Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR231W (PEP5)1029101150670.0
Scas_594.21029102027840.0
ABL012C1020102523030.0
CAGL0M04895g1036102422380.0
KLLA0B13090g1021102322320.0
Kwal_55.2031889989520990.0
Kwal_26.803066056840.097
Kwal_56.2311213549770.14
KLLA0E18601g65079820.16
Sklu_2412.7112764820.16
Sklu_1684.114449770.17
CAGL0L00451g24169780.32
CAGL0I04576g14957711.1
CAGL0K08052g30567721.8
YDL008W (APC11)16549701.9
Sklu_2437.12622150722.0
KLLA0B09240g80072722.5
Scas_721.100113780713.6
Sklu_2337.232264694.4
Kwal_56.24206150230704.8
CAGL0L09823g74365695.1
Kwal_47.1777197263695.8
CAGL0J07920g80753686.5
AFR220W108559687.5
KLLA0D17182g92431688.2
Kwal_55.2151057571678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR231W
         (1011 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR231W (PEP5) [4187] chr13 (733544..736633) Vacuolar peripheral...  1956   0.0  
Scas_594.2                                                           1077   0.0  
ABL012C [580] [Homologous to ScYMR231W (PEP5) - SH] (375053..378...   891   0.0  
CAGL0M04895g 534252..537362 similar to sp|P12868 Saccharomyces c...   866   0.0  
KLLA0B13090g complement(1142698..1145763) similar to sp|P12868 S...   864   0.0  
Kwal_55.20318                                                         813   0.0  
Kwal_26.8030                                                           37   0.097
Kwal_56.23112                                                          34   0.14 
KLLA0E18601g complement(1645113..1647065) some similarities with...    36   0.16 
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          36   0.16 
Sklu_1684.1 YDL008W, Contig c1684 226-660                              34   0.17 
CAGL0L00451g 50190..50915 similar to sp|Q03246 Saccharomyces cer...    35   0.32 
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    32   1.1  
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    32   1.8  
YDL008W (APC11) [849] chr4 (433494..433991) Component of the ana...    32   1.9  
Sklu_2437.12 YDR488C, Contig c2437 21488-23356 reverse complement      32   2.0  
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    32   2.5  
Scas_721.100                                                           32   3.6  
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         31   4.4  
Kwal_56.24206                                                          32   4.8  
CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...    31   5.1  
Kwal_47.17771                                                          31   5.8  
CAGL0J07920g complement(769776..772199) similar to sp|P53848 Sac...    31   6.5  
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    31   7.5  
KLLA0D17182g 1456620..1459394 similar to sp|P27801 Saccharomyces...    31   8.2  
Kwal_55.21510                                                          30   8.9  

>YMR231W (PEP5) [4187] chr13 (733544..736633) Vacuolar peripheral
            membrane protein required for vacuole biogenesis [3090
            bp, 1029 aa]
          Length = 1029

 Score = 1956 bits (5067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 962/1011 (95%), Positives = 962/1011 (95%)

Query: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60
            MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN
Sbjct: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60

Query: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120
            QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV
Sbjct: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120

Query: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180
            ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT
Sbjct: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180

Query: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240
            ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL
Sbjct: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240

Query: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300
            SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR
Sbjct: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300

Query: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360
            IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII
Sbjct: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360

Query: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420
            QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS
Sbjct: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420

Query: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHXXXXXXXXXXXXDVEGIDTFIQHFDRK 480
            KFGVKEVPDPESMRNLADYLWSLIKNSISQRDH            DVEGIDTFIQHFDRK
Sbjct: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHVTLLLIVLIKLKDVEGIDTFIQHFDRK 480

Query: 481  GIWNEGXXXXXXXXXTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI 540
            GIWNEG         TFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI
Sbjct: 481  GIWNEGVVMDDMDDVTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI 540

Query: 541  LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE 600
            LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE
Sbjct: 541  LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE 600

Query: 601  VDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTXXXXXXXXXXXXXXXXPTYHPPKPS 660
            VDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGT                PTYHPPKPS
Sbjct: 601  VDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTSDAMSESSEASHEHEEPTYHPPKPS 660

Query: 661  IVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDW 720
            IVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDW
Sbjct: 661  IVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDW 720

Query: 721  RSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIASFANDN 780
            RSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIASFANDN
Sbjct: 721  RSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIASFANDN 780

Query: 781  PEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGNEVLK 840
            PEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGNEVLK
Sbjct: 781  PEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGNEVLK 840

Query: 841  EKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIESYDX 900
            EKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIESYD 
Sbjct: 841  EKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIESYDK 900

Query: 901  XXXXXXXXXXXTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTL 960
                       TINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTL
Sbjct: 901  ELKEKNKKLKNTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTL 960

Query: 961  ESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFK 1011
            ESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFK
Sbjct: 961  ESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFK 1011

