Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR272C (SCS7)38437817670.0
KLLA0D01639g38137513040.0
Scas_696.3642637812871e-177
Kwal_27.1033237837312661e-175
AAL183W37737412351e-170
CAGL0F03399g38037811681e-160
AFL223W165851695e-14
Scas_666.12121711631e-13
Kwal_26.8461123851631e-13
CAGL0L03828g1211051612e-13
YNL111C (CYB5)1201061577e-13
KLLA0F23672g123761551e-12
KLLA0B14795g556501441e-09
Kwal_47.18167227601372e-09
KLLA0A12111g236501346e-09
Scas_571.1d609581324e-08
KLLA0F27577g172511254e-08
Kwal_23.2823560431315e-08
YML054C (CYB2)591521298e-08
ADL085C2731271188e-07
Scas_571.2602471201e-06
Sklu_2444.3564461191e-06
CAGL0K10736g593521182e-06
KLLA0D02640g589521154e-06
Sklu_2258.5580621145e-06
CAGL0K03069g194441043e-05
Kwal_14.807578541074e-05
CAGL0I00418g490991031e-04
YGL055W (OLE1)510100993e-04
Scas_717.1418982938e-04
AAR153C47873940.001
Sklu_2299.348046930.002
Kwal_26.804619853900.002
Scas_563.6497114920.003
KLLA0E18535g14863860.004
KLLA0C05566g47773900.004
Kwal_14.184528846810.046
AAL078W59246810.064
Sklu_2032.352271800.071
KLLA0C10692g52046790.086
AFL079W53870790.099
Kwal_23.569351346790.10
YMR073C20148760.14
KLLA0E19569g57355710.82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR272C
         (378 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...   685   0.0  
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...   506   0.0  
Scas_696.36                                                           500   e-177
Kwal_27.10332                                                         492   e-175
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...   480   e-170
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...   454   e-160
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    70   5e-14
Scas_666.12                                                            67   1e-13
Kwal_26.8461                                                           67   1e-13
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    67   2e-13
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    65   7e-13
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    64   1e-12
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    60   1e-09
Kwal_47.18167                                                          57   2e-09
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    56   6e-09
Scas_571.1d                                                            55   4e-08
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...    53   4e-08
Kwal_23.2823                                                           55   5e-08
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    54   8e-08
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...    50   8e-07
Scas_571.2                                                             51   1e-06
Sklu_2444.3 , Contig c2444 10960-12654                                 50   1e-06
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    50   2e-06
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    49   4e-06
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        49   5e-06
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    45   3e-05
Kwal_14.807                                                            46   4e-05
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    44   1e-04
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    43   3e-04
Scas_717.14                                                            40   8e-04
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    41   0.001
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         40   0.002
Kwal_26.8046                                                           39   0.002
Scas_563.6                                                             40   0.003
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    38   0.004
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    39   0.004
Kwal_14.1845                                                           36   0.046
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    36   0.064
Sklu_2032.3 , Contig c2032 4286-5854                                   35   0.071
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    35   0.086
AFL079W [3114] [Homologous to NOHBY] complement(290134..291750) ...    35   0.099
Kwal_23.5693                                                           35   0.10 
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    34   0.14 
KLLA0E19569g complement(1730651..1732372) gi|21104522|dbj|BAB931...    32   0.82 

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/378 (89%), Positives = 337/378 (89%)

Query: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60
           MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120
           TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 181 GSAPLFGNFLEPLTKTXXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLEPLTKT              YHMGVALKNMNQLFACFLFCVGVFVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               VCYDECHFFLHHSKLPPFMR            NYQLGFGVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 361 SWFWDEVFGTYLGPDAPL 378
           SWFWDEVFGTYLGPDAPL
Sbjct: 361 SWFWDEVFGTYLGPDAPL 378

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/375 (65%), Positives = 282/375 (75%), Gaps = 1/375 (0%)

