Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR274C (RCE1)31531016270.0
Scas_696.373223157311e-95
CAGL0F03443g3123127012e-91
Kwal_27.103143153085797e-73
KLLA0D01705g3213124692e-56
AAL186W3193184501e-53
Scas_676.8332106700.66
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR274C
         (310 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease ...   631   0.0  
Scas_696.37                                                           286   1e-95
CAGL0F03443g complement(339175..340113) similar to sp|Q03530 Sac...   274   2e-91
Kwal_27.10314                                                         227   7e-73
KLLA0D01705g complement(152307..153272) similar to sp|Q03530 Sac...   185   2e-56
AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH] complement(810...   177   1e-53
Scas_676.8                                                             32   0.66 

>YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease
           involved in ras and a-factor C-terminal proteolysis [948
           bp, 315 aa]
          Length = 315

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MLQFSTFLVLLYISISYVLPLYATSQPEGSKRDNPRTIKSRMQKLTIMLISNLFLVPFLQ 60
           MLQFSTFLVLLYISISYVLPLYATSQPEGSKRDNPRTIKSRMQKLTIMLISNLFLVPFLQ
Sbjct: 1   MLQFSTFLVLLYISISYVLPLYATSQPEGSKRDNPRTIKSRMQKLTIMLISNLFLVPFLQ 60

Query: 61  SQLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDF 120
           SQLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDF
Sbjct: 61  SQLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDF 120

Query: 121 VLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLSYQ 180
           VLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLSYQ
Sbjct: 121 VLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLSYQ 180

Query: 181 QLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTGGN 240
           QLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTGGN
Sbjct: 181 QLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTGGN 240

Query: 241 LWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGRISKLVSIWNKCYFALLVLGLISLKD 300
           LWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGRISKLVSIWNKCYFALLVLGLISLKD
Sbjct: 241 LWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGRISKLVSIWNKCYFALLVLGLISLKD 300

Query: 301 TLQTLVGTPG 310
           TLQTLVGTPG
Sbjct: 301 TLQTLVGTPG 310

>Scas_696.37
          Length = 322

 Score =  286 bits (731), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 197/315 (62%), Gaps = 11/315 (3%)

Query: 1   MLQFSTFLVLLYISISYVLPLYATSQPEGS----KRDNPRTIKSRMQKLTIMLISNLFLV 56
           ML F  F VL YISISYV  +YA+S+         RD+P  IK R++K+ ++   N+ LV
Sbjct: 1   MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV 60

Query: 57  PFLQSQL----SSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTL 112
           PFLQ  +     ST S IS   A + LGI+PG+Y      W  S +  D+   + ++  L
Sbjct: 61  PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYR--DGHWDISSYYYDIISGIWVVTLL 118

Query: 113 YCGPVLDFVLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLI 172
           Y GP++D  L+++     ++  D+  EF NI+  RN+IFAPITEEIFYTSMLL TYL L 
Sbjct: 119 YVGPLMDLFLFYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLC 178

Query: 173 PHSQLSYQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKF 232
           P   LS + L WQPSLFFGLAH HHAY   + G    ++IL+ T  Q  YTTLFG  T F
Sbjct: 179 PIESLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNF 238

Query: 233 VFVRTGGNLWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGR-ISKLVSIWNKCYFALL 291
           +F+RTGGNLW C+  H+ CNIMGFPG SRL+LHFT++++  G    KL++ WNK Y  LL
Sbjct: 239 IFLRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIEEVKGDWRRKLIAAWNKSYIFLL 298

Query: 292 VLGLISLKDTLQTLV 306
            LG+   K  + TL+
Sbjct: 299 FLGIYLFKANIDTLI 313

>CAGL0F03443g complement(339175..340113) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of
           RAS2P, hypothetical start
          Length = 312

 Score =  274 bits (701), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 202/312 (64%), Gaps = 10/312 (3%)