>Scas_594.2
          Length = 1029

 Score = 1077 bits (2784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1020 (52%), Positives = 719/1020 (70%), Gaps = 18/1020 (1%)

Query: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60
            MSLS+WRQFQ +E++PI+DP  G D  LYSDPTLCA+  VD   L IAV S  IK++ L 
Sbjct: 1    MSLSNWRQFQFYESVPIKDPELGSDEPLYSDPTLCASAPVDATELFIAVKSTYIKLINLA 60

Query: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120
            +S+V + F +F  D+QIT LKVI+  FLVA+ E IGKPSLI+VYKL+KLP+    YHS V
Sbjct: 61   ESKVTYHFNAFEEDYQITCLKVIDKIFLVAIGECIGKPSLIKVYKLDKLPSNPTSYHSLV 120

Query: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180
            ELKNG+NTYPISV+SISNDLSCI VG++NGKIILIRGDISRDRGS+QR+IYED  KEPIT
Sbjct: 121  ELKNGSNTYPISVISISNDLSCIAVGYVNGKIILIRGDISRDRGSRQRMIYEDSGKEPIT 180

Query: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240
            +L LN DA+ CFA+TTSR LLFNTTGRN+G P L+LN++ G+DLNC   NP T+E+IC  
Sbjct: 181  SLNLNRDASICFASTTSRTLLFNTTGRNKGSPDLILNAQKGVDLNCSCLNPFTDEYICFT 240

Query: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300
             + IEF+  +G+KH+   DL++ KRIF V KD I+ V EE    T +ISVN  S + +NR
Sbjct: 241  DDSIEFYKETGEKHKILSDLAVPKRIFPVSKDDIVFVIEEK--QTQNISVNGGSFSTLNR 298

Query: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360
            + +ID  N++IS++  +S AIIDIF  +    +I ++LTSEGV++RIT KS+  Q+NI++
Sbjct: 299  VIVIDTLNQVISMSIYISHAIIDIFLVNDGKNDILFMLTSEGVLYRITKKSIHEQLNILM 358

Query: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420
            QKE + FAL L+KQH+L+ L++++IHK +GD+L+KKG + +AT +YIQCLDV+ETSE+IS
Sbjct: 359  QKEAFQFALTLSKQHNLNALEIEKIHKSFGDFLYKKGKKNDATKEYIQCLDVIETSEVIS 418

Query: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHXXXXXXXXXXXXDVEGIDTFIQHFDRK 480
            KFG+   PD  +  NLAD++WSLIK +I+  DH            D +G+D F+QHF R 
Sbjct: 419  KFGIDGNPDTNNTENLADFIWSLIKKNIANSDHVTLLLVVLIKLKDEKGMDYFLQHFTRA 478

Query: 481  GIWNEGXXXXXXXXXTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI 540
            G ++            +FYSD   FDL LI+ L+K S F + +Y  AKK++KD L IV I
Sbjct: 479  GTFDATGNAEDLNDEEYFYSDVPVFDLYLIVTLLKNSAFNKKAYFFAKKFAKDPLTIVSI 538

Query: 541  LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE 600
            LL+ L++P  A++Y++SLPID+TLR LV+YSK LL+E PNETNA+LI+VFTGK+KP  + 
Sbjct: 539  LLSTLNDPSGALEYVRSLPIDDTLRALVSYSKTLLQELPNETNAILIDVFTGKYKPKEYR 598

Query: 601  VD----LDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTXXXXXXXXXXXXXXXXPTYHP 656
             D    +   +TT   + +++ VFYSY TFFNYMN   T                PTYHP
Sbjct: 599  DDNIEPVTPDETT---TSDLKKVFYSYTTFFNYMNK--TVNPLLSEEHTLDAINTPTYHP 653

Query: 657  PKPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPER 716
            PKPSIVFSSF++KPFEFVVFLEACL  YQ+YEGF+ D+Q ILTTLYDLYLNL+  D+ ER
Sbjct: 654  PKPSIVFSSFLSKPFEFVVFLEACLDSYQRYEGFNNDKQDILTTLYDLYLNLSNTDIEER 713

Query: 717  IDDWRSRATGVLRESNKLV----YSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKID 772
              DW+SRA  +L++SN+LV     +  ++ T+K+ DNS+M+LISHM++    +  + +  
Sbjct: 714  RHDWKSRARKILKQSNELVALQEAATQASTTNKQFDNSLMMLISHMNKIDPYSMLEEEDG 773

Query: 773  IASFANDNP-EMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFK 831
                  +NP E+D +S F+ MTL +    C KF +KY + EP L ++AL +FVS+K I K
Sbjct: 774  EPMIVGNNPNELDYISLFKFMTLTDSAVNCFKFFQKYSSREPGLNRIALIFFVSSKHILK 833