Query: 4   NTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
           ++S+ L L+SK  +++HN  NDCWV+   RKIY+VT FL EHPGG E ILDYAG DIT++
Sbjct: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61

Query: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFV 123
           MKD   HEHS+SAYEI+++ YL+GYLAT+EE  +LLTNK+H VEV L  +  EFDST FV
Sbjct: 62  MKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGN-NEFDSTVFV 120

Query: 124 KELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183
           KELP E+KLSIATDY NDYKKHKFLDLN+PLL Q+L   F KDFY+DQ+HRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180

Query: 184 PLFGNFLEPLTKTXXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243
           PLFGNFLEPL+KT              YH+  AL NMNQ FA FLF VGVFVWTLIEYGL
Sbjct: 181 PLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240

Query: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD++RLVMPPTLFV+LC PFYKLVFALL
Sbjct: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300

Query: 304 PXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWF 363
           P               VCYD  H+FLHHS+LPP+MR            NY+LGFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 364 WDEVFGTYLGPDAPL 378
           WD+VFGTYLG +APL
Sbjct: 361 WDKVFGTYLGENAPL 375

>Scas_696.36
          Length = 426

 Score =  500 bits (1287), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 239/378 (63%), Positives = 282/378 (74%), Gaps = 4/378 (1%)

Query: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60
           MS+N SKTLELFSK  V +HNT  DCWVT  +RKIYDV++FL +HP GD+SIL +AGKDI
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120
           TE++KD  + + +D    +L+D+YLIGY+ATD E  +LLTNK+HKVEV+L+     FDST
Sbjct: 107 TELLKDEKIDQQTD----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162

Query: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LP E+KLSIATDY  D KKH FLDLN+PLL QIL  +F KDFY+DQIHRPRHYG+
Sbjct: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222

Query: 181 GSAPLFGNFLEPLTKTXXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
            SAPLFGNFLEP TKT              YH+ +A KN+N LFA  LFC+GV+VWT IE
Sbjct: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282

Query: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMDKYRLV+PP LF+ LCAPFYKLVF
Sbjct: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           ALLP               +CYD CH+FLHHSKLPPFMR            NYQLG+GVT
Sbjct: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVT 402

Query: 361 SWFWDEVFGTYLGPDAPL 378
           SW+WD+ FGTYL PD+PL
Sbjct: 403 SWYWDKKFGTYLSPDSPL 420

>Kwal_27.10332
          Length = 378

 Score =  492 bits (1266), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/373 (62%), Positives = 281/373 (75%), Gaps = 3/373 (0%)

Query: 6   SKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMK 65
           +KTL L+S   VQEHN+A+DCWVT QNRKIYDVT+FL +HPGG + I++YAGKDITE+MK
Sbjct: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62

Query: 66  DSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVKE 125
           D  +H HS  AYE+L++EY +GYLAT EE  +LL N  HKVEV+L     E+DST FV E
Sbjct: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE---DEYDSTVFVPE 119

Query: 126 LPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPL 185
           +PAEEKLSI TDY+ DY +HKFLDLNRPLLMQ+L +DF K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 186 FGNFLEPLTKTXXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHR 245
           FGNFLEPL+KT              YH+  A++NMN+LFA FLF VG+FVWTLIEYG+HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 246 FLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPX 305
           FLFH D +LP + +A+  HFLLHG HHYLPMD+YRLVMPPTLF++LC PFYKLVFALLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 306 XXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 365
                         VCYD  H+FLHH+KLP  ++            NY+LGFGVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 366 EVFGTYLGPDAPL 378
           +VFGTYL  +APL
Sbjct: 360 KVFGTYLAENAPL 372

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score =  480 bits (1235), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/374 (61%), Positives = 274/374 (73%), Gaps = 4/374 (1%)

Query: 5   TSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIM 64
            SKTL L+SK T+Q+H     CWV+  NRKIYDV++FL EHPGGD+ ILDYAGKDIT ++
Sbjct: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61