Query: 2   LQFSTFLVLLYISISYVLPLYATS---QPEGSKRDNPRTIKSRMQKLTIMLISNLFLVPF 58
           + +  F + + IS+SYV  LY TS   +   ++RD+PR IK R++ + ++ I N  +VP 
Sbjct: 1   MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPL 60

Query: 59  LQSQLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVL 118
           L S +      +S+K+AFL +GIIPGY+    +  Q   ++  + K + +++ LY GP+ 
Sbjct: 61  LHSII---VPQLSYKEAFLNIGIIPGYHQHGSS--QIKLYIGTILKNLCLVMLLYIGPLT 115

Query: 119 DFVLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLS 178
           D VLY++ N +SSIL  F  EF+NIW  RN+IFAPITEE+FYTS+LL TYL L P     
Sbjct: 116 DMVLYYISNKESSILSAFREEFMNIWGLRNYIFAPITEELFYTSLLLNTYLTLEPRKP-K 174

Query: 179 YQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTG 238
              L WQPSLFF +AH HHAYE    G+ +T SI++ T FQ+ YT +FG  T FVF+RTG
Sbjct: 175 LTTLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTG 234

Query: 239 GNLWCCIILHALCNIMGFPGPSRLNLHFTVVDK-KAGRISKLVSIWNKCYFALLVLGLIS 297
           GNLW CI+LH+ CN+MGFP  S L  +FTV+   K+ ++  L+SIWNK Y+ LL +G++ 
Sbjct: 235 GNLWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLLSIWNKVYYILLFMGILF 294

Query: 298 LKDTLQTLVGTP 309
            KD L  L   P
Sbjct: 295 FKDGLWRLTSCP 306

>Kwal_27.10314
          Length = 315

 Score =  227 bits (579), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 132/308 (42%), Positives = 185/308 (60%), Gaps = 10/308 (3%)

Query: 7   FLVLLYISISYVLPLYATSQPEG---SKRDNPRTIKSRMQKLTIMLISNLFLVPFLQSQL 63
           FL+ LY+SISYV  ++  SQP G   ++RD+PR IKSRM+++ ++   NL LVP+LQS  
Sbjct: 6   FLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPWLQSTF 65

Query: 64  SSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDFVLY 123
           S+    I+F DAFL LGIIP  Y +    +  S FV D+ + + ++  LY GP+LD VLY
Sbjct: 66  SA--REITFMDAFLALGIIPAGYKSDTFYFDVSNFVYDIVRALKLVCILYSGPLLDNVLY 123

Query: 124 HLLNPKSSILE---DFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQLSYQ 180
           +LL P  ++ E   D   E  +IW  RN++F P TEE+FYT ML+  +L L     ++Y+
Sbjct: 124 YLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFL-LTSTDPVTYK 182

Query: 181 QLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTGGN 240
            +   P LFFGLAH HHA+E    G  + V I +TT  Q+ YTTLFG  T FV++RTG N
Sbjct: 183 AILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTGQN 242

Query: 241 LWCCIILHALCNIMGFPGPSRLNLHFTVVDKKAGRISKLVSIWNKCYFALLVLGLISLKD 300
            WCC  +HA  N MG P  S L   F  +++  G  S +   W   Y A+L++GL+  K 
Sbjct: 243 FWCCFAIHAFANYMGLPKMSALCEQFD-LNRSTGFRSLVSKFWKWGYVAMLLIGLVKFKG 301

Query: 301 TLQTLVGT 308
            +  L  +
Sbjct: 302 NMWELTDS 309

>KLLA0D01705g complement(152307..153272) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of RAS2P
           singleton, start by similarity
          Length = 321

 Score =  185 bits (469), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 171/312 (54%), Gaps = 17/312 (5%)

Query: 8   LVLLYISISYVLPLYATSQPEGS---KRDNPRTIKSRMQKLTIMLISNLFLVPFLQSQLS 64
           +V +YIS+SYV+ ++  S+       +RD+P+ IK+RM+ +  +   +L  +P L   ++
Sbjct: 8   VVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIPLLLKYMN 67

