Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR273C (ZDS1)91590036270.0
Scas_650.22993964892e-50
CAGL0F03421g817964763e-49
KLLA0D01683g944954687e-48
YML109W (ZDS2)942974464e-45
Kwal_27.103189251664454e-45
AAL185W1018954384e-44
CAGL0J06688g828934081e-40
YIR006C (PAN1)148046695.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR273C
         (900 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...  1401   0.0  
Scas_650.22                                                           192   2e-50
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   187   3e-49
KLLA0D01683g complement(148855..151689) some similarities with s...   184   7e-48
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   176   4e-45
Kwal_27.10318                                                         176   4e-45
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   173   4e-44
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   161   1e-40
YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein in...    31   5.0  

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score = 1401 bits (3627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/900 (79%), Positives = 713/900 (79%)

Query: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFXXXXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSN 120
           PELDIKF                          VNNTRYSDPTPLENLHGRGNSGIESSN
Sbjct: 61  PELDIKFGGESSGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIESSN 120

Query: 121 KTKQGNYLGIKKGVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNFLELVQDTLQNIQLS 180
           KTKQGNYLGIKKGVHSPSR            WVPANQHPNVKPDNFLELVQDTLQNIQLS
Sbjct: 121 KTKQGNYLGIKKGVHSPSRKLNANVLKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLS 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS 240
                                 KESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS
Sbjct: 181 DNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRS 240

Query: 241 YTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI 300
           YTEF           SASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI
Sbjct: 241 YTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAI 300

Query: 301 TLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPER 360
           TLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPER
Sbjct: 301 TLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPER 360

Query: 361 SSLRRSRFNTYRIRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDE 420
           SSLRRSRFNTYRIR              MKNDDEERLKLTKNTIKVEIDPHKSPFRQQDE
Sbjct: 361 SSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDE 420

Query: 421 DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGT 480
           DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGT
Sbjct: 421 DSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGT 480

Query: 481 TDMVKPSATDDNKETKRHRRRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRMELDNS 540
           TDMVKPSATDDNKETKRHRRRNGWTWLNNKMSR                VDSQRMELDNS
Sbjct: 481 TDMVKPSATDDNKETKRHRRRNGWTWLNNKMSREDDNEENQGDDENEENVDSQRMELDNS 540

Query: 541 KKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPHHKHDAXXXX 600
           KKHYISLFNGGEKTEVSNKEEMNN          RQKIEKTFANLFRRKPHHKHDA    
Sbjct: 541 KKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTRQKIEKTFANLFRRKPHHKHDASSSP 600

Query: 601 XXXXXXXXXIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLXXXXXXXXXXXXXXGSQKIS 660
                    IPNNDAVHVRVRKSKKLGNKSGREPVEPIVL              GSQKIS
Sbjct: 601 SSSPSSSPSIPNNDAVHVRVRKSKKLGNKSGREPVEPIVLRNRPRPHRHHHSRHGSQKIS 660

Query: 661 VKTLKDSXXXXXXXXXXXXEGAXXXXXXXXXXXXXLPQLQPAVSVSSTKSNSRDXXXXXX 720
           VKTLKDS            EGA             LPQLQPAVSVSSTKSNSRD      
Sbjct: 661 VKTLKDSQPQQQIPLQPQLEGAIEIEKKEESDSESLPQLQPAVSVSSTKSNSRDREEEEA 720

Query: 721 XXXXXXXXXXXXISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPV 780
                       ISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPV
Sbjct: 721 KKKNKKRSNTTEISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPV 780

Query: 781 QTSAPVEASAQTQXXXXXXLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLL 840
           QTSAPVEASAQTQ      LKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLL
Sbjct: 781 QTSAPVEASAQTQAPAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLL 840

Query: 841 TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ
Sbjct: 841 TVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900

>Scas_650.22
          Length = 993

 Score =  192 bits (489), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 85/96 (88%), Positives = 93/96 (96%)

Query: 805 ILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 864
           +LP RKLTFADVK+PD+PN+P+QFTDSAFGFPLP+LTVSTVIMFDHRL INVERAIYRLS
Sbjct: 849 VLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLS 908