Query: 832  EMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRN 891
            E+GG  VLKE+VL  IIE E M +L+II+ LS TNVA FGL+QD++I++V  E+ EI +N
Sbjct: 834  EIGGELVLKEEVLNKIIEDELMSVLEIIQVLSTTNVATFGLVQDLLINYVNKEEIEINKN 893

Query: 892  EKLIESYDXXXXXXXXXXXXTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQH 951
             KLIESY              + + +P+H+ +KNQ CFMC   LD+P+VFFKCGHIYHQ 
Sbjct: 894  RKLIESYQQELTEKNNKLKELLQTTEPIHIGIKNQKCFMCNGVLDLPIVFFKCGHIYHQR 953

Query: 952  CLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFK 1011
            CLNEE    + E KLFKCPKC+V+LET+N L+ AQ  +  K   L   L + +G  DRFK
Sbjct: 954  CLNEENSARDGE-KLFKCPKCMVELETANNLYLAQTAIARKKGQLEILLEN-DGKNDRFK 1011

>ABL012C [580] [Homologous to ScYMR231W (PEP5) - SH] (375053..378115)
            [3063 bp, 1020 aa]
          Length = 1020

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1025 (44%), Positives = 658/1025 (64%), Gaps = 34/1025 (3%)

Query: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60
            MS +S RQFQLFE  PIRDPNFG D+ LYSDPTL A T +   T+ IAV S  I+ + L 
Sbjct: 1    MSFNSQRQFQLFEITPIRDPNFGTDTPLYSDPTLSAVTPLGNGTIAIAVRSVYIQTIDLK 60

Query: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120
                + EF+++  D+QIT+L+ +    LV++ E +GKP+ I+++ L K P     +HS  
Sbjct: 61   TPASLAEFKAYGDDYQITYLEYVKDGMLVSVGECVGKPTSIKIWNLGKTPKDAFDFHSTC 120

Query: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180
            E++NGNNT+P+S +S+S DLSCIV+GF+NG+IIL+RGD+ RDRGS+QRIIYED + EPIT
Sbjct: 121  EVRNGNNTFPVSAISLSQDLSCIVLGFVNGRIILVRGDLYRDRGSRQRIIYEDLNNEPIT 180

Query: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240
            ALFLNND +  FA+TTSRI+LF TTGRN G P  VLN+  G+DLNC  FNP  +E +CCL
Sbjct: 181  ALFLNNDYSVTFASTTSRIMLFRTTGRNNGEPERVLNANTGIDLNCSCFNPERDELLCCL 240

Query: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300
               +EF+ ++G+KH    ++ ++KRIF +D DHIL+++  +   +T++ ++  + TI  +
Sbjct: 241  DKSVEFYKATGEKHSLLVEVPMKKRIFLIDNDHILLLSSVSTPNSTALQLSS-TGTITKK 299

Query: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360
            + I+D KN++I++N +++S I+ I+S +  G    YL+T++GV++RIT K ++ QI +I 
Sbjct: 300  VLILDLKNQLIAMNHLLASNIVHIYSDTVDGVYSVYLVTTDGVINRITEKPVDKQIKLIT 359

Query: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420
            Q+ELYP ALQLA+Q S+SPL +QEI ++YGD L+KK +++EA +QYIQCLD+ ETSEIIS
Sbjct: 360  QRELYPIALQLAEQRSVSPLRIQEIRRQYGDALYKKNMKEEAVEQYIQCLDITETSEIIS 419

Query: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHXXXXXXXXXXXXDVEGIDTFIQHFDRK 480
            +FG+++   P+  RNLA YLWS+IK  +S  DH            DV+GID FI HF R 
Sbjct: 420  RFGIQKTSRPDDSRNLATYLWSMIKQKLSHSDHVTLLLAILIKLKDVDGIDYFISHFSRN 479

Query: 481  GIW---NEGXXXXXXXXXTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLII 537
            G +    E          TFFYSD    DLD IL+L+K+S+    ++ L  K+SKD + +
Sbjct: 480  GEFVEEGEDESSWSVDDETFFYSDIVLMDLDTILQLLKDSELDAQAFSLVHKFSKDPIQV 539

Query: 538  VDILLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPS 597
            VD++LN L +P  A+KYIKSL +D+TLR L+ +SK LLE+ PN+TNALLI+VFTG+++ S
Sbjct: 540  VDVILNTLDDPHSALKYIKSLHVDDTLRVLIEFSKVLLEKLPNDTNALLIDVFTGRYQRS 599

Query: 598  TFEVDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTXXXXXXXXXXXXXXXXPTYHPP 657
            T + +++ R+     S N   VF+SYK F  YM S                   PTYHPP
Sbjct: 600  T-KCEVNIREKKQTISRN-NPVFHSYKAFVTYMYSTAG------GVPNSEDIQEPTYHPP 651

