Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YNL025C (SSN8)32331815650.0
CAGL0M06875g33933612661e-176
Scas_666.2633533312211e-170
Sklu_2251.929931911591e-161
ADL207W36031811381e-157
Kwal_27.1149429931810601e-146
KLLA0E08151g30431910231e-140
KLLA0E06666g3982391126e-06
YPR025C (CCL1)3932761037e-05
Kwal_27.10641376241966e-04
Scas_672.12374232910.002
CAGL0K05115g367237880.005
AGL273C399134800.055
YGR109C (CLB6)38031700.90
YPR119W (CLB2)49172691.1
KLLA0E03751g60055662.7
YLR227C (ADY4)49339645.4
Scas_684.1833047636.3
KLLA0F11231g43457628.5
Scas_716.18d43273619.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YNL025C
         (318 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C ...   607   0.0  
CAGL0M06875g complement(699260..700279) highly similar to sp|P47...   492   e-176
Scas_666.26                                                           474   e-170
Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement        451   e-161
ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH] complement(...   442   e-157
Kwal_27.11494                                                         412   e-146
KLLA0E08151g complement(737811..738725) similar to sp|P47821 Sac...   398   e-140
KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyce...    48   6e-06
YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C ...    44   7e-05
Kwal_27.10641                                                          42   6e-04
Scas_672.12                                                            40   0.002
CAGL0K05115g complement(497262..498365) similar to sp|P37366 Sac...    39   0.005
AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH] (194015..19...    35   0.055
YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyc...    32   0.90 
YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific...    31   1.1  
KLLA0E03751g 352621..354423 some similarities with sgd|S0006359 ...    30   2.7  
YLR227C (ADY4) [3627] chr12 complement(590564..592045) Protein w...    29   5.4  
Scas_684.18                                                            29   6.3  
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    28   8.5  
Scas_716.18d                                                           28   9.8  

>YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C
           homolog, component of RNA polymerase holoenzyme complex
           and Kornberg's mediator (SRB) subcomplex [972 bp, 323
           aa]
          Length = 323

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/318 (95%), Positives = 304/318 (95%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIP 60
           MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIP
Sbjct: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIP 60

Query: 61  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120
           ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML
Sbjct: 61  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120

Query: 121 VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHP 180
           VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVT              IVHHP
Sbjct: 121 VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELESYLIVHHP 180

Query: 181 YQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI 240
           YQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI
Sbjct: 181 YQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI 240

Query: 241 HGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHW 300
           HGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHW
Sbjct: 241 HGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHW 300

Query: 301 DKYHEQWIKFLLHTLYLR 318
           DKYHEQWIKFLLHTLYLR
Sbjct: 301 DKYHEQWIKFLLHTLYLR 318

>CAGL0M06875g complement(699260..700279) highly similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8, start by
           similarity
          Length = 339

 Score =  492 bits (1266), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/336 (70%), Positives = 271/336 (80%), Gaps = 19/336 (5%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQS------ 54
           MSGS+WTS QR  WQ+TK SLA+ERQ+LW++ECQLFPQGLNI++DSK N  + S      
Sbjct: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDSKPNSADSSNGNAAN 60

Query: 55  ------------ITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 102
                        TKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY
Sbjct: 61  NGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIY 120

Query: 103 LSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTX 162
           LSRFL+KASVRE+NLY+LVTTCVYLACKVEECPQYIRTLVSEAR+LWPEFIPPDPTKVT 
Sbjct: 121 LSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVTE 180

Query: 163 XXXXXXXXXXXXXIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHL 222
                        IVHHPY+S++QIV+ LK+ PF++T +SD+LQNCWSLINDS+INDVHL
Sbjct: 181 FEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVHL 240

Query: 223 LYPPHIIAVACLFITISIHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVD 282
            Y PHIIA+ACLFIT+SI G  TK  SL SA +E +   ++S +P Q  F RF+AES VD
Sbjct: 241 TYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTS-QSSLTPQQQTFFRFLAESHVD 299