Query: 865 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           HLKLS+SKR LR+QVLLSNFMYAYLNLVNHTLYMEQ
Sbjct: 909 HLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQ 944

 Score =  174 bits (441), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 154/490 (31%), Positives = 218/490 (44%), Gaps = 76/490 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LELVQDTLQNI L                        +S   E +
Sbjct: 202 WVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISKSNMSEEE 261

Query: 212 --ENNTINLNRGLSR--HGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEER 267
             + +  +L++      + N SL+RRPS LR SYTEF            A    +++  R
Sbjct: 262 PIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAKTNESQLSSR 321

Query: 268 ISK---------------IKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSY 312
             K                 +R VSL+DITEELT ISN AGLTD+DAITLARTLSMA S+
Sbjct: 322 EEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTLSMASSF 381

Query: 313 SDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYR 372
           SD        G+    ++G S  Q  + ++ EFASNM + N +T PERSSLRRS+FNTYR
Sbjct: 382 SD--------GNV---NLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTYR 430

Query: 373 IRXXXXXXXXXXXXXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIG 432
           IR              +     +     +     + D  +SP    + DS   ++  S G
Sbjct: 431 IRSTSSSTSTREKTSPLL----QSSSFARQEADTD-DLQRSPVSFTNRDSYLATTTSSPG 485

Query: 433 DFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLELREGTTD--MVKPSAT- 489
              D+Y+HY Q + E +Q    + EA +  +   + + E      E + D  +VKP  + 
Sbjct: 486 SISDLYDHY-QDNAESKQGNDNDNEARQGDLSHASISQESSFLSNESSNDSILVKPLGSK 544

Query: 490 -------------DDNK--------------ETKRHR-RRNGWTWLNNKMSRXXXXXXXX 521
                        DD++              +T R + +RNGW+W  N   R        
Sbjct: 545 SMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGN---RANSEEDAT 601

Query: 522 XXXXXXXXVDSQRMELDNSKKHYISLFNGGEKTEVSNKEEMNNXXXXXXXXXXRQKIEKT 581
                     +   +  +  +H   L    +  +++ + E+            R+ IEK 
Sbjct: 602 VLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLKINKEAEL------PKESHKRETIEKR 655

Query: 582 FANLFRRKPH 591
           F  LFRRK H
Sbjct: 656 FVKLFRRKGH 665

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 2/58 (3%)

Query: 10 LRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          LR TS   ++ +QRDKRKSEVLIAAQSLDNE++SVKNLKRLSIGSMDLLIDPEL+ + 
Sbjct: 10 LRKTSG--SLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRV 65

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  187 bits (476), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 84/96 (87%), Positives = 90/96 (93%)

Query: 805 ILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLS 864
           + PPRKLTFADVKK DK N+P++FTDSAFGFPLP LT STVIMFDHRLPI+VERAIYRLS
Sbjct: 720 LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLS 779

Query: 865 HLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           HLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 780 HLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  147 bits (372), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 210/454 (46%), Gaps = 94/454 (20%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WV A+QHPNVKP+N++ELVQD L NIQ+                       KE+    +K
Sbjct: 156 WVRADQHPNVKPENYIELVQDALHNIQIDKTEEHD----------------KENSDTLDK 199

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
            +   N N   S   N  L+RRPS LR+SYTEF           S+  T N V+   S  
Sbjct: 200 VSRYYNSNNKRSP-NNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSS--TNNNVD---STP 253

Query: 272 KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAG-SYSDKKD--QPQPEGHYDEG 328
             +  +L+DITEELT+ISN AGLT+NDA+TLARTLSMA  +  D+ D  Q +PE   D  
Sbjct: 254 HNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDD-- 311

Query: 329 DIGFSTSQANTLDDGEFASNMPI-NNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXX 387
              ++    N  +D  +AS M +  +++   E S+L+RS++ TY IR             
Sbjct: 312 ---YARQSRN--NDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDP------ 359

