Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR233W22622310211e-142
ABL015C2201984713e-59
CAGL0M04939g2332054491e-55
Sklu_1837.21611463856e-47
YOR295W (UAF30)2281993523e-41
KLLA0B13024g124853225e-38
Scas_324.1103972163e-22
Kwal_55.2030878722133e-22
CAGL0G07557g2411962071e-19
Scas_665.262492191693e-14
YBR247C (ENP1)48346750.12
Sklu_2379.346744710.36
CAGL0C01639g47144710.38
KLLA0E20361g69354652.2
YDR397C (NCB2)14671622.7
CAGL0H09416g75020642.8
Kwal_47.1883116171605.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR233W
         (223 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...   397   e-142
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...   186   3e-59
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...   177   1e-55
Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement        152   6e-47
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...   140   3e-41
KLLA0B13024g complement(1138572..1138946) some similarities with...   128   5e-38
Scas_324.1                                                             88   3e-22
Kwal_55.20308                                                          87   3e-22
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    84   1e-19
Scas_665.26                                                            70   3e-14
YBR247C (ENP1) [426] chr2 complement(712961..714412) Essential n...    33   0.12 
Sklu_2379.3 YBR247C, Contig c2379 5202-6605                            32   0.36 
CAGL0C01639g 175747..177162 highly similar to sp|P38333 Saccharo...    32   0.38 
KLLA0E20361g 1801106..1803187 some similarities with sp|P34226 S...    30   2.2  
YDR397C (NCB2) [1224] chr4 complement(1266354..1266757,1266850.....    28   2.7  
CAGL0H09416g 921571..923823 highly similar to sp|P39925 Saccharo...    29   2.8  
Kwal_47.18831                                                          28   5.2  

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score =  397 bits (1021), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 203/223 (91%)

Query: 1   MADINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQE 60
           MADINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQE
Sbjct: 1   MADINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQE 60

Query: 61  NPRVLIPKNDLISRDQELSLRLQKEEERPLXXXXXXXXXXXXXXXXXXXXNDSPDSNSIS 120
           NPRVLIPKNDLISRDQELSLRLQKEEERPL                    NDSPDSNSIS
Sbjct: 61  NPRVLIPKNDLISRDQELSLRLQKEEERPLRSTRKRKGKSESKSKRKKKKNDSPDSNSIS 120

Query: 121 VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM 180
           VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM
Sbjct: 121 VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM 180

Query: 181 TMFSMNKLLTKHLFNPDEIVKHEEEQKQTPEKEIKLENESLPN 223
           TMFSMNKLLTKHLFNPDEIVKHEEEQKQTPEKEIKLENESLPN
Sbjct: 181 TMFSMNKLLTKHLFNPDEIVKHEEEQKQTPEKEIKLENESLPN 223

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score =  186 bits (471), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 95/198 (47%), Positives = 129/198 (65%), Gaps = 4/198 (2%)

Query: 8   IPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQENPRVLIP 67
            P+  AILSVS+PDEIS KR+RKALQ L++V+LD  +K I  LILERF  +++    ++ 
Sbjct: 15  TPLPKAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDRQSKVLS 74

Query: 68  KNDLISRDQELSLRLQKEEERPLXXXXXXXXXXXXXXXXXXXXNDSPDSNSISVRKVLLS 127
           + +L+ RD E++  L + +                        N S + NS  +R V LS
Sbjct: 75  QEELVQRDSEMAAALVRGD----AGRAKRPRKRDADKPRKKRANQSDNPNSFHMRPVQLS 130

Query: 128 APLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSMNK 187
            PLQ+ LG E+LPRTQVVK +W YIK+H LQNP DRREILCD  MEP+FGKKMTMFSMNK
Sbjct: 131 EPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNK 190

Query: 188 LLTKHLFNPDEIVKHEEE 205
           +L++HL NP ++   +++
Sbjct: 191 ILSQHLTNPKDVSGSDQD 208

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score =  177 bits (449), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 134/205 (65%), Gaps = 16/205 (7%)

Query: 3   DINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQENP 62
           D+N Y+ M+DAI+SVS+PD++SPK++RKAL+ L+SV+L++++K +NELI+ RF  +Q +P
Sbjct: 6   DLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADP 65

Query: 63  RVLIPKND--------------LISRDQELSLRLQKEEERPLXXXXXXXXXXXXXXXXXX 108
            +L+   +              L S+  E   +L +  ++                    
Sbjct: 66  HILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSKKTRIQVKKKKSKKSSKDGEKK 125

Query: 109 XXNDSPDSNSISVRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILC 168
             N  P+SN+I+  K+ LS  L KFLG  ELPRTQVVK +W YIKEH+LQ+P+DRREI+C
Sbjct: 126 VAN--PNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIIC 183

Query: 169 DEKMEPIFGKKMTMFSMNKLLTKHL 193
           D++M PIFG KMTMF++NK+L+KHL
Sbjct: 184 DDRMRPIFGDKMTMFALNKILSKHL 208

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score =  152 bits (385), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 6/146 (4%)