Query: 658  KPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERI 717
            KPS+VF+SF+ +PF+FVVFLEACL  Y +++GF  D+Q ILTTLYD+YL+LA  D     
Sbjct: 652  KPSLVFTSFIDRPFQFVVFLEACLESYNKFQGFLRDKQEILTTLYDIYLSLAATDEAHN- 710

Query: 718  DDWRSRATGVLRESNKLVYSAASNNTSK----RVDNSIMLLISHMD-------QSSASAK 766
            +DWR++AT V +ES KL  +  S    K    + DNS+M+LISH++       +  AS  
Sbjct: 711  EDWRTKATAVYKESEKLAGTCRSPQAPKASNTQFDNSLMMLISHINNVDLYSVEGDASGT 770

Query: 767  DKTKIDIASFANDNPEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSN 826
            +   ++ A+  N         TFR+M L +E   C+ FLEKYG+ EP+L ++AL +F+S+
Sbjct: 771  EDLSVNKANLTN---------TFRSMCLTKEAKKCMNFLEKYGSVEPELYRMALGFFLSS 821

Query: 827  KLIFKEMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDT 886
            K ++  +GG  V K +VL  +IE + +  LDI+  LS T+VA FGL++D +I+H+K +  
Sbjct: 822  KQVYDSIGGAPVFKARVLDKVIEMDLLQPLDILFVLSSTSVATFGLVRDFLINHIKAQQR 881

Query: 887  EIKRNEKLIESYDXXXXXXXXXXXXTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGH 946
            E   NEKLI+SY              ++  +PL V +KN  C MC   LD+P    +   
Sbjct: 882  ETHNNEKLIQSYQGELQEKEMQLKTLLSESEPLQVKVKNNFCKMCHTLLDLPGDILQMWP 941

Query: 947  IYHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGS 1006
             Y    L  E+       +L   PKC VD   S    + + +   K  LL  AL++E+ S
Sbjct: 942  -YLPPALPPEDSISAEMVRLILMPKCAVDNGASETWIKPKKDNDTKASLLQAALSNEDSS 1000

Query: 1007 RDRFK 1011
             DRFK
Sbjct: 1001 GDRFK 1005

>CAGL0M04895g 534252..537362 similar to sp|P12868 Saccharomyces
            cerevisiae YMR231w PEP5, start by similarity
          Length = 1036

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1024 (43%), Positives = 654/1024 (63%), Gaps = 21/1024 (2%)

Query: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60
            MSL SWR FQ ++N+PI DP  G D  LYSDPTL AA  V+     IAV SN I+   L 
Sbjct: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60

Query: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120
            ++++I EF++F   FQI++L V+   FL+A+ E +  PS ++++K+  LP  E  YHS V
Sbjct: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120

Query: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180
            E+KN +N +PIS VS+SN+L+CIVVGF+NGKI+LI+GD+SRDRGSQQRI+YED + +PIT
Sbjct: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180

Query: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240
            +LFLN+DA++CFA TTSRI++FN   +++  P  VL+SK G+ LNC SF+  TNE ICC+
Sbjct: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240

Query: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300
            ++ I+F+  +G++H     +S  K++  ++K  +LI+ EE    TTSI     +   I +
Sbjct: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300

Query: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360
              +ID +N I+S +F  +S I+D+        +I YL+T+EG+M++++ KSL+ +++I++
Sbjct: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360

Query: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420
             KE++PFALQLA   +L    +Q+I+K YGDYL+ KGL  EA  QY++C+D+++ S+II+
Sbjct: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420

Query: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHXXXXXXXXXXXXDVEGIDTFIQHFDRK 480
            K G  +V D ++MRNLAD++W LI+   +  D             D +G+  F+ +F R 
Sbjct: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480

Query: 481  GIWNEGXXXXXXXXXTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI 540
            G + E          ++F+SD   FDL+LI  L+ +S   +L Y+   K+SKD ++I D+
Sbjct: 481  GKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMITDV 540

Query: 541  LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE 600
            LLN+L      +KY+KSL +D+ LR LV +SK+LL  SPNETN LLIEVFTGK++PS++ 
Sbjct: 541  LLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYV 600

Query: 601  VDLDR--RDTTGDFSENIRTVFYSYKTFFNYMNS-NGTXXXXXXXXXXXXXXXXPTYHPP 657
             D++      TG  SE    VFYSY  F  YMN                     PTYHPP
Sbjct: 601  SDINNVVNTKTGTKSEK-NPVFYSYTAFLKYMNPLADASVLDASENGDRLDVDRPTYHPP 659

Query: 658  KPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERI 717
            KPS+VF++F+++PFEFVVFLEACL  Y+Q++GF  DRQ ILTTLYDLYL L++ DV ER 
Sbjct: 660  KPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEILTTLYDLYLTLSKQDVGERK 719