Query: 283 LEEVMDTIQEQITLYDHWDKYHEQWIKFLLHTLYLR 318
           LEEVMDTIQ+QI LYDHWD+YHE WIK+LLHTLYLR
Sbjct: 300 LEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLR 335

>Scas_666.26
          Length = 335

 Score =  474 bits (1221), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/333 (69%), Positives = 264/333 (79%), Gaps = 19/333 (5%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQ-------NG-IE 52
           MSGS+WTSTQRH+WQ+TK SLAKERQKLW+LECQLFPQGLNI MD+ +       NG I 
Sbjct: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60

Query: 53  QSITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASV 112
           +  TKNIPITHRDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ ALATAHIYLSRFL++ SV
Sbjct: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120

Query: 113 REINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXX 172
           RE+NLY+LVTT VYLACKVEECPQYIRTLVSEAR+LWPEF+PPDPTKVT           
Sbjct: 121 REVNLYLLVTTTVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTEFEFYLLEELE 180

Query: 173 XXXIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVA 232
              IVHHPY+ L+QIV+ LK  PFQ+ L++DDLQNCWSLINDSYI D +L+YPPHIIA++
Sbjct: 181 SYLIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240

Query: 233 CLFITIS-------IHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEE 285
           CLFITI+       +    TK  +L + A       +N  S  Q  FN +MA+S VDLEE
Sbjct: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSG----ENGMSKTQEVFNLYMAQSQVDLEE 296

Query: 286 VMDTIQEQITLYDHWDKYHEQWIKFLLHTLYLR 318
           VMDTIQEQITLYDHWDKYHE W+KFLLHTLYLR
Sbjct: 297 VMDTIQEQITLYDHWDKYHEPWVKFLLHTLYLR 329

>Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement
          Length = 299

 Score =  451 bits (1159), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 254/319 (79%), Gaps = 22/319 (6%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMD-SKQNGIEQSITKNI 59
           MS S+W STQRH WQYT+ SLA+ERQ LWL+ECQLFP GL+IVM+ SK  G +QSIT+NI
Sbjct: 1   MSASYWESTQRHKWQYTRESLARERQNLWLMECQLFPHGLSIVMENSKNGGQQQSITRNI 60

Query: 60  PITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYM 119
           PI+H+DLHYDKDYNLRIYCYFLIMKLGRRLNIRQ ALATAH+YLSRFL+KAS+RE+NLY+
Sbjct: 61  PISHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLSRFLLKASIREVNLYL 120

Query: 120 LVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHH 179
           LVTTC+YLACKVEECPQ+IRTLV+EAR+LWPEF+PPDPTKVT              IVHH
Sbjct: 121 LVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYLIVHH 180

Query: 180 PYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITIS 239
           PY+S++ IV  L++ P+Q+ LS +DLQN WSLINDSYI D+HL+YPPH+IA+AC+FIT+ 
Sbjct: 181 PYRSMEHIVSSLREEPYQLALSPEDLQNSWSLINDSYITDLHLMYPPHVIAMACMFITVC 240

Query: 240 IHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDH 299
           +                     K S S  Q  FNRFMAES VDL+EVM+ IQ+ ITLYDH
Sbjct: 241 L---------------------KKSVSHRQQTFNRFMAESQVDLQEVMNVIQDLITLYDH 279

Query: 300 WDKYHEQWIKFLLHTLYLR 318
           WDKY+E WIKFLLHT+YLR
Sbjct: 280 WDKYNEPWIKFLLHTVYLR 298

>ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH]
           complement(339219..340301) [1083 bp, 360 aa]
          Length = 360

 Score =  442 bits (1138), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 251/318 (78%), Gaps = 20/318 (6%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIP 60
           MS S+W S+QR+ WQY++ SLA+ RQKLW+LECQL+PQG NI+M+       Q +TKNIP
Sbjct: 29  MSASYWDSSQRNKWQYSRESLARTRQKLWMLECQLYPQGTNILMEGGGKD-AQPVTKNIP 87