Query: 388 XMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGE 447
                          TI V  +       +        +SPGSI    DIY+HYR+ SG+
Sbjct: 360 ---------------TIPVSTESQHQDVIE--------ASPGSIN---DIYDHYREPSGD 393

Query: 448 WEQEMGIEKEAEEVPVKVRNDT-VEQDLELREGTTDMVKPSAT--------DDNKETKRH 498
           W   + +  E E    K R DT ++ + ++ + +T+ V   +T        D NK+   H
Sbjct: 394 WSSLIQVAPENEN---KKRTDTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAH 450

Query: 499 R-RRNGWTWLNNKMSRXXXXXXXXXXXXXXXXVDSQRMELDNSKKHYISLFNGGEKTEVS 557
           R +RNGW W ++K S                 V   R   ++SK  +  L+N   K E++
Sbjct: 451 RKKRNGWLW-SSKTSE--KVNVTSDKHENEDIVPESR--FNHSKNRHEPLYN--HKIEIA 503

Query: 558 NKEEMNNXXXXXXXXXXRQKIEKTFANLFRRKPH 591
           N                +  I+K  +N+FRRK H
Sbjct: 504 N--------TLGTLPEKKNAIDKKISNIFRRKHH 529

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (94%)

Query: 28 SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDI 65
          SEV IAAQSLD E+RSVKNLKRLSIGSMDLL+DPE+D+
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  184 bits (468), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 91/95 (95%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           LPPRKLTFADV KPD+PNSP++FTDSAFGFPLP LT+STVIMFDHRLPI+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++Q
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQ 918

 Score =  125 bits (315), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/227 (39%), Positives = 112/227 (49%), Gaps = 45/227 (19%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WV A+QHPNVKP+N+LELVQ+TL+N+ L                       +  QS    
Sbjct: 194 WVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTLRKRSMQS---- 249

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXX----XSASETVNKVEER 267
                         GN SL RRPS LR SYTE                +A+ T++     
Sbjct: 250 --------------GN-SLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSS---- 290

Query: 268 ISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDE 327
                 R VSL+DITEELTK+SN AGLTD DA+TLARTL +A            E   D 
Sbjct: 291 -----RRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVAD-----------ESTTDS 334

Query: 328 GDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR 374
              G S + A+  ++ EFAS M   +  T P R SLRRS+FNTYRI+
Sbjct: 335 TGQGLSNNLAD--EEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          S+RDKRKSEVLIAAQSLD E++ VKNLKRLSIGSMDLL+DPEL+ +
Sbjct: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYR 49

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  176 bits (446), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 87/97 (89%)

Query: 804 SILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRL 863
           S LPPRKLTF DV KPD  N+P++FTDSAFGFPLP++T STVIMFDHRL INVERAIYRL
Sbjct: 815 STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 874

Query: 864 SHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           SHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 875 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 911

 Score =  162 bits (411), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 163/316 (51%), Gaps = 84/316 (26%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPA+QHPNVKP+N+LEL+QDTLQNIQ+S                            ENK
Sbjct: 213 WVPADQHPNVKPENYLELIQDTLQNIQISTNQDID----------------------ENK 250

Query: 212 ---ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERI 268
               NN +  NR   R G  S++RRPS L+ SYT+F              E   +V++RI
Sbjct: 251 LELGNNHVISNR--KRTG--SVVRRPSRLKTSYTKFDDEPPLADK---PQEGEIQVDKRI 303

Query: 269 SK--IKE-RPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHY 325
           S   IK  R VSL++ITEELTKISN+AGLTD+DA+TLAR+LSM+GS+++       E  +
Sbjct: 304 SSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN-------ESLH 356

Query: 326 DEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXX 385
             G+        +T +D EFASNM     +T PERSSLRRS+FNTY+IR           
Sbjct: 357 LNGN--------HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVK 408

Query: 386 XXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSP----------GSIGDFQ 435
              + N                         Q +++  + SSP           S+ DF 
Sbjct: 409 LNSLMN------------------------IQTNDNRRSASSPASYTQVPQEQASLNDFH 444