Query: 718  DDWRSRATGVLRESNKLV--YSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIAS 775
             +W  +A  VL ESN+L       SNN   +VDNS+M LI+HM+  + +       DI+S
Sbjct: 720  SEWTEKANLVLNESNELANELDQNSNNNLNKVDNSLMKLIAHMNGLNVA-------DISS 772

Query: 776  FANDNPEMD--------LLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNK 827
              N+N E          +++ FR +T   E S C+KF E++      L  +ALSYF+S K
Sbjct: 773  PINENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKK 832

Query: 828  LIFKEMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTE 887
             I + +GG + L +K+++PIIE   M +LD+++ LS  +   +G ++DI++D +K ED  
Sbjct: 833  EILEFIGGEDQLVKKIIKPIIENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAV 892

Query: 888  IKRNEKLIESYDXXXXXXXXXXXXTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHI 947
             KR +KLI SY              ++ D   H+ +K++ C +C +TL++PV++FKC HI
Sbjct: 893  AKRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHI 952

Query: 948  YHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSR 1007
            YHQ CLNEE D       L+KCPKC++D+ETS+K    + E+  + +LL+ A   E  + 
Sbjct: 953  YHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNS 1012

Query: 1008 DRFK 1011
            DRF+
Sbjct: 1013 DRFR 1016

>KLLA0B13090g complement(1142698..1145763) similar to sp|P12868
            Saccharomyces cerevisiae YMR231w PEP5 vacuolar biogenesis
            protein singleton, start by similarity
          Length = 1021

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1023 (42%), Positives = 649/1023 (63%), Gaps = 37/1023 (3%)

Query: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60
            MSL++WRQFQL+ENIPIRDP    D  LYSDPTL A   ++   L IAV ++++KVV L+
Sbjct: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60

Query: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120
               +  EF+++  ++Q+T+L+ ++   +V++ E +GKP LI+++ LEK+P  E  YH+  
Sbjct: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120

Query: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180
            E++NG+N YP+S VS + D SCI VGF +G++IL+RGD+ RDRGS+ RIIYED +KEPIT
Sbjct: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180

Query: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240
            AL L+ND +  F  TT++I+LFNT+GRN G+P ++LN   G+DLNCG  N +T+EFIC L
Sbjct: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240

Query: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300
             + ++ +  SG K     D+   KRIF +  DHIL++   + + T+S+ + + +P    R
Sbjct: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLV--SNITTSSLHLGK-TPNETIR 297

Query: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360
              I+D K KIIS + +++S++IDIFS   S      LLTS GV+H++  K L++Q+N I 
Sbjct: 298  AVILDIKTKIISYSLLITSSVIDIFSDGAS----VNLLTSNGVIHKLRQKKLDDQLNTIC 353

Query: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420
            QK++Y  AL+LAKQHSL  + VQEI K YGDYLFKKG ++EA +QY+ C++V + +EIIS
Sbjct: 354  QKDMYSVALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIIS 413

Query: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHXXXXXXXXXXXXDVEGIDTFIQHFDRK 480
            KFGV+   + E   NL D+LW L+K+  ++ DH            D+EG+ +F+ HF R 
Sbjct: 414  KFGVEHKTNSEDSINLKDFLWKLVKDGKAKVDHITLLLTLLIKLHDIEGLGSFLSHFKRD 473

Query: 481  GIWNEGXXX---XXXXXXTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLII 537
            G++NE             +FFYSD+  FDLD+ L L+ E +   L+ +   KYSKD   +
Sbjct: 474  GVFNENPEEFGNWSMNDDSFFYSDSSLFDLDIALRLLLECNMLELAQKYVLKYSKDPSQV 533

Query: 538  VDILLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPS 597
            V I+L    +   A+ YIKSLP+D+ LR L+ +S+KLL+  PNETN LLI++F G++KPS
Sbjct: 534  VSIVLLHKKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPS 593

Query: 598  TFEV---DLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTXXXXXXXXXXXXXXXXPTY 654
             ++    ++  +    + ++    +FY+Y++FF YM  +                  PTY
Sbjct: 594  NYDAVKENVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSA---SSDDKPLTVESAQPTY 650

Query: 655  HPPKPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVP 714
            HPPKPS++F SFV KPF+FVVFLEACL  Y++++G+D+DRQ ILTTLYD+YL+L ++D+ 
Sbjct: 651  HPPKPSLIFPSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIE 710

Query: 715  ERIDDWRSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIA 774
            ER  +W+ +A  VL E+ K     AS       D+S+MLLISHM        D     ++
Sbjct: 711  ERKAEWKGKAEAVLEETEKYKIRQASERAP---DSSLMLLISHM-------HDMNPFTLS 760

Query: 775  SFANDNPE-------MDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNK 827
            S   D  E       + L   FR+M L  +P  CL FLEKYG  E  L ++A+ +FVS+K
Sbjct: 761  SMQEDEQESNSIISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSK 820