Query: 61  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120
           ITHRDLHYD+DYNLRIYCYFLIMKLGRRLN+RQYALATAH+YL+RF +KAS+RE+NLY+L
Sbjct: 88  ITHRDLHYDRDYNLRIYCYFLIMKLGRRLNVRQYALATAHVYLARFCLKASIREVNLYLL 147

Query: 121 VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHP 180
           VTTC+YLACKVEECPQ+IRTLV+EAR+LWPEF+PPDPTKVT              IVH+P
Sbjct: 148 VTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYMIVHYP 207

Query: 181 YQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI 240
           Y++++QI   L++PP+ + LS DDLQN WSLINDSYI DVHLLYPPH+IA+ACLFIT+  
Sbjct: 208 YRAMEQIAAALRRPPYNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMACLFITV-- 265

Query: 241 HGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHW 300
                    L SAA    RD       +Q  FNRFMA+S VDL EVMDTIQ+ ITLYDHW
Sbjct: 266 --------CLRSAA--GARD-------LQETFNRFMADSQVDLHEVMDTIQDFITLYDHW 308

Query: 301 DKYHEQWIKFLLHTLYLR 318
           DKY+E WIKFLLH LYLR
Sbjct: 309 DKYNEPWIKFLLHNLYLR 326

>Kwal_27.11494
          Length = 299

 Score =  412 bits (1060), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/318 (61%), Positives = 242/318 (76%), Gaps = 21/318 (6%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIP 60
           MS S+W STQR  WQYT+  L +ER +LWLLECQLFPQGL + M++ + G  + +++NIP
Sbjct: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNK-GTGEPVSRNIP 59

Query: 61  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120
           ITH D+HY KD+NLRIYCYFLIMKLGRRLNIRQYALATAH+YL+RFL++ASVRE+NLY+L
Sbjct: 60  ITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLL 119

Query: 121 VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHP 180
           VTTC+YLACKVEECPQ+IRTLV+EAR+LWPEF+PPDPTKVT              +VHHP
Sbjct: 120 VTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHP 179

Query: 181 YQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI 240
           Y++++QIV  L+  P+ +TLS+ DLQN WSLINDSYI D+HLL PPH+IA+A L I + +
Sbjct: 180 YRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVCL 239

Query: 241 HGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHW 300
             +P + +                    Q  FN FMA+S VDL EVMDTIQ+ ITLYD+W
Sbjct: 240 Q-RPHRPAH-------------------QETFNNFMAKSQVDLAEVMDTIQDLITLYDYW 279

Query: 301 DKYHEQWIKFLLHTLYLR 318
           DKY+E WIKFLLH LYLR
Sbjct: 280 DKYNEPWIKFLLHCLYLR 297

>KLLA0E08151g complement(737811..738725) similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8 DNA-directed RNA
           polymerase II holoenzyme and Kornberg s mediator (SRB)
           subcomplex subunit, cyclin C homolog singleton, start by
           similarity
          Length = 304

 Score =  398 bits (1023), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/319 (61%), Positives = 237/319 (74%), Gaps = 23/319 (7%)

Query: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVM-DSKQNGIEQSITKNI 59
           MS S+W S+QRH W+YT+ SLAKE+QKLWLLECQLFPQGLN+ + DSK N   + +T NI
Sbjct: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKAN---KQVTTNI 57

Query: 60  PITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYM 119
           P+T RDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ AL TAH+YLSRFL++ASVRE+NLY+
Sbjct: 58  PVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYL 117

Query: 120 LVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHH 179
           L+TTC+YLACKVEECPQ+IRTLV+EAR+LWPEFIPPD TKVT              IVHH
Sbjct: 118 LITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHH 177