Query: 436 DIYNHYRQSSGEWEQE 451
           +I++HYR++S +W  E
Sbjct: 445 EIFDHYRRTSTDWSTE 460

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 46 EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFK 88

>Kwal_27.10318
          Length = 925

 Score =  176 bits (445), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/166 (53%), Positives = 117/166 (70%), Gaps = 17/166 (10%)

Query: 737 QHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPV--QNSAPVQTSAPVEASAQTQX 794
           + S  V+K +T +   QL+ P Q++  +   VQ S+PV  +++A +   AP         
Sbjct: 755 KQSASVEKADT-QPVIQLEEPFQQKQASRKDVQDSSPVDIEDNAGIDPMAPAAGGY---- 809

Query: 795 XXXXXLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPI 854
                      LPPRKLTF+DV KP++PNSP++F+DS+FGFPLP LT+STV+M DHRL I
Sbjct: 810 ----------TLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTI 859

Query: 855 NVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           NVERAIYRLSHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q
Sbjct: 860 NVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQ 905

 Score =  159 bits (402), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 147/314 (46%), Gaps = 48/314 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WVPANQHPNVKP+N+LELVQDTL  + +                       + +  Y   
Sbjct: 176 WVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTV-----------EGNNPYLAS 224

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
            N   + +  L R G  SL+RRPS LR+SYTE            S     N   E  + I
Sbjct: 225 ANTKASPSSQL-RSGQNSLVRRPSGLRKSYTELEDLLQHEIQD-SDENNENAQSELNNII 282

Query: 272 KERP------VSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHY 325
           K RP       SL+DITEELT+ISN AG TD DA+ LARTLSMA SY  ++ Q     + 
Sbjct: 283 KNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLARTLSMASSYDGEQSQANQSANT 342

Query: 326 DEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXX 385
           D               D E+AS +   N +  P RSSLRRS+FNTYRIR           
Sbjct: 343 DH------------TPDSEYASTILTKNGLAIPARSSLRRSKFNTYRIRTPNGSSVTSSS 390

Query: 386 XXXMKNDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSS 445
                  +EER            DP         E S+ + SP S+ DF +IY+HYRQ S
Sbjct: 391 LRSTSLPNEERK-----------DPEG-----YIEKSDRLRSPTSVNDFNEIYDHYRQGS 434

Query: 446 -GEWEQEMGIEKEA 458
            G   +   ++ +A
Sbjct: 435 VGSTSEPHAVDNDA 448

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 51/70 (72%), Gaps = 6/70 (8%)

Query: 4  RDNESMLRTTSSDKAIA------SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDL 57
          RD+ + L     D++++      ++ +KRKSEVLIAAQSLD+E++ VKNLKR+S GSMDL
Sbjct: 5  RDHRASLNNDMRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDL 64

Query: 58 LIDPELDIKF 67
           +DPE++ + 
Sbjct: 65 PLDPEMEFRM 74

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  173 bits (438), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 87/95 (91%)

Query: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865
           LPPRKL F DV +P+KPNSP++FT SAFGFPLP LTVSTVIMFDHRLPI VERAIYRLSH
Sbjct: 896 LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSH 955

Query: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           LKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q
Sbjct: 956 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQ 990

 Score =  119 bits (299), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 46/296 (15%)

Query: 152 WVPANQHPNVKPDNFLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENK 211
           WV A+QHPNVKP+N+LELV DTL N+++                               +
Sbjct: 234 WVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPV--------------------Q 273

Query: 212 ENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKI 271
           ++NT   N   S     SL+R+ S LR+S+TE              SE       R+S  
Sbjct: 274 QSNTPVANGESSTASARSLVRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGKRMRVS-- 331

Query: 272 KERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIG 331
                SL++ITEELT+ISN+AGLTD+DAITLARTL +    +D+         + E    
Sbjct: 332 -----SLKEITEELTRISNNAGLTDSDAITLARTLGIGSQSADE------HATFSE---C 377

Query: 332 FSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRXXXXXXXXXXXXXXMKN 391
             +++A   ++ E+AS++   N +  P RSSLRRS+F TYRIR                +
Sbjct: 378 VPSAEA---EENEYASSILAKNGLAIPARSSLRRSKFTTYRIRSAGSDSSPPENKSTSSS 434

Query: 392 DDEERLKLTKNTIKVEIDPHKSPFRQQDE--DSENMS-SPGSIGDFQDIYNHYRQS 444
                 +    + K++    K+ F+        EN S +P S     DIY+HY  S
Sbjct: 435 SLAAAYERNSRSPKMQ----KAAFKGSHPRLSGENTSLAPQSPNSINDIYDHYNTS 486

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 42/45 (93%)

Query: 23  RDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
           ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLL+DPE++ + 
Sbjct: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRM 114

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%)

Query: 808 PRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLK 867
           P+KLTF DVKKP++ N+P++FTDSAFGFPLP LT+STVIM DHRL INVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 868 LSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 900
           LS + R LR+QVLLSNFMYAYLNLV HTL +E+
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEE 788

 Score =  139 bits (351), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 173/389 (44%), Gaps = 71/389 (18%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLI--------------DPELDIKFXX 69
           D   SE L AAQSLD E+++VKNLKRLSIGS+DL+               D   D     
Sbjct: 17  DGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSN 76

Query: 70  XXXXXXXXXXXXXXXXXXXXXXXXVNNTRYSDPTPLENLHGRGNSGIESSNKTKQG---- 125
                                   ++ TR    T  +N         ESSN++ +G    
Sbjct: 77  GSFTEEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQ-------ESSNESPKGVART 129

Query: 126 -----NY-------LGIKKGVHSPSRX--------XXXXXXXXXXXWVPANQHPNVKPDN 165
                NY       + IK+     SR                    WVPANQHPNVKP+N
Sbjct: 130 RSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPEN 189

Query: 166 FLELVQDTLQNIQLSXXXXXXXXXXXXXXXXXXXXXXKESQSYENKENNTINLNRGLSRH 225
           +LELV++TL  I+                           +   NKEN  IN N  L   
Sbjct: 190 YLELVKETLNKIR------------DINTDGKEKSENNSEEEVSNKEN--INENGRL--- 232

Query: 226 GNASLIRRPSTLRRSYTEFXXXXXXXXXXXSASETVNKVEERISKIKERPVSLRDITEEL 285
              S++RRPS LR+SYTEF            ++   N++    +    + +SL++IT EL
Sbjct: 233 -RGSIVRRPSKLRKSYTEFSSEDLELLDKALSN---NRIISTRNTTNSKRLSLKEITNEL 288

Query: 286 TKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEF 345
            K SN AGLTD++A+TLARTLS+A S +++ +     G  D+ +      Q+   DD  F
Sbjct: 289 VKHSNKAGLTDDNAVTLARTLSIASSVTNQNET----GRNDQSNTE-QQKQSEDADDDTF 343

Query: 346 ASNMPINNTMTWPERSSLRRSRFNTYRIR 374
           A+ +  N+       SSLRRS+FNTYR++
Sbjct: 344 ATAVVGNSHSLASNTSSLRRSKFNTYRVK 372

>YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein
            involved in organization of the actin cytoskeleton and in
            endocytosis, binds to the ARP2/3 complex to stimulate
            actin polymerization [4443 bp, 1480 aa]
          Length = 1480

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 748  DEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQ 793
            +E+  ++  P Q  VQ++ PVQ + PVQ + PVQ + PV+ +   Q
Sbjct: 1076 EEKYVEVAQPTQP-VQSTQPVQPTQPVQPTQPVQPTQPVQPTQPVQ 1120

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,878,421
Number of extensions: 913215
Number of successful extensions: 3313
Number of sequences better than 10.0: 51
Number of HSP's gapped: 3291
Number of HSP's successfully gapped: 82
Length of query: 900
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 789
Effective length of database: 12,753,511
Effective search space: 10062520179
Effective search space used: 10062520179
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)