Query: 66  IPKNDLISRDQELSLRLQKEEERPLXXXXXXXXXXXXXXXXXXXXNDSPDSNSISVRKVL 125
           + + +L+ RD +L+ +LQK+E+                         S ++NSI  RKVL
Sbjct: 1   MSQEELVKRDAKLAAKLQKQEDDAKRKKKRKTDKPKKKRKV------SENANSIQARKVL 54

Query: 126 LSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSM 185
           LS  L++FLG  ELPRTQVVK +W YIKEHDLQNP DRREILCD+ MEPIFGKKMTMFSM
Sbjct: 55  LSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSM 114

Query: 186 NKLLTKHLFNPDEIVKHEEEQKQTPE 211
           NK+L+KHLFNP+++V   +E+++  E
Sbjct: 115 NKILSKHLFNPEDVVNGSKEKEELQE 140

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score =  140 bits (352), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 112/199 (56%)

Query: 1   MADINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQE 60
           MA++N Y  M+D +LS  + + ++ K+VR AL+ +Y+++++SQ K IN+LI +    ++E
Sbjct: 1   MAELNDYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKE 60

Query: 61  NPRVLIPKNDLISRDQELSLRLQKEEERPLXXXXXXXXXXXXXXXXXXXXNDSPDSNSIS 120
            PR      DL+  +  L++ L KE                           +   + IS
Sbjct: 61  RPRFERSLEDLLKENATLAIELTKEITVSKRSSGEEKNDSETKGTHVEKKKGTVSKSPIS 120

Query: 121 VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM 180
            RKV LS  L   LG  EL RT+VV+ +W YIK H+LQNP +++EILCDEK+E I GK  
Sbjct: 121 TRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKST 180

Query: 181 TMFSMNKLLTKHLFNPDEI 199
            MF M+K+L  H+  P +I
Sbjct: 181 NMFEMHKILASHMTEPKKI 199

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score =  128 bits (322), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 2/85 (2%)

Query: 111 NDSPDSNSISVRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDE 170
           ND+P  NSI ++KV LS  LQ+FL  EE+PRTQVVK +W YIKEHDLQNP+DRREI+CD+
Sbjct: 24  NDNP--NSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81

Query: 171 KMEPIFGKKMTMFSMNKLLTKHLFN 195
            M+PIFG+KMTMF++NK+L+KHLFN
Sbjct: 82  AMKPIFGEKMTMFTLNKILSKHLFN 106

>Scas_324.1
          Length = 103

 Score = 87.8 bits (216), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 68/97 (70%), Gaps = 13/97 (13%)

Query: 4   INKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQENPR 63
           +++Y+ M+DAILS SNPDE+SPK++R+ALQ L++V+LD+QRK +N+LI+ERF  +Q+ P+
Sbjct: 6   LDRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDRPK 65

Query: 64  V-------------LIPKNDLISRDQELSLRLQKEEE 87
           V              + +   +  D++ +L+LQKE +
Sbjct: 66  VKESSNTQTVERSPTLSEEGQVDEDRKFALQLQKEAD 102

>Kwal_55.20308
          Length = 78

 Score = 86.7 bits (213), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 54/72 (75%)

Query: 139 LPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSMNKLLTKHLFNPDE 198
           + RTQ+VK +W++IK++ LQNP DRREI CD+ M+P+FG+K TMF++NK L+ H+   DE
Sbjct: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60

Query: 199 IVKHEEEQKQTP 210
            V+  +  + +P
Sbjct: 61  TVQPSKTAEDSP 72

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 84.3 bits (207), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 99/196 (50%), Gaps = 11/196 (5%)

Query: 7   YIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDS----QRKLINELILERFGDIQENP 62
           Y  M+DA+L+  + +E+S   +R  L  ++S+N+ S     R L+++  LE F ++ E P
Sbjct: 10  YESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKK-LEAFKNVTEKP 67

Query: 63  RVLIPKNDLISRDQELSLRLQKE--EERPLXXXXXXXXXXXXXXXXXXXXNDSPDSNSIS 120
           +V     D +  +    + + K+  +E  L                    N       I 
Sbjct: 68  KVKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSKKSMIHI- 126

Query: 121 VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM 180
             K+ ++  LQ  +G+    RT++V+ +W+YIKEH+LQNP D+R+I+ D  +EP+ GK  
Sbjct: 127 --KMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVLGKTS 184

Query: 181 TMFSMNKLLTKHLFNP 196
            +F M++ L  H+  P
Sbjct: 185 DIFMMHRALKHHILGP 200

>Scas_665.26
          Length = 249

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 105/219 (47%), Gaps = 15/219 (6%)

Query: 1   MADINKYIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQE 60
           M+    YI M+DA+L+ S  D  + K +R  LQ ++++N++  R   N++I  R    Q+
Sbjct: 12  MSGYASYISMIDALLNSSFTDNPTVKELRMDLQEVFALNIEPLRGDFNDIIQSRIEMWQQ 71

Query: 61  NPRVLIPKNDLISRDQELSLRLQKEEERPLXXXXXXXXXXXXXXXXXXXXNDSPDSNSIS 120
             +++I + DL    + +SL L+K  E+ L                    +  P      
Sbjct: 72  RSKIIINEIDL--EKENISL-LRKFNEK-LDRHSNNKDDIISPRDKRQKVDVEP------ 121

Query: 121 VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM 180
                +S PL+ F G  EL +++++  IW YI+ H L+   +  EILCD+K+  +FG+ +
Sbjct: 122 --TYKISEPLRGFFGETELTKSEIMNRIWDYIELHKLKRSNNSEEILCDDKLGLVFGEVV 179

Query: 181 TMFSMNKLLTKHLFNPDEIVKHEEEQKQTPEKEIKLENE 219
               +  + +K+L   + I    E    + EK+  L NE
Sbjct: 180 LAHKIPTMTSKYL---ERIESELEADASSLEKQSPLSNE 215

>YBR247C (ENP1) [426] chr2 complement(712961..714412) Essential
           nuclear protein required for 35S pre-rRNA processing
           into 18S rRNA [1452 bp, 483 aa]
          Length = 483

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 3/46 (6%)

Query: 14  ILSVSNPDEISPKRVRKALQILYSVNLDSQ--RKLINELILERFGD 57
           ++ V+NP+E SP  V +A ++  S NL ++  +K IN ++LERF D
Sbjct: 245 VIYVTNPEEWSPHVVYEATKLFVS-NLTAKESQKFINLILLERFRD 289

>Sklu_2379.3 YBR247C, Contig c2379 5202-6605
          Length = 467

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 3/44 (6%)

Query: 14  ILSVSNPDEISPKRVRKALQILYSVNLDSQ--RKLINELILERF 55
           IL V+NP++ SP  V +A ++  S NL ++  +K +N ++LERF
Sbjct: 229 ILYVTNPEQWSPHIVYEATKLFVS-NLPAKEAQKFVNSVLLERF 271

>CAGL0C01639g 175747..177162 highly similar to sp|P38333
           Saccharomyces cerevisiae YBR247c ENP1, start by
           similarity
          Length = 471

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 3/44 (6%)

Query: 14  ILSVSNPDEISPKRVRKALQILYSVNLDSQ--RKLINELILERF 55
           +L V+NP+E SP  V +A ++  S NL ++  +K IN ++L+RF
Sbjct: 233 VLYVTNPEEWSPHIVYEATKLFVS-NLQAKEAQKFINMVLLDRF 275

>KLLA0E20361g 1801106..1803187 some similarities with sp|P34226
           Saccharomyces cerevisiae YBL061c SKT5 protoplast
           regeneration and killer toxin resistance protein,
           hypothetical start
          Length = 693

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 141 RTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGK--KMTMFSMNKLLTKH 192
           R Q +K    Y+K+  ++  KD + +L D     +FGK  +   FS+ +   KH
Sbjct: 231 RQQFLKEALHYLKKLSVKGYKDAQYLLADSYSSGVFGKVNQKEAFSLFQASAKH 284

>YDR397C (NCB2) [1224] chr4
           complement(1266354..1266757,1266850..1266886) Beta
           subunit of NC2 (Dr1/Drap1) regulator of class II
           transcription [441 bp, 146 aa]
          Length = 146

 Score = 28.5 bits (62), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 139 LPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSMNKLL----TKHLF 194
           LP+  V KMI + I + DL   KD REI+ +  +E I    M + SM   +     K   
Sbjct: 10  LPKATVQKMISE-ILDQDLMFTKDAREIIINSGIEFI----MILSSMASEMADNEAKKTI 64

Query: 195 NPDEIVKHEEE 205
            P+ ++K  EE
Sbjct: 65  APEHVIKALEE 75

>CAGL0H09416g 921571..923823 highly similar to sp|P39925
           Saccharomyces cerevisiae YER017c AFG3 or sp|P40341
           Saccharomyces cerevisiae YMR089c YTA12, hypothetical
           start
          Length = 750

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 140 PRTQVVKMIWQYIKEHDLQN 159
           PR +++K  WQY+K  + QN
Sbjct: 81  PREEMMKAFWQYVKSKEFQN 100

>Kwal_47.18831
          Length = 161

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 139 LPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSMNKLLT----KHLF 194
           LP+  V K+I + + E DL   K+ REI+ +  +E I    M + SM   +     K   
Sbjct: 9   LPKATVQKIISEVL-ESDLTFSKEAREIIIESGIEFI----MILSSMASEMADKEAKKTI 63

Query: 195 NPDEIVKHEEE 205
            PD ++K  EE
Sbjct: 64  APDHVIKALEE 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.134    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,087,056
Number of extensions: 293434
Number of successful extensions: 1024
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1020
Number of HSP's successfully gapped: 37
Length of query: 223
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 125
Effective length of database: 13,203,545
Effective search space: 1650443125
Effective search space used: 1650443125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)