Query: 65  KDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVK 124
           KD  +HEH+++AYEIL++ YL+GYLAT+EE  +LLTN+ H +EV         D+TTFVK
Sbjct: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT----PENLDTTTFVK 117

Query: 125 ELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAP 184
           ELPAEE LS+ATD+  DY KH FLDLN+PLLMQ+LR +F +DFY+DQIHRPRHYGKGSAP
Sbjct: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177

Query: 185 LFGNFLEPLTKTXXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLH 244
           LFGNFLEPL+KT              Y++  AL+NM    A   F  GVFVWTLIEY LH
Sbjct: 178 LFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237

Query: 245 RFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLP 304
           RFLFHFDD +PESNIAF  HFLLHG HHYLPMDKYRLVMPP LFV+LCAPFY+LVF++ P
Sbjct: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297

Query: 305 XXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVTSWFW 364
                          VCYD  H+FLHH KLPPFMR            NY+LGFGVTSW+W
Sbjct: 298 EYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 357

Query: 365 DEVFGTYLGPDAPL 378
           D+VFGTYL  ++P+
Sbjct: 358 DKVFGTYLASNSPV 371

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score =  454 bits (1168), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/378 (58%), Positives = 269/378 (71%), Gaps = 6/378 (1%)

Query: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60
           ++ ++SKTLELF +  + +HN+ +DCWV+   RKIYDV+++L +HP   +++        
Sbjct: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAV-----HKA 57

Query: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120
            +    +D+ +   +  + + D+YL+GYLAT +E  +LLTNK+HKVEV+L+AD T FDST
Sbjct: 58  LDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNT-FDST 116

Query: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180
           TFVK+LP E+KLSI TDY  DYKKHKFLDLN+PLL QIL  +F KDFY+DQIHRPRHYGK
Sbjct: 117 TFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGK 176

Query: 181 GSAPLFGNFLEPLTKTXXXXXXXXXXXXXXYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240
           GSAPLFGNFLE  TKT              Y +  AL NMN   A FLF +G+FVWTLIE
Sbjct: 177 GSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIE 236

Query: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300
           Y LHRFLFHFD+WLPE ++ F  HFLLHGCHHYLPMD YRLV+PP LFV+LCAP YKLVF
Sbjct: 237 YCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVF 296

Query: 301 ALLPXXXXXXXXXXXXXXXVCYDECHFFLHHSKLPPFMRXXXXXXXXXXXXNYQLGFGVT 360
           A LP               +CYD CH+FLHHSK+PPFMR            NYQLGFGVT
Sbjct: 297 AALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVT 356

Query: 361 SWFWDEVFGTYLGPDAPL 378
           SWFWD+VFGTYLGPDAPL
Sbjct: 357 SWFWDKVFGTYLGPDAPL 374

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 69.7 bits (169), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 53/85 (62%), Gaps = 5/85 (5%)

Query: 10  ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
           +L++ + + EHN+ ND W+   N K+YD T+F  EHPGGDE ++D AG+D TE   D   
Sbjct: 42  KLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIG- 99

Query: 70  HEHSDSAYEILEDEYLIGYLATDEE 94
             HSD A ++LE  Y +G L  D E
Sbjct: 100 --HSDDAVKMLEGLY-VGDLDKDSE 121

>Scas_666.12
          Length = 121

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 10 ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
          +++S + + EHN  +D W+  +  K+YDV++FL EHPGGDE I + AG+D TE   D   
Sbjct: 3  QVYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIG- 60

Query: 70 HEHSDSAYEIL 80
            HSD A +IL
Sbjct: 61 --HSDDALQIL 69

>Kwal_26.8461
          Length = 123

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 5/85 (5%)