Query: 65  STTSHISFKDAFLGLGIIPGYY----AALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDF 120
                 S ++  L  G++PG+       LP+ W    + KD ++ +++ + LY  P+LD 
Sbjct: 68  GD----SIQNTLLRFGLLPGFLNETETGLPS-WVPFNYFKDSSRHLSLAIVLYSTPLLDS 122

Query: 121 VLYHLLNPKSS---ILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQL 177
           +L++   P  S   I+ D   EF  IW  R++IF PITEE+FYTSM+L  YL L   SQ 
Sbjct: 123 LLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSSQY 182

Query: 178 SYQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRT 237
               L       FG+AH HHA+EQ   G M   +I+  T  Q+ YT LFG  T ++F+ +
Sbjct: 183 DANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFLNS 242

Query: 238 GGNLWCCIILHALCNIMGFPGPSRLNLHFTVV--DKKAGRISKLVSIWNKCYFALLVLGL 295
            GNLW CI++H  CN MG P  +  +  + +V  +K++   +   S+W   Y  LLV+ +
Sbjct: 243 SGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVISI 302

Query: 296 ISLKDTLQTLVG 307
           +  K+ L +L  
Sbjct: 303 VLFKNNLTSLTA 314

>AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH]
           complement(8108..9067) [960 bp, 319 aa]
          Length = 319

 Score =  177 bits (450), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/318 (34%), Positives = 166/318 (52%), Gaps = 13/318 (4%)

Query: 1   MLQFSTFLVLLYISISYVLPLYATSQPE---GSKRDNPRTIKSRMQKLTIMLISNLFLVP 57
           M   S  L+  Y + SYV  LY          + R++P+ I   M+ +   +++NL ++P
Sbjct: 1   MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP 60

Query: 58  FLQSQLSSTTSHISFKDAFLGLGIIPGYYAALPN-PWQFSQFVKDLTKCVAMLLTLYCGP 116
           +LQS+L+S     SF D F  LG++PG YA      W    +  D+ + +++L +LY   
Sbjct: 61  WLQSRLAS--DGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGSLYAAD 118

Query: 117 VLDFVLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQ 176
           +LD   Y+LL P +S + D           RN++F PITEE+ YTSM+L  Y  L P   
Sbjct: 119 LLDSAAYYLLVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQP--T 176

Query: 177 LSYQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVR 236
           +S   L     +FFG+AH HHA + L  G      + LT+ FQILYTTLFG  T +++  
Sbjct: 177 ISRAMLLLATPMFFGVAHVHHARQLLATGH-RPAQVALTSSFQILYTTLFGTFTNYIYYH 235

Query: 237 TGGNLWCCIILHALCNIMGFPG-PSRLNLHFTVVDKKAGRI---SKLVSIWNKCYFALLV 292
           T GNLW CI+LHA+CN + FP   S +   +      A R     +L+  W   Y   L+
Sbjct: 236 TAGNLWACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTYRLCLL 295

Query: 293 LGLISLKDTLQTLVGTPG 310
            GL++  D ++T   + G
Sbjct: 296 CGLLAFLDGIRTFSSSAG 313

>Scas_676.8
          Length = 332

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 210 VSILLTTCFQILYTTLFGGLTKFVFVRTGGNLWCCIILHALCNIMGFPGPSRLNLHFTVV 269
           +SIL++   ++ Y   F   T+F  +RT   +      + L N++G       +L F + 
Sbjct: 212 LSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLG-------SLDFEMS 264

Query: 270 DKKAGRISKLVSIWNKCYFAL---LVLGL-ISL-KDTLQTLVGTPG 310
           D    R  +L++ ++K  F L     LG+ ++L ++  Q L  TPG
Sbjct: 265 DNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPG 310

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.142    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,767,181
Number of extensions: 407004
Number of successful extensions: 1285
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1276
Number of HSP's successfully gapped: 11
Length of query: 310
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 209
Effective length of database: 13,099,691
Effective search space: 2737835419
Effective search space used: 2737835419
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)