   Q +  + D H   +I+RDIK DN L+   G     +V + DFG   +  D 
Sbjct: 621 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLDTHG-----RVKITDFGFCAKLTDK 672

Query: 229 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           ++K       + ++ GT  +M+      RE   + D+ ++G +    L G+ P+
Sbjct: 673 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 719

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 91/223 (40%), Gaps = 44/223 (19%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQE 135
           YK   KIG+G+ G ++    +     VAIK         Q+  E +  K L     I  E
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIK---------QMNLEKQPKKEL-----IVNE 743

Query: 136 YYFGQEGLHNILV--ID--------------LLGPSLEDLFDWCGRRFSVKTVVQVAVQM 179
               +   HN +V  ID              + G SL D+   C    +   +  V+ + 
Sbjct: 744 ILVMKGSKHNNIVNFIDSYLFRGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRET 801

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
           +  ++ LH+  +I+RDIK DN L+   G      + L DFG   Q  +   K       +
Sbjct: 802 LKGLQFLHSKGVIHRDIKSDNILLSMNGD-----IKLTDFGFCAQINEVNLK-------R 849

Query: 240 KSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
            ++ GT  +M+      +E   + D+ ++G +    + G+ P+
Sbjct: 850 TTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 90/209 (43%), Gaps = 26/209 (12%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMING---LPVA---IKFEPRKTEAPQLKDEYRTYKILAGT 129
           YK  +K+GEG++GV+++  ++  G     VA   I+ E      P      R   +L   
Sbjct: 8   YKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPS--TAIREISLLKEL 65

Query: 130 P--GIPQEYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIE 184
               I + Y       H + LV++ L   L+   +   +     V  + +  VQ+   I 
Sbjct: 66  KDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKKFMVQLCKGIA 125

Query: 185 DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 244
             HAH +++RD+KP N LI + G      + L DFG+A+ +        +P R       
Sbjct: 126 YCHAHRILHRDLKPQNLLIDKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIV 173

Query: 245 TARYMSINTHLGREQ-SRRDDMEAMGHVF 272
           T  Y +    LG +Q S   D  ++G +F
Sbjct: 174 TLWYRAPEVLLGGKQYSTGVDTWSIGCIF 202

>Kwal_55.21709
          Length = 340

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 30/163 (18%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQ 134
           HY+I  KIG G +  +F G  ++N     IK      +  +LK  YR  KIL    G P 
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIK----VLKPVKLKKIYRELKILTNLTGGP- 103

Query: 135 EYYFGQEGLHNILVIDLLGPS--------LEDL----FDWCGRRFSVKTVVQVAVQMITL 182
                    + I ++D++  S         E++    F     +F++  +     Q++  
Sbjct: 104 ---------NVIALLDIVQDSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIA 154

Query: 183 IEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           ++  H+  +++RD+KP N +I     P   K+ LID+G+A+ Y
Sbjct: 155 LDYCHSMGIMHRDVKPQNVMI----DPVERKLRLIDWGLAEFY 193

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 61/126 (48%), Gaps = 20/126 (15%)

Query: 158 DLFDWCGRR-----FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 212
           DLF +  ++      S    + +  Q++  ++ LH+  +++RD+K DN L+  P +P  +
Sbjct: 243 DLFSYLAKKDCLAPISETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTP-EP-CS 300

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS------INTHLGREQSRRDDME 266
           ++ L DFG+AK     + + H       ++ GT  Y +      ++ +  R  SR   ME
Sbjct: 301 RIVLADFGIAKDLPSTRVRMH-------TIVGTPEYCAPEVGFRVDRNSYRNFSRTASME 353

Query: 267 AMGHVF 272
             G+ F
Sbjct: 354 QQGYDF 359

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 14/127 (11%)

Query: 164 GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
           G R   K + ++A  ++  +  LH   +I+RDIKP N L+   GQ     V L DFG++ 
Sbjct: 333 GGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQ-----VKLCDFGVSG 387

Query: 224 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
           +  +             + +GT+ YM+     G+  S   D+ ++G       +   P+ 
Sbjct: 388 EAVNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFD 438