Query: 10 ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
          +L+S K + EHNT  D W+     K+YD T+F+ EHPGG+E ++D  G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 70 HEHSDSAYEILEDEYLIGYLATDEE 94
            HSD A ++L D Y +G +  D E
Sbjct: 61 --HSDDAVKMLADLY-VGDVDKDSE 82

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
           cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 7/105 (6%)

Query: 10  ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
           ++++ K V EHN   DCW+      +YDV++FL EHPGGDE I ++ G D T    D   
Sbjct: 3   KVYTYKQVSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADG 114
             HSD A +IL+    IG    D  + R++ +      VQ S +G
Sbjct: 61  --HSDDALKILK-TLKIG--EVDPNSERVVIDNRESDMVQKSTEG 100

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
           b5 [363 bp, 120 aa]
          Length = 120

 Score = 65.1 bits (157), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 57/106 (53%), Gaps = 7/106 (6%)

Query: 10  ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
           +++S + V EHN   + W+   + K+YDV++F  EHPGGDE I+D  G+D TE   D   
Sbjct: 3   KVYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70  HEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGT 115
             HSD A  +L+  Y IG    D+ + R+   K    E Q    GT
Sbjct: 61  --HSDEALRLLKGLY-IG--DVDKTSERVSVEKVSTSENQSKGSGT 101

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 10 ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
          +L + K V EH T +D W+     K+YD T+F+ EHPGGDE ++D  G+D T   +D   
Sbjct: 3  KLLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIG- 60

Query: 70 HEHSDSAYEILEDEYL 85
            HSD A ++LE  Y+
Sbjct: 61 --HSDDAIKLLEPMYV 74

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 1/50 (2%)

Query: 13  SKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITE 62
           S K V+ HN  +DCW+   N ++YD+T+FLS+HPGG   ++++AG+D TE
Sbjct: 82  SVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATE 130

>Kwal_47.18167
          Length = 227

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 2  STNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT 61
          ++ TS  L   S   V  H  A+DCW++    K+YDV+ +L +HPGG + +L  AGKD T
Sbjct: 24 TSQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 13  SKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITE 62
           S K V+ HN  +DCW+      +YD+T FLS+HPGG   ++++AG+D TE
Sbjct: 82  SVKEVKSHNRIDDCWIVIDG-DVYDITGFLSKHPGGVTRLMEFAGRDATE 130

>Scas_571.1d
          Length = 609

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 6   SKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
           S T    S   V +HN+ NDCW+   N ++YD+T F+S HPGG + I   AGKD++ I
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
          Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 11 LFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT 61
          L +   V  H++ +DCW T  + K+YD+T FL +HPGG + +L YAGKD T
Sbjct: 5  LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDST 54

>Kwal_23.2823
          Length = 560

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (69%), Gaps = 1/43 (2%)

Query: 20  HNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITE 62
           HN  NDCW+   N ++YDVT F++ HPGG + IL+ AG D TE
Sbjct: 89  HNKLNDCWIVL-NDEVYDVTSFIAAHPGGVQRILEVAGSDATE 130

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 12  FSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
            S   V +HN  +DCWV   N  +YD+TRFL  HPGG + I   AGKD+T I
Sbjct: 91  ISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 26/127 (20%)

Query: 9   LELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT------- 61
           L   S + V +H + +DCW     R +YD+T  L  HPGG + +L YAG+D T       
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDVG 148

Query: 62  -------------EIMKDSDVHEHSDSAYEILEDEYL-----IGYLATDEEAARLLTNKN 103
                          + + D  E+ +S   ++    L      G  A+D+   R L +++
Sbjct: 149 HSMESLIYDMAPGSYLGEVDGGENVNSCSSVVSWRSLRWLRSWGKGASDDATVRSLGSQS 208

Query: 104 HKVEVQL 110
            K+E  L
Sbjct: 209 EKLESDL 215

>Scas_571.2
          Length = 602

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 17  VQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
           V  HNT  DCW+   N  +YD+T F+  HPGG + I   AGKD+T I
Sbjct: 94  VARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVTAI 139