Query: 180 PYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITIS 239
           PY+SL+QI + L    +   LS D+LQ  WSLINDSY  DVHLLY PH+IA++CLF    
Sbjct: 178 PYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLF---- 233

Query: 240 IHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDH 299
                        A S  I  P++S+    I  N F+AE+ V+LE+VM  +QE I+LYDH
Sbjct: 234 -------------AVSCIIHKPEDSTKRANI--NMFIAETQVNLEQVMFILQELISLYDH 278

Query: 300 WDKYHEQWIKFLLHTLYLR 318
           WDKY+E  I+ LLH LYLR
Sbjct: 279 WDKYNELRIRALLHELYLR 297

>KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyces
           cerevisiae YPR025c CCL1 TFIIH subunit (transcription
           initiation factor), cyclin C component, start by
           similarity
          Length = 398

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 88/239 (36%), Gaps = 26/239 (10%)

Query: 8   STQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSI-----TKNIPIT 62
           S+Q   W +TK  L   R+ L         + L  ++ SK N + Q        K +P+T
Sbjct: 61  SSQYRLWSFTKEQLESRRRALNAKVVDKVNEKLQDII-SKHNDLSQEELNAINEKAVPVT 119

Query: 63  HRDLHYDKDYNLRIYCYFL--IMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120
             +        L+   +F   +      LN+     ATA  +  RF +  S  EI+   +
Sbjct: 120 MEE-------ELKFVNFFAKKVQSFCHSLNLPTEVCATAISFFRRFFLVNSTMEIHPKHI 172

Query: 121 VTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHP 180
           +   ++LACK E     I     + ++         PT +               + HHP
Sbjct: 173 LLASIFLACKSENYFIGIEAFAKKTKS--------QPTTILKYEFDVLESLQFTLLNHHP 224

Query: 181 YQSLKQI---VQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFI 236
           Y+ L      +Q +      +        NC   I ++ + DV   Y P  I +ACL I
Sbjct: 225 YRPLHGFFLDIQYILHGKVDLNYMGQIYTNCKRRITETLLTDVVYHYTPPQITLACLLI 283

>YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C
           component of RNA polymerase transcription initiation
           factor TFIIH, required for PolII transcription, for
           nucleotide excision repair, and for activity of Kin28p
           [1182 bp, 393 aa]
          Length = 393

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/276 (21%), Positives = 105/276 (38%), Gaps = 28/276 (10%)

Query: 8   STQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSI----TKNIPITH 63
           S+Q   W YTK  L ++R            + L +      N  E+ I     K IP+T 
Sbjct: 52  SSQYRMWSYTKDQLQEKRVDTNARAIAYIEENL-LKFREAHNLTEEEIKVLEAKAIPLT- 109

Query: 64  RDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTT 123
                +++ +L  +    +  + + LN+    +ATA  +  RF ++ SV +I+   +V T
Sbjct: 110 ----MEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKSIVHT 165

Query: 124 CVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHPYQS 183
            ++LACK E     + +   +A++            V               + HHPY+ 
Sbjct: 166 TIFLACKSENYFISVDSFAQKAKSTR--------DSVLKFEFKLLESLKFSLLNHHPYKP 217

Query: 184 LKQI---VQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFI---- 236
           L      +Q +      +         C   I  + + DV   Y P  I +A L I    
Sbjct: 218 LHGFFLDIQNVLYGKVDLNYMGQIYDRCKKRITAALLTDVVYFYTPPQITLATLLIEDEA 277

Query: 237 --TISIHGK-PTKGSSLASAASEAIRDPKNSSSPVQ 269
             T  +  K P++  S  S       +P+N +S  +
Sbjct: 278 LVTRYLETKFPSREGSQESVPGNEKEEPQNDASTTE 313

>Kwal_27.10641
          Length = 376

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/241 (19%), Positives = 88/241 (36%), Gaps = 30/241 (12%)