Query: 284 GLKAPNN 290
             K   N
Sbjct: 439 SGKFAAN 445

>Kwal_27.9804
          Length = 473

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 27/175 (15%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK---------------TEAPQ-LKDE 119
           YK+  KIGEG+F  +++  ++   +  A      K               T +PQ + +E
Sbjct: 26  YKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKRYVALKRIYVTSSPQRIYNE 85

Query: 120 YRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 179
                +L G+  +           H   VI +L     + F    R   +K + +   ++
Sbjct: 86  LNLLYMLCGSTRVAP---LCDALRHQDQVIAVLPWYPHEEFRNFYRDLPIKGIKKYMSEL 142

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK----QYRDPKT 230
           +  +  +H+  +I+RDIKP NFL      P   +  L+DFG+A+      RDP+T
Sbjct: 143 LQALSFVHSKAIIHRDIKPTNFLYS----PQLGRGVLVDFGLAETEVSHARDPET 193

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 71/162 (43%), Gaps = 18/162 (11%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD--------EYRTYKIL 126
            Y   KK+GEG++ V++ GT    G  +A+K    + +  + KD        E +  + +
Sbjct: 5   EYTKEKKVGEGTYAVVYVGTKQSTGRRIAVK----EIKTSEFKDGLDMSAIREVKYLQEM 60

Query: 127 AGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 186
                I     F   G  N LV++ L   LE +       F+   +    +  +  +   
Sbjct: 61  QHVNVIELVDIFMSYGNLN-LVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHC 119

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
           H + +++RD+KP+N LI   GQ     + + DFG+A+    P
Sbjct: 120 HRNFILHRDLKPNNLLIAPDGQ-----IKVADFGLARAVPSP 156

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 22/203 (10%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIK--FEPRKTEAPQLKDEYRTYKILAGTPG---IPQEY 136
           +G G+FG++   T+ +   PVAIK   +P  T     K  YR  K+L        I  E 
Sbjct: 28  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSV-LAKRTYRELKLLKHLRHENLICLED 86

Query: 137 YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 196
            F         V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 87  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 144

Query: 197 KPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 256
           KP N LI      +   + + DFG+A+  +DP+   ++  R  ++      +   N  + 
Sbjct: 145 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 197

Query: 257 REQSRRDDMEAMGHVFFYFLRGQ 279
                  D+ + G +F   + G+
Sbjct: 198 -------DIWSAGCIFAEMIEGK 213

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 14/96 (14%)

Query: 189 HDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 248
           + +I+RDIKP N LI   G     ++ L DFG++++  +      +         GT+ Y
Sbjct: 248 YKIIHRDIKPSNVLINSKG-----RIKLCDFGVSRKLNNSIADTFV---------GTSTY 293

Query: 249 MSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQG 284
           MS     G + + + D+ ++G +    L G+ P  G
Sbjct: 294 MSPERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGG 329

>Scas_700.35
          Length = 439

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 67/157 (42%), Gaps = 25/157 (15%)

Query: 126 LAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 185
           L G+  I  EY  GQ        +D +  SL       G R   K + ++A  ++  +  
Sbjct: 220 LNGSIYIAMEYMGGQS-------LDTIYKSLLSR----GGRIGEKILGKIAESVLRGLSY 268

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245
           LH   +I+RDIKP N L+   G+     V L DFG++ +  +             + +GT
Sbjct: 269 LHERKIIHRDIKPQNILLNEEGE-----VKLCDFGVSGEAVNSLA---------TTFTGT 314

Query: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           + YM+     G   S   D+ ++G       +G+ P+
Sbjct: 315 SFYMAPERIQGHPYSVTCDVWSLGLTILEVAQGRFPF 351

>Scas_700.28
          Length = 896

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 93/224 (41%), Gaps = 47/224 (20%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-------------FEPRKTEAPQLKDEYR 121
           +YKI  +IGEGSFG ++   +      V +K             F  R+ + P +   Y 
Sbjct: 37  NYKILDQIGEGSFGKVYLAQHRPTHTKVVLKSSDKNDPNIVREVFYHRQFDYPYITKLYE 96