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 17  VQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITE 62
           V+ HN  +DCW+   N  +YD+T F+  HPGG   +++ AG+D TE
Sbjct: 93  VKLHNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 12  FSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
            S   V +HNT  DCWV      +YD+T F++ HPGG + I   AGKD+T I
Sbjct: 90  ISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 12  FSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
            S   V +H++  DCWV  +   +Y++T F+S HPGG   I + AGKD+T+I
Sbjct: 90  VSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 2   STNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT 61
            T T  + +    + V +HN   DCWV      +YD+T F+  HPGG   I + AGKD+T
Sbjct: 71  GTVTDSSKKPIDPQDVAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVT 129

Query: 62  EI 63
            I
Sbjct: 130 AI 131

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 2/44 (4%)

Query: 19  EHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILD-YAGKDIT 61
            HNTA DCW T  N K+Y ++ +LS HPGG + ++D  +G+D T
Sbjct: 126 RHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>Kwal_14.807
          Length = 578

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 10  ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63
           E    + V +H+  +DCWV   N  +YD++ F++ HPGG   I   AGKD++ I
Sbjct: 77  ESIRPQEVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 9   LELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSD 68
           L  ++K+   E N  ND  V      ++DV+ +++EHPGG++ + +  GKD T+      
Sbjct: 386 LPAWTKEEFLEKNRENDGLVIVGG-IVHDVSGYITEHPGGEKLLKNALGKDATKAF-SGG 443

Query: 69  VHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVE 107
           V+ HS++A+  L    +       E A R    +  + E
Sbjct: 444 VYRHSNAAHNTLATMRVAVMKDNKETAMRFAQKRGERAE 482

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 2/100 (2%)

Query: 9   LELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSD 68
           L ++ K+T    +  N   V      ++DV+ ++SEHPGG+  I    GKD T+      
Sbjct: 409 LPMWDKQTFLAKSKENKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDATKAF-SGG 466

Query: 69  VHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEV 108
           V+ HS++A  +L D  +     +   A R+ + +    E 
Sbjct: 467 VYRHSNAAQNVLADMRVAVIKESKNSAIRMASKRGEIYET 506

>Scas_717.14
          Length = 189

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 12  FSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESIL-DYAGKDITEIMKDSDVH 70
            +   +Q H +  DCW  Y+  K+Y V+ +L  HPGG + I  + AGKD T +       
Sbjct: 113 INNSILQRHTSRTDCWTIYKG-KVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFN----Q 167

Query: 71  EHSDSAYEILEDEYLIGYLATD 92
            HS    E L +  LIG    +
Sbjct: 168 YHSWVNAEKLLETCLIGIFVNE 189

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ +++EHPGG+  I    GKD T    +  V+ HS++A+ IL    +       + 
Sbjct: 403 VHDVSGYITEHPGGETLIQAALGKDATRAF-NGGVYMHSNAAHNILATMRVAVVKEGQDA 461

Query: 95  AARLLTNKNHKVE 107
           A R    +   +E
Sbjct: 462 ATRFAARRGEALE 474

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 32/46 (69%), Gaps = 1/46 (2%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEIL 80
           ++DV+ +++EHPGG+  I   AGKD T+   +  V+ HS++A+ +L
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVL 448

>Kwal_26.8046
          Length = 198

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 12  FSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESIL-DYAGKDITEI 63
            +K  + +H    DCW    N+K+Y ++ +L  HPGG + ++   AGKD T +
Sbjct: 123 INKAQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>Scas_563.6
          Length = 497

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 13/114 (11%)

Query: 9   LELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSD 68
           L ++ KK   E    N   V      I+D++ ++ EHPGG+  I    GKD T   +   
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVISG-IIHDISNYIPEHPGGESLIKQALGKDATRAFQ-GG 453