Query: 8   STQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQN-------GIEQSITKNIP 60
           S+Q   W +T   L + R +          Q L    D   +       GI++   K +P
Sbjct: 32  SSQYRLWSFTPERLTQMRHETNARARTKIEQDLRAFRDMNPDLSAEELAGIDE---KAVP 88

Query: 61  ITHRDLHYDKDYNLRIYCYF--LIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLY 118
           ++  +        + +  YF  +++    ++N+     ATA  +  +F +  SV E++  
Sbjct: 89  VSAEE-------EILLVNYFARMLLSFANKMNLPTEVAATAISFFRKFYLSNSVAELSPK 141

Query: 119 MLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVH 178
            +  T ++ ACK E     + +   +ART            V               + H
Sbjct: 142 EIFHTALFFACKSENYFIGVESFAKKARTTT--------EAVLKHEFRLLESLNFTIMNH 193

Query: 179 HPYQSLKQI---VQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLF 235
           HPY++L      +Q +      +        +C   I D+ + D    Y P  I +A L 
Sbjct: 194 HPYKALHGFFLDIQTVLAGKVDMKYMGQVYTDCKKFITDALLTDAVYFYTPPQITLATLL 253

Query: 236 I 236
           +
Sbjct: 254 M 254

>Scas_672.12
          Length = 374

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 90/232 (38%), Gaps = 13/232 (5%)

Query: 8   STQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLH 67
           S+Q   W ++K  L ++R     +      +  NI+    Q  + Q     +    + L 
Sbjct: 60  SSQYRFWSFSKERLREKRVNTNKIAADTIYK--NILDFKNQQDLTQEQLDVLDARTQPLS 117

Query: 68  YDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYL 127
            D +  L  +    +  + + LN+    +AT+  +  +F ++ SV + +   LV T ++L
Sbjct: 118 VDDELKLINFYAKKVQVISQHLNLPTEIIATSISFFKKFFLENSVMQYDPKSLVHTTIFL 177

Query: 128 ACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHPYQSLKQI 187
           ACK E     + +   +A++        +   +               ++HHPY+ L   
Sbjct: 178 ACKAENYFISVDSFAKKAKS--------NREAILKYEFKLLESLKFSLLIHHPYKPLHGF 229

Query: 188 ---VQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFI 236
              +Q +      +         C   I ++ + DV  L+ P  I +A L I
Sbjct: 230 FLDIQNVLHGKVDLNYMGQIYDKCKKKITEAILTDVVYLFTPPQITLAILMI 281

>CAGL0K05115g complement(497262..498365) similar to sp|P37366
           Saccharomyces cerevisiae YPR025c Cyclin, hypothetical
           start
          Length = 367

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 92/237 (38%), Gaps = 21/237 (8%)

Query: 8   STQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLH 67
           S+Q   W +T   L ++R +       +  + L    +  ++ +   + K I      + 
Sbjct: 40  SSQFRLWSFTPDKLLQKRTETNARAVVVIEEKLRAFKEKHKDELTPDVAKVIDSKATPIT 99

Query: 68  YDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYL 127
            +++  L  +    +  + +++++    +AT+  +  RF ++ SV E+    +V T ++L
Sbjct: 100 TEEELKLVNFYAQKVQVIAQKMSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFL 159

Query: 128 ACKVEECPQYIRTLVSEART-----LWPEFIPPDPTKVTXXXXXXXXXXXXXXIVHHPYQ 182
           ACK E     + +   +A+      L  EF   +  K T              + HHPY+
Sbjct: 160 ACKSENYFISVNSFAEKAKATKETILKYEFKLLETLKFT-------------LMNHHPYK 206

Query: 183 SLKQI---VQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFI 236
            L      +Q        +       + C   I ++ + D    Y P  I +A L I
Sbjct: 207 PLHGFFLDIQKTLHGKIDLKYMGKIYEKCKKRITEALLTDAVYFYTPPQITLATLMI 263

>AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH]
           (194015..195214) [1200 bp, 399 aa]
          Length = 399

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%), Gaps = 13/134 (9%)

Query: 5   FWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITK----NIP 60
           +  STQ   W +    L + R++L L   ++  Q ++    S    +E+  T      +P
Sbjct: 36  YRASTQYRLWSFRPEQLRQIREELNLRVAKVVEQRVDQYKASHPELLEEERTALEQMAVP 95

Query: 61  ITHRDLHYDKDYNLRIYCYFL--IMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLY 118
           +T        D  L++  ++   +   G  L +     ATA  +  +F +  SV E++  
Sbjct: 96  LTA-------DEELKLVNFYAKKVRHFGNSLELPTEVTATAISFFRKFFLTNSVMELHPK 148

Query: 119 MLVTTCVYLACKVE 132
            ++ T ++LACK E
Sbjct: 149 NILWTTIFLACKSE 162

>YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyclin
           appearing late in G1, involved in initiation of DNA
           synthesis [1143 bp, 380 aa]
          Length = 380

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 103 LSRFLIKASVREINLYMLVTTCVYLACKVEE 133
           L RFL +  V+   L +L  TC+++ACK EE
Sbjct: 184 LDRFLSQNVVKLNKLQLLCITCLFIACKFEE 214

>YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific
           cyclin [1476 bp, 491 aa]
          Length = 491

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 63  HRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVT 122
           HR++H ++D    I   +L+ K+  +  +    L  A   + RFL K  V+   L ++ T
Sbjct: 254 HRNIHQNRD----ILVNWLV-KIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGT 308

Query: 123 TCVYLACKVEEC 134
           +C+++A K EE 
Sbjct: 309 SCLFIASKYEEV 320

>KLLA0E03751g 352621..354423 some similarities with sgd|S0006359
           Saccharomyces cerevisiae YPR155c NCA2 control of
           mitochondrial synthesis of ATP6P and Atp8p, hypothetical
           start
          Length = 600

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 28/55 (50%)

Query: 259 RDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDHWDKYHEQWIKFLLH 313
           RD + S S + +  N F+ E   + ++V+  I++ +    HWD    +W + + H
Sbjct: 27  RDKEISQSALSLPLNEFVIELKQEADQVIAAIEKNVRHDMHWDTLQTKWSQLISH 81

>YLR227C (ADY4) [3627] chr12 complement(590564..592045) Protein with
           role in sporulation [1482 bp, 493 aa]
          Length = 493

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 21  LAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNI 59
           LA  R K+W  EC +F   + +++DS  N + ++I KNI
Sbjct: 268 LAILRGKIWECECDVFGPRIGLLVDS--NHMNETIQKNI 304

>Scas_684.18
          Length = 330

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 84  KLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYLACK 130
           +L  RLN  +  L TA  Y  R+ +  S      Y L T+C+ L+CK
Sbjct: 51  ELCTRLNFPRKTLETALYYYQRYHLFNSFETELCYTLATSCLVLSCK 97

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 188 VQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHL-LYPPHIIAVACLFITISIHGK 243
           + + K+ P+  + S D L  CW L  ++ I D H  L   H + V      I+  G+
Sbjct: 171 IAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGR 227

>Scas_716.18d
          Length = 432

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 61  ITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYML 120
           I H+++ +++D    I   +LI K+  +  +    L  A   L RFL K  V    L ++
Sbjct: 193 IKHKNITHNRD----ILINWLI-KVHNKFGLLPETLYLAINLLDRFLSKEEVTLNKLQLV 247

Query: 121 VTTCVYLACKVEE 133
            T C+++A K EE
Sbjct: 248 GTYCLFIASKYEE 260

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,942,761
Number of extensions: 384144
Number of successful extensions: 1498
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1505
Number of HSP's successfully gapped: 27
Length of query: 318
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 216
Effective length of database: 13,065,073
Effective search space: 2822055768
Effective search space used: 2822055768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)