Query: 122 TYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMIT 181
              I      +  EY  G+E    +L +                R      VQ+  Q++ 
Sbjct: 97  VI-ITETKVWMALEYCPGKELYDRVLSM---------------HRVPTDECVQLFAQIVG 140

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
            +   H+ + ++RD+K +N L+ + G  DA    L DFG     R+  TK  +     ++
Sbjct: 141 GVHYAHSLNCVHRDLKLENILLDKSG--DAK---LTDFGFT---RECMTKTTL-----ET 187

Query: 242 LSGTARYMSINTHLGREQSR---RDDMEAMGHVFFYFLRGQLPW 282
           + GT  YM+    L   +S    + D+ ++G + +  + G +P+
Sbjct: 188 ICGTTVYMA--PELIERKSYDGFKIDIWSLGVILYTMINGSMPF 229

>CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase,
           hypothetical start
          Length = 728

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 10/138 (7%)

Query: 158 DLFDWC-GRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           DLF      + S + +     Q++  ++ LH+  L +RD+K DN +I   G      V L
Sbjct: 459 DLFAIVMSNKMSYEEICCCFKQILCGVQYLHSIGLAHRDLKLDNCVINSKG-----IVKL 513

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEAMGHVFFYF 275
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 514 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFTKYDPRPVDIWSTAIIFACM 570

Query: 276 LRGQLPWQGLKAPNNKQK 293
           +  + PW+  K  +N  K
Sbjct: 571 ILKKFPWKIPKLRDNSFK 588

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 105/250 (42%), Gaps = 67/250 (26%)

Query: 80  KKIGEGSFG-VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKILAGTPGIP 133
           K +G GS G V++EG           KF+ R     ++  ++     +  ++L+ +   P
Sbjct: 605 KVLGYGSSGTVVYEG-----------KFQERSVAVKRMLVDFYDIASKEIELLSESDEHP 653

Query: 134 Q--EYYFGQEGLHNI-LVIDLLGPSLEDLFDWCG-----RRFSVKTVVQVAVQMITLIED 185
               YY  +E    + + ++L   +LE L +        +R     +V +  Q+   I  
Sbjct: 654 NVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQRLKDYELVDILAQITQGIAY 713

Query: 186 LHAHDLIYRDIKPDNFLIG-------RPGQPDAN---KVHLIDFGMAKQ--YRDPKTKQH 233
           LH+ ++I+RDIKP N LI        +P   + N   ++ L DFG+ K+  +     K +
Sbjct: 714 LHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTN 773

Query: 234 IPYREKKSLSGTARYMS-------------------------INTHLGREQSRRDDMEAM 268
           I     K+ +GT  +M+                          + +L R  ++  D+ ++
Sbjct: 774 I-----KNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYDPYLRRRLTKAIDIFSL 828

Query: 269 GHVFFYFLRG 278
           G VF+Y L G
Sbjct: 829 GCVFYYVLSG 838

>Scas_627.7
          Length = 349

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 17/113 (15%)

Query: 175 VAVQMITLIED----LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKT 230
           +A + +  I D    LH   +I+RD+KP+N LIG       N + L DFG +    +P+ 
Sbjct: 190 IASRFVFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWS--IINPRG 242

Query: 231 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
            +      +K+L GT  Y+S      RE   + D+ A+G + +  + G  P++
Sbjct: 243 VK------RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE 289

>Scas_668.22
          Length = 893

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 59/130 (45%), Gaps = 14/130 (10%)

Query: 153 GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 212
           G SL D+   C    +   +  V  + ++ ++ LH+  +++RDIK DN L+   G     
Sbjct: 690 GGSLTDVVTHC--ILTEGQIGAVCRETLSGLQFLHSKGVLHRDIKSDNILLSISGD---- 743

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVF 272
            + L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ ++G + 
Sbjct: 744 -IKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 795