Query: 828  LIFKEMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTE 887
             I++++GG  V +EK+L  +++ + M  L+II+ LS TNV  +G I+D ++D++K E+ E
Sbjct: 821  QIYEDIGGESVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAE 880

Query: 888  IKRNEKLIESYDXXXXXXXXXXXXTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHI 947
            I++NE L++SY+             +  + PL V +K + C  C + L+ P+VFFKCGH+
Sbjct: 881  IQKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHL 940

Query: 948  YHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSR 1007
            YHQ CLNEE D+      L+ CP+C+V+ E++ K         +  +LL  AL+  +   
Sbjct: 941  YHQRCLNEETDS----DLLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKE 996

Query: 1008 DRF 1010
            DRF
Sbjct: 997  DRF 999

>Kwal_55.20318
          Length = 899

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/895 (44%), Positives = 604/895 (67%), Gaps = 27/895 (3%)

Query: 129  YPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPITALFLNNDA 188
            YP+S VSI +DL+CI +GF+NG++ILIRGDI  DRGS+QR+IY+D +KEPITAL L+ D 
Sbjct: 2    YPMSAVSIWHDLTCIAIGFVNGRVILIRGDILHDRGSRQRVIYDDHNKEPITALMLDRDC 61

Query: 189  TACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCLSNFIEFFS 248
              CFA+TTS + LFNT GRN G+P +VLNS+ G+DLNC   +    EFICC S+ IEF+ 
Sbjct: 62   RMCFASTTSAMFLFNTAGRNSGKPDVVLNSETGIDLNCSCLSYDETEFICCSSSSIEFYK 121

Query: 249  SSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINRIFIIDAKN 308
            S+G+K     D+++ KR++ +D++HILI++      +T++SV  +S T  NR+ I+D +N
Sbjct: 122  STGEKRSLVIDIAMIKRVYAIDQNHILILSGVQTSNSTALSVTNVS-TPNNRVVILDIQN 180

Query: 309  KIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIIIQKELYPFA 368
            K+I++N +++ +I+DIF +  +G+    LLT++G +H++T KS+E +++I  QKEL+P A
Sbjct: 181  KLIAMNSLITGSILDIFPSIFAGEPSVVLLTNDGTLHKLTEKSIEQKLDITEQKELFPIA 240

Query: 369  LQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIISKFGVKEVP 428
            L LAKQ+ L PL ++ I KKY +YL++KG + EA +QY+QCL V ETSE+I KFG+    
Sbjct: 241  LDLAKQNKLKPLQIENIRKKYAEYLYRKGAKAEAIEQYLQCLSVTETSEVIEKFGIGSTS 300

Query: 429  DPESMRNLADYLWSLIKNSISQRDHXXXXXXXXXXXXDVEGIDTFIQHFDRKGIW---NE 485
            D   + +L+ YL ++IK  +S  +H            D EGID FI+HF R G +    E
Sbjct: 301  DISDVSHLSYYLLAMIKKRLSNANHVTLYMITLIKLRDEEGIDRFIKHFSRSGYYLEEEE 360

Query: 486  GXXXXXXXXXTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDILLNLL 545
                       +FYSD+D FDLDL L L++E+ F   SY+L++K++KD  I+V++ +  L
Sbjct: 361  SEEDWRKEDEAYFYSDSDLFDLDLSLRLLQEAGFFSQSYQLSRKFAKDPAIVVEMSIEGL 420

Query: 546  HNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFEVDLDR 605
            ++P  A++YIKSLP+D+TLR L+T+SKKLLE  PN+TNALLIE+FTGK++P T+E +  R
Sbjct: 421  NDPHSALRYIKSLPVDDTLRVLITFSKKLLELLPNDTNALLIELFTGKYQPLTYE-EASR 479

Query: 606  RDTTGDFSENIRTVFYSYKTFFNYMNSNGTXXXXXXXXXXXXXXXXPTYHPPKPSIVFSS 665
             ++  +  +  + VFYSY +F  +M ++ T                PTY PPKP+++F+S
Sbjct: 480  CNSLSE-KKPEKNVFYSYSSFIEHMKTSAT------SKDQPHVNNIPTYQPPKPALIFTS 532

Query: 666  FVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDWRSRAT 725
            F+ +PFEFVVFLEACL  Y ++ GFD D+Q+ILTTLYD+YL+LA+ D  +R  +WR++A+
Sbjct: 533  FINQPFEFVVFLEACLGSYSEFHGFDHDKQLILTTLYDIYLSLAEADEEDRQQEWRAKAS 592

Query: 726  GVLRESNKLVYSAASNNTS-------KRVDNSIMLLISHMDQSSASAKD--KTKIDIASF 776
             V +ES KL+ + A++N S       K +DNS+M+LIS ++    + ++    + +++SF
Sbjct: 593  RVYKESTKLLAATAASNKSSSSEKPAKPIDNSLMMLISQVNGIDLALEECMSKEEEVSSF 652