Query: 69  VHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTF 122
           V+ HS +A  +L  E  +  L  +  AA     +           G +FD   F
Sbjct: 454 VYRHSTAAQNVLS-ELRVAVLKENGNAAMNFVKRR----------GEQFDKNKF 496

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 32  NRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEILEDEYLIG-YLA 90
           NRK+Y +  +LS HPGG+  +   AGKD+T +        H    YE L +   IG Y+ 
Sbjct: 89  NRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNKY----HRWVNYERLLETCFIGMYVG 144

Query: 91  TDE 93
           + E
Sbjct: 145 SAE 147

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEE 94
           ++DV+ +++EHPGG+  I    GKD T+   +  V+ HS++A+ IL    +       ++
Sbjct: 404 VHDVSGYITEHPGGETLIQASLGKDATKAF-NGGVYLHSNAAHNILATMRIAVVKDNVDQ 462

Query: 95  AARLLTNKNHKVE 107
           AA+    +    E
Sbjct: 463 AAKFAARRGEVYE 475

>Kwal_14.1845
          Length = 288

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEIL 80
           ++DV+ +++EHPGG+  I     KD T+   +  V+ HS++A+ +L
Sbjct: 212 VHDVSNYITEHPGGETLIKAALNKDATKAF-NGGVYLHSNAAHNVL 256

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEIL 80
           I+DVT F+ +HPGG   ++   GKD T     + V+ HS +A  +L
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAFNGA-VYAHSTAARNLL 540

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 35.4 bits (80), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 10  ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDV 69
           E F+K    E+ T     V  +   ++DVT F+ +HPGG   +    GKD T    +  V
Sbjct: 395 ENFAKLAQSEYRTNKRALVAIEG-IVHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAV 452

Query: 70  HEHSDSAYEIL 80
           + HS +A  +L
Sbjct: 453 YSHSRAARNLL 463

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 35.0 bits (79), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEIL 80
           ++DVT F+ +HPGG   +    GKD T+    + V+ HS++A  +L
Sbjct: 417 VHDVTPFIYDHPGGVTLVETSIGKDATQAFNGA-VYRHSNAARNLL 461

>AFL079W [3114] [Homologous to NOHBY] complement(290134..291750)
          [1617 bp, 538 aa]
          Length = 538

 Score = 35.0 bits (79), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 9  LELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSD 68
          + + SK  V+E     +  V Y++  +  + +++  HPGGD++I    G+D T+ M    
Sbjct: 1  MAVLSKSEVEERIANGEVIVIYKS-AVLKLDKWIKYHPGGDKAIYHMVGRDATDEMNAY- 58

Query: 69 VHEHSDSAYE 78
             HSD + +
Sbjct: 59 ---HSDESVQ 65

>Kwal_23.5693
          Length = 513

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEIL 80
           ++DVT F+ +HPGG   +    GKD T+    + V+ HS +A  +L
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAFNGA-VYSHSQAARNLL 454

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 12  FSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKD 59
            ++K V++H    D      N K+YD++ +L  HPGG + ++ +   D
Sbjct: 125 INRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>KLLA0E19569g complement(1730651..1732372)
          gi|21104522|dbj|BAB93118.1 Kluyveromyces lactis
          putative delta 8-sphingolipid desaturase, start by
          similarity
          Length = 573

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 10 ELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIM 64
           + S++ + +        V Y++  + ++ +++  HPGGD+SI    G+D T+ M
Sbjct: 3  RVLSRRDIADRIAKGQTIVIYED-SVLNLDKWIKFHPGGDKSIYHMIGRDATDEM 56

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.140    0.448 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,002,407
Number of extensions: 508285
Number of successful extensions: 1880
Number of sequences better than 10.0: 54
Number of HSP's gapped: 1904
Number of HSP's successfully gapped: 54
Length of query: 378
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 275
Effective length of database: 13,030,455
Effective search space: 3583375125
Effective search space used: 3583375125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)