Query: 273 FYFLRGQLPW 282
              + G+ P+
Sbjct: 796 IEMIEGEPPY 805

>Kwal_23.5290
          Length = 819

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 53/111 (47%), Gaps = 15/111 (13%)

Query: 172 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTK 231
           +V+   Q +  + D H   +I+RDIK DN L+      +  +V + DFG   +  D ++K
Sbjct: 650 IVRETCQGLKFLHDKH---IIHRDIKSDNVLLD-----NRARVKITDFGFCAKLTDKRSK 701

Query: 232 QHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
                  + ++ GT  +M+      RE   + D+ ++G +    L G+ P+
Sbjct: 702 -------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 745

>Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement
          Length = 434

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 86/203 (42%), Gaps = 22/203 (10%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIK--FEPRKTEAPQLKDEYRTYKILAGTPG---IPQEY 136
           +G G+FG++   T+     PVAIK   +P  T A   K  YR  K+L        I  E 
Sbjct: 29  VGMGAFGLVCSATDTYTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLED 87

Query: 137 YFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 196
            F         V +L G  L  L     R    + V     Q++  ++ +H+  +I+RD+
Sbjct: 88  IFLSPLEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDL 145

Query: 197 KPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 256
           KP N LI      +   + + DFG+A+  +DP+   ++  R  ++      +   N  + 
Sbjct: 146 KPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTRYYRAPEIMLTWQKYNVEV- 198

Query: 257 REQSRRDDMEAMGHVFFYFLRGQ 279
                  D+ + G +F   + G+
Sbjct: 199 -------DIWSAGCIFAEMIEGK 214

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 75/164 (45%), Gaps = 16/164 (9%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-EYRTYKILAGTP 130
           + + +   + +G GSFGV+F          VAIK   +  +  + K+ E    K+L    
Sbjct: 33  ITISFPATEVVGHGSFGVVFTTVIQETNEKVAIK---KVLQDKRFKNRELEIMKMLQHRN 89

Query: 131 GIPQEYYFGQ----EGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDL 186
            I  +YYF +    E +   L++D +  SL         + +    +++ + M  L + L
Sbjct: 90  IIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKAL 149

Query: 187 ----HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYR 226
               H  ++ +RDIKP N L+     P++  + L DFG AKQ +
Sbjct: 150 NYLHHTANVCHRDIKPQNLLVD----PNSWCLRLCDFGSAKQLK 189

>Scas_623.11
          Length = 378

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 84/165 (50%), Gaps = 18/165 (10%)

Query: 72  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-EYRTYKILAGTP 130
           + + +   + IG+GSFG++F  T       VAIK   +  +  + K+ E    K++    
Sbjct: 43  ITITFPTTEIIGKGSFGLVFCTTIRETDEVVAIK---KVLQDRRFKNRELEIMKLIQHPN 99

Query: 131 GIPQEYYFGQEGLHNI----LVIDLLGPSL-EDLFDWCGRRFSVKTVVQVAVQMITLIED 185
            I  +YYF ++ + +     L++D +  SL + L  +  +R S+ + +++   M  L + 
Sbjct: 100 VINLKYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSM-SRLEIKFYMFQLFKS 158

Query: 186 LH----AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYR 226
           L+    A ++ +RDIKP N L+     P++  + L DFG AKQ +
Sbjct: 159 LNYLHNAKNVCHRDIKPQNILVD----PNSWNLKLCDFGSAKQLK 199

>Scas_711.15
          Length = 727

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 14/79 (17%)

Query: 165 RRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQ-------------PDA 211
           R FS+ ++  +  Q++  I+ +H H+  +RDIKP+N L+  P +             PD 
Sbjct: 163 RVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVS-PNKRYFDKERLELGFYPDN 221

Query: 212 NKVHLIDFGMAKQYRDPKT 230
             V L DFG+A+   +  T
Sbjct: 222 YVVKLADFGLARHVENKNT 240

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 153 GPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 212
           G SL D+   C    S   +  V  + +  ++ LH+  +++RDIK DN L+   G     
Sbjct: 699 GGSLTDVVTHC--LLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSLKGN---- 752

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVF 272
            + L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ ++G + 
Sbjct: 753 -IKLTDFGFCAQINENNLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 804

Query: 273 FYFLRGQLPW 282
              + G+ P+
Sbjct: 805 IEMIEGEPPY 814

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 92/241 (38%), Gaps = 49/241 (20%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRK------TEAPQLKD-------E 119
           Y + + IG G++GV++         P AIK   FE          E   LK+       E
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFEDESELNEHMLEIDLLKNLRHQNIVE 69

Query: 120 YRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQM 179
           YR +   A    I  EY   +  L +IL     GP LED              V    Q 
Sbjct: 70  YRGFIQKAHELYIILEYC-ARGSLRDILK---HGPLLED------------DTVNYVTQT 113

Query: 180 ITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREK 239
           +  ++ LH   +I+RDIK  N L+   G      V L DFG++ +            R  
Sbjct: 114 LYGLQYLHEQGVIHRDIKAANLLLTEEG-----IVKLADFGVSTRIN----------RMA 158

Query: 240 KSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGE 299
            + +G+  +M+     G+  S   D+ ++G      L G  P+  L   N    Y  + E
Sbjct: 159 MTYAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPFHNL--VNESACYAIVNE 216

Query: 300 K 300
           +
Sbjct: 217 E 217

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 88/207 (42%), Gaps = 24/207 (11%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILAGTP- 130
           YK  +K+GEG++GV+++  ++ +   V     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 131 -GIPQEYYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRR--FSVKTVVQVAVQMITLIEDL 186
             I + Y       H + LV + L   L+   +   +        + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPLGGNIIKKFMMQLCKGIAYC 124

Query: 187 HAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 246
           HAH +I+RD+KP N LI R G      + L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRIIHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 247 RYMSINTHLGREQ-SRRDDMEAMGHVF 272
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDVWSIGCIF 199

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 14/98 (14%)

Query: 158 DLFDW-----CGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDAN 212
           DLF +     C    S    + +  Q++  +  LH  D+++RD+K DN L+  P +P   
Sbjct: 248 DLFSYLAKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTP-EP-CT 305

Query: 213 KVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 250
           ++ L DFG+AK     K + H       ++ GT  Y +
Sbjct: 306 RIVLADFGIAKDLNSNKERMH-------TVVGTPEYCA 336

>Kwal_14.2497
          Length = 418

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 12/123 (9%)

Query: 178 QMITLIEDLHAHD-LIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPY 236
           Q+I  I+ LH    + +RDIKP+N L+   G      + L DFG+A Q++     + I  
Sbjct: 30  QLINAIDHLHNRCGVAHRDIKPENLLLDERGN-----LKLADFGLASQFKRKDGSKRIMS 84

Query: 237 REKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEK 296
             + SL   A  +  +     + +   D+ + G + F  L G+ PW    +P++  +++ 
Sbjct: 85  DTRGSLPYMAPEIVYSKSYYADST---DIWSCGVLVFVLLTGETPWD---SPSDDSRFDD 138

Query: 297 IGE 299
             E
Sbjct: 139 FLE 141

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 15/114 (13%)

Query: 169 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
           +  +V+   Q +  + D H   +I+RDIK DN L+         +V + DFG   +  D 
Sbjct: 670 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLDTRA-----RVKITDFGFCARLTDK 721

Query: 229 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           ++K       + ++ GT  +M+      RE   + D+ ++G +    L G+ P+
Sbjct: 722 RSK-------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK),
           principal component of the high-osmolarity signal
           transduction pathway [1308 bp, 435 aa]
          Length = 435

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 76/163 (46%), Gaps = 18/163 (11%)

Query: 82  IGEGSFGVLFEGTNMINGLPVAIK--FEPRKTEAPQLKDEYRTYKILAGTPG----IPQE 135
           +G G+FG++   T+ +   PVAIK   +P  T A   K  YR  K+L           Q+
Sbjct: 29  VGMGAFGLVCSATDTLTSQPVAIKKIMKPFST-AVLAKRTYRELKLLKHLRHENLICLQD 87