Query: 777  ANDNPEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGN 836
                 ++DL   F++++L   P   L+F+EK+G  EP L  +ALS+F+++K   K +GG 
Sbjct: 653  ----EKLDLTYRFQSLSLTSSPQNALEFVEKFGEREPALYTMALSHFITSKSAMKAIGGE 708

Query: 837  EVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIE 896
             V + KVL+ ++E + MPLLD+++ L  TNVA FGL+Q+I+IDH++++  EIK+N+KLI+
Sbjct: 709  AVFRSKVLQKVLEKDLMPLLDVLQVLGSTNVASFGLVQEILIDHLRSDSQEIKKNKKLID 768

Query: 897  SYDXXXXXXXXXXXXTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEE 956
            SY+             ++   P  + LKNQ C  C  TL+ P+V+FKCGHIYHQ CLNEE
Sbjct: 769  SYEAELQEKESRLLSLLDDTNPSQIRLKNQNCNTCHTTLNAPIVYFKCGHIYHQRCLNEE 828

Query: 957  EDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFK 1011
            E +LE   + FKCP+C++D ETS  +  AQ +     DLL  AL  ++ ++DRF+
Sbjct: 829  E-SLERGSRFFKCPQCVIDFETSEGMKNAQIKAQMDADLLKLALK-DQNNKDRFR 881

>Kwal_26.8030
          Length = 660

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 11/56 (19%)

Query: 938 PVVFFK-CGHIYHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEK 992
           PVV+   CGH  HQHC +      E  +  +KCP C V +       EAQ  V++K
Sbjct: 399 PVVYMSPCGHAIHQHCFD------EYTKHSYKCPSCQVSVLN----MEAQFRVLDK 444

>Kwal_56.23112
          Length = 135

 Score = 34.3 bits (77), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972
           N TC  CR   D  P+V  +C H +H HC+ +    LE+      CP C
Sbjct: 42  NGTCPGCRFPGDNCPLVIGECNHNFHVHCIQQ---WLETATAKGLCPMC 87

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 13/79 (16%)

Query: 920 HVPLKNQT---CFMCR---LTLDIPVVFFK-CGHIYHQHCLNEEEDTLESERKLFKCPKC 972
           H  ++N T   C +CR    T  + VV+   CGH  HQHC +      E  +  +KCP C
Sbjct: 360 HKCIENSTRSNCPICREYMFTSTMAVVYMDPCGHAIHQHCFD------EYIKHSYKCPNC 413

Query: 973 LVDLETSNKLFEAQHEVVE 991
            V +    + F   H+ ++
Sbjct: 414 NVSVINMEREFRILHQEIQ 432

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 913 INSDQPLHVPLKNQTCFMCRLTLDIP---VVFFKCGHIYHQHCLNEEEDTLESERKL-FK 968
           +N   P     K   C +C      P   V+F +C H + +HCL E  D  ++++KL  K
Sbjct: 859 VNEKYPDRDSFKGLECSICTSEPIEPITQVIFTECAHAFCEHCLLEYID-FQTQKKLELK 917

Query: 969 CPKC 972
           CP C
Sbjct: 918 CPNC 921

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 34.3 bits (77), Expect = 0.17,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972
           N TC  C+   D  P+V  +C H +H HC+ +  DT  S R L  CP C
Sbjct: 44  NGTCPSCKYPGDECPLVVGECNHNFHVHCIVQWLDTATS-RGL--CPMC 89

>CAGL0L00451g 50190..50915 similar to sp|Q03246 Saccharomyces
           cerevisiae YMR188c, start by similarity
          Length = 241

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 770 KIDIASFANDNPEMDLLSTFRAMT-----LNEEPSTCLKFLEKYGTEEPKLLQVALSYFV 824
           K+DI     D  E    S   AM      L +EPS C+++L++ G E P+LLQ  +   +
Sbjct: 175 KLDIQGVEEDLIEQK--SKIDAMQGKLNDLLQEPSKCIEYLKQRGVESPELLQKNIMKNL 232

Query: 825 SNKLIFKEM 833
             K + KE+
Sbjct: 233 VRKHVLKEL 241

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 32.0 bits (71), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 15/57 (26%)

Query: 928 CFMCRLTLDIP------------VVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972
           C +CR +   P            +V  +CGH +H HC++   DT  S+     CP C
Sbjct: 37  CGICRASYHAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKG---LCPMC 90

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
            Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 32.3 bits (72), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 11/67 (16%)