Query: 136 YYFGQEGLHNI-LVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYR 194
            +     L +I  V +L G  L  L     R    + V     Q++  ++ +H+  +I+R
Sbjct: 88  IFLSP--LEDIYFVTELQGTDLHRLLQ--TRPLEKQFVQYFLYQILRGLKYVHSAGVIHR 143

Query: 195 DIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYR 237
           D+KP N LI      +   + + DFG+A+  +DP+   ++  R
Sbjct: 144 DLKPSNILIN-----ENCDLKICDFGLAR-IQDPQMTGYVSTR 180

>Scas_477.5
          Length = 703

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 71/149 (47%), Gaps = 14/149 (9%)

Query: 137 YFG--QEGLH-NILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIY 193
           Y+G  QEG + NI +  + G S+  + +  G  F    +V    Q++  +  LH  ++I+
Sbjct: 506 YYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGP-FEESLIVNFIRQVLIGVAYLHNKNIIH 564

Query: 194 RDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT 253
           RDIK  N LI   G      V + DFG++K+   P +KQ     ++ SL G+  +M+   
Sbjct: 565 RDIKGANILIDTKGC-----VKITDFGISKKL-SPLSKQD----KRASLQGSVYWMAPEV 614

Query: 254 HLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
                 + + D+ + G V      G+ P+
Sbjct: 615 VKQTATTEKADIWSTGCVVIEMFTGKHPF 643

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 178 QMITLIEDLH-AHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPY 236
           Q++  I  LH    + +RDIKP+N L+ + G      + L DFG+A Q+R     + +  
Sbjct: 68  QLLRAIHHLHEVCGIAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTKRLAR 122

Query: 237 REKKSLSGTARYMSINTHLGRE-QSRRDDMEAMGHVFFYFLRGQLPWQ 283
            ++    G+  YM+       E  +   D+ + G + F  L G+ PW+
Sbjct: 123 DQR----GSPPYMAPEIIYSSEYYADTTDIWSCGILVFVLLTGETPWE 166

>Scas_613.13*
          Length = 312

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 74/173 (42%), Gaps = 32/173 (18%)

Query: 71  IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTP 130
           I    Y  GKK+GEG++ V++ GT    G  +A+K    + +  + KD      I     
Sbjct: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVK----EIKTSEFKDGLDMSAI----- 59

Query: 131 GIPQEYYFGQEGLH-NI--------------LVIDLLGPSLEDLFDWCGRRFSVKTVVQV 175
              +E  + QE  H N+              LV++ L   LE +       F+   +   
Sbjct: 60  ---REVKYLQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSW 116

Query: 176 AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
            +  +  +   H + +++RD+KP+N L+     PD   + + DFG+A+    P
Sbjct: 117 MLMTLRGVHHCHRNFILHRDLKPNNLLLS----PDG-VIKVADFGLARAVPSP 164

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 90/186 (48%), Gaps = 12/186 (6%)

Query: 74  LHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQLKDEYRTYKILAGTP 130
           + +K+GK IG G++G++ E  ++ +G   A+K   F+  +     +  E   +K +    
Sbjct: 485 MGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKIVRFKDNQKVKRNVIREVNVWKEMHHMY 544

Query: 131 GIPQ-EYYFGQEGLHNILVIDLLGPSLEDL-FDWCGRRFS-------VKTVVQVAVQMIT 181
            +P  ++    +     L   +   +L DL   W  R+ +       +K  + + +Q+I+
Sbjct: 545 ILPLLDWKLISDYAMYCLTERVKDGTLYDLVLSWEDRKNNQIPVDERIKLTMFLMLQLIS 604

Query: 182 LIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKS 241
            ++ +H++  ++ DIK +N L+ +  Q     + L DFGM+ ++   +++      E+K+
Sbjct: 605 ALKYMHSNSTVHGDIKLENCLLKKGRQHKNWTIFLCDFGMSCRFGSYRSRYDTLIDEEKN 664

Query: 242 LSGTAR 247
            SG  R
Sbjct: 665 NSGIIR 670

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 103/238 (43%), Gaps = 35/238 (14%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRT-YKILAGT--PG 131
           Y +GK++G G + ++ E  N   G  VA+K F  ++ +  +   ++R    IL     P 
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPN 259

Query: 132 IPQEYY-----FGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAV--QMITLIE 184
           I            +  +   LV++ +     +LF+   R+  ++     A+  Q++T ++
Sbjct: 260 IVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 185 DLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL--------------IDFGMAKQYRDPKT 230
            LH  ++I+RDIKP+N L+    + + ++V L               DFG+AK   +   
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGE--- 374

Query: 231 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAP 288
                 +   +L GT  Y++      +  + + D+ + G + +  L G  P+     P
Sbjct: 375 -----MQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 427

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 101/244 (41%), Gaps = 54/244 (22%)

Query: 79  GKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEA--PQLKDEYRTYKILAGTPG-- 131
           G +IG GSFG ++ G N   G  +A+K    +P    A    + DE +     A +PG  
Sbjct: 442 GARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKK----AHSPGGG 497

Query: 132 -----------------------IPQEY-------YFG--QEGLH-NILVIDLLGPSLED 158
                                  I +E        Y+G  QEG + NI +  + G S+  
Sbjct: 498 NTAVKNTSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSS 557

Query: 159 LFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLID 218
           + +  G  F    V     Q++  +  LH  ++I+RDIK  N LI   G      V + D
Sbjct: 558 MLNNYGP-FDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKG-----GVKITD 611

Query: 219 FGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRG 278
           FG++K+   P  KQ     ++ SL G+  +M+         + + D+ ++G V      G
Sbjct: 612 FGISKKL-SPLNKQQ---NKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVIVEMFTG 667

Query: 279 QLPW 282
           + P+
Sbjct: 668 KHPF 671

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 78/150 (52%), Gaps = 27/150 (18%)

Query: 159 LFDWCGRRFSVKT--VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHL 216
           L D+  +  S+K     +V+  +++ ++ LHA+++++RD+K +N ++ + G+     + L
Sbjct: 178 LLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGE-----IKL 232

Query: 217 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARY-----MSINTHLGREQSRRDDMEAMGHV 271
           IDFG++  Y DP+       +  ++  G+  +     +  + +LG E     D+ + G V
Sbjct: 233 IDFGLSNMY-DPR-------KSLQTFCGSLYFAAPELLKAHPYLGPEV----DVWSFGVV 280

Query: 272 FFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 301
            +  + G++P+      N+   +EKI + K
Sbjct: 281 LYVLVCGKVPFDD---ENSSALHEKIKKGK 307

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 93/217 (42%), Gaps = 19/217 (8%)

Query: 76  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQ- 134
           +K  + IG G FGV+++  +       A+K         +++D  +  + LA    +P  
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDEVEDVQKEIQFLASLKQVPNI 84

Query: 135 EYYFGQEGLHNILVIDL---LGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDL 191
             Y+G       L + +    G SL  L      +   K +  +  +++  +  +H  ++
Sbjct: 85  TRYYGSYLYDTKLWVIMEYCAGGSLRTLLR--PGKIDEKYLGVIVRKLLIALVYIHKDNV 142

Query: 192 IYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI 251
           I+RDIK  N LI   G      V L DFG+A Q      K       +++++GT  +M+ 
Sbjct: 143 IHRDIKAANVLITNEGH-----VKLCDFGVAAQLTAANHK-------RQTMAGTPYWMAP 190

Query: 252 NTHL-GREQSRRDDMEAMGHVFFYFLRGQLPWQGLKA 287
              + G   + + D+ ++G   +    G  P+  ++A
Sbjct: 191 EVIMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEA 227

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 94/251 (37%), Gaps = 47/251 (18%)

Query: 75  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK----------------- 117
           +Y+  +K+G+G+FG +F+G ++     VAIK    + E                      
Sbjct: 54  NYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNHKN 113

Query: 118 ---------DEYRTYKILAGTPGIPQEYYFGQ---------EGLHNILVIDLLGPSLEDL 159
                    DE  T K  + +P  P   Y G           G H  +++  +   L  L
Sbjct: 114 IVKLIEIVYDESPTPKTDSTSPR-PVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTGL 172

Query: 160 FDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDF 219
                  F +  V  + +Q++  I  +H +  ++RDIK  N LI   G      V + DF
Sbjct: 173 LHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDHKGV-----VKIADF 227

Query: 220 GMAKQYRDPKTKQHIP-----YREKKSLSGTARYMSINTHLG-REQSRRDDMEAMGHVFF 273
           G+A+ Y         P       +  S+  T  Y +    LG R  +   D+  +G VF 
Sbjct: 228 GLARNYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTAVDIWGIGCVFA 287

Query: 274 YFLRGQLPWQG 284
            F   +   QG
Sbjct: 288 EFFEKKPILQG 298

>Kwal_23.6458
          Length = 868

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 19/121 (15%)

Query: 178 QMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPK-------- 229
           +++  IE LH    IYRD+KP+N L+ + G      + L DF ++ Q +D K        
Sbjct: 572 EVVAAIEYLHLMGFIYRDLKPENILLHKSGH-----IMLSDFDLSVQAKDTKNPVVKGSA 626

Query: 230 ------TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQ 283
                 TK         S  GT  Y++     G   +   D   +G + +  L G  P++
Sbjct: 627 QSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYK 686

Query: 284 G 284
           G
Sbjct: 687 G 687

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 15/114 (13%)

Query: 169 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDP 228
           +  +V+   Q +  + D H   +I+RDIK DN L+   G     +V + DFG   +  D 
Sbjct: 707 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLDTRG-----RVKITDFGFCAKLTDK 758

Query: 229 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
           ++K       + ++ GT  +M+      RE   + D+ ++G +    L  + P+
Sbjct: 759 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLESEPPY 805

>Scas_667.18
          Length = 437

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 38/170 (22%)

Query: 76  YKIGKKIGEGSFGVL---FEGTNMINGLPVAIKFEPRKTEAPQ----LKDEYRTYKILAG 128
           YKI K +G+GS+GV+    +  N  N  PVAIK   + T   Q    LK   R  K +  
Sbjct: 78  YKIIKVLGKGSYGVVCSAMDNKNPANAYPVAIK---KVTNIFQKEILLKRAIRELKFM-- 132

Query: 129 TPGIPQEYYFGQEGLHNILVIDLLGP--------SLEDLFDWCGRRF---SVKT----VV 173
                  ++ G + + N++ ++++            ++L D+   +    S+K     + 
Sbjct: 133 ------NFFQGHKNIVNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHSSIKLTEFHIQ 186

Query: 174 QVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAK 223
               Q+++ ++ +H+ D+I+RD+KP N L    G      + + DFG+A+
Sbjct: 187 YFMYQILSGLKYIHSADVIHRDLKPGNILCTLNGN-----LKICDFGLAR 231

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 186 LHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 245
           LH  ++I+RDIK DN L+         +V + DFG   +  D ++K       + ++ GT
Sbjct: 703 LHDKNIIHRDIKSDNVLLDTKA-----RVKITDFGFCAKLTDQRSK-------RATMVGT 750

Query: 246 ARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPW 282
             +M+      +E   + D+ ++G +    L G+ P+
Sbjct: 751 PYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPY 787

>Scas_201.1*
          Length = 274

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 166 RFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQY 225
           +F+    V + VQ++  ++ +H+ ++++RD+KP+N L   P   D +++ + DFG+AK+ 
Sbjct: 130 KFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPS--DESQLVIADFGIAKEL 187

Query: 226 R 226
           +
Sbjct: 188 K 188

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,232,323
Number of extensions: 726145
Number of successful extensions: 2531
Number of sequences better than 10.0: 560
Number of HSP's gapped: 2319
Number of HSP's successfully gapped: 568
Length of query: 537
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 431
Effective length of database: 12,926,601
Effective search space: 5571365031
Effective search space used: 5571365031
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)