Query: 944  CGHIYHQHCLNEEEDTLESERKLFKCPKCLVDLET-SNKLFEAQHEVVE------KNDLL 996
            CGH YH  C+ +     E      KCP C +D E    KL+    ++++       N ++
Sbjct: 25   CGHEYHSDCIRKWHGHAED----LKCPMCRIDAEELVVKLYGCAEKIIDLQKGFAVNQVV 80

Query: 997  NFALNSE 1003
            N  +N+E
Sbjct: 81   NHVINTE 87

>YDL008W (APC11) [849] chr4 (433494..433991) Component of the
           anaphase-promoting complex (APC), has ubiquitin ligase
           activity and is required for the metaphase-anaphase
           transition [498 bp, 165 aa]
          Length = 165

 Score = 31.6 bits (70), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972
           N TC  C+   D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 49  NGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKG---LCPMC 94

>Sklu_2437.12 YDR488C, Contig c2437 21488-23356 reverse complement
          Length = 622

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 61/150 (40%), Gaps = 14/150 (9%)

Query: 252 KKHQFAFDLSLRKRIFCVDKDH----ILIVTEETGVPTTSISVNELSPTIINRIFIIDA- 306
           + H+   D+    R  CV  D+    +L V + +   T S S + +     +   ++DA 
Sbjct: 197 RSHELPMDMGPPGRPLCVSVDYHNGLVLAVVQTSLGSTESFSTSMVYVYKFDTAEVVDAV 256

Query: 307 ---KNKIISLNFVVS--SAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIIIQ 361
               + ++   F+ +  SAI+ +  TS +GK + Y L +     R  P    N    II 
Sbjct: 257 EFKGHSLLRGEFIRNEPSAIVSMVLTSYNGKTVLYELRATTQEGRYRPVVERN----IIS 312

Query: 362 KELYPFALQLAKQHSLSPLDVQEIHKKYGD 391
           K  + + +    QH      VQ I+    D
Sbjct: 313 KNYHNYPVYALCQHGAKGRPVQRIYTASTD 342

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 928 CFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKCLVDL--ETSNKLFEA 985
           C +C    + P+   KC H + + C+NE  D+  ++ K   CP C + L  +   +  E 
Sbjct: 547 CQLCDDEAEEPIES-KCHHRFCRLCINEYIDSFMADEKKLTCPVCHIGLSIDLQQQALEV 605

Query: 986 QHEVVEKNDLLN 997
             E+ +K  +++
Sbjct: 606 DEELFKKQSIVS 617

>Scas_721.100
          Length = 1137

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 928  CFMCRLTLDIP---VVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFE 984
            C +C  T  IP   +VF +CGH + + C+ E  +    +    KCP C   +  SN+L  
Sbjct: 884  CSIC-TTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQI-NSNRLL- 940

Query: 985  AQHEVVEKNDLLNFALNSEE 1004
                 VEK +   F L   E
Sbjct: 941  ----TVEKIEAETFKLKHYE 956

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 927 TCFMCRLTLDIPV-VFFKCGHIYHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEA 985
           TC +C   L   +     C H YH  C+ E      +  + FKCP C V+   SNKL + 
Sbjct: 5   TCSICLEALGQNIGRLVTCQHEYHLECIRE----WHNHSQDFKCPTCRVE---SNKLLDV 57

Query: 986 QHEV 989
           ++ V
Sbjct: 58  ENNV 61

>Kwal_56.24206
          Length = 1502

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 944  CGHIYHQHCLNEEEDTL-ESERKLFKCPKC 972
            CG  YH +C+N+ +  L  SE  +F CP C
Sbjct: 1290 CGEWYHMNCINKGKWALASSENTVFVCPIC 1319

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 933 LTLDIPVVFFKCGHIYHQHCLNEEEDTLESE----RKLFKCPKCLVDLETSNKLFEAQHE 988
           +T DI ++F +C       CLN  E  L+ +    + L     CL ++++SNKLF   HE
Sbjct: 390 VTSDIDILFNQCKF---SQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHE 446

Query: 989 VVEKN 993
           + EK+
Sbjct: 447 LAEKD 451

>Kwal_47.17771
          Length = 972

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%)

Query: 913 INSDQPLHVPLKNQTCFMCRLTLDIPV---VFFKCGHIYHQHCLNEEEDTLESERKLFKC 969
           I+   P    L+N  C +C      PV   +F +CGH + + C+ E        ++  KC
Sbjct: 704 IHEKYPHEDRLRNLECSICTSEPIDPVTQVIFTECGHAFCELCILEYIRFQTERQQDIKC 763

Query: 970 PKC 972
           P C
Sbjct: 764 PNC 766

>CAGL0J07920g complement(769776..772199) similar to sp|P53848
           Saccharomyces cerevisiae YNL256w FOL1 Dihydroneopterin
           aldolase, hypothetical start
          Length = 807

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 549 VKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFEV 601
           +KAIK    +P D+ L  + TY  K+ + +      ++ ++  G F P+ F+V
Sbjct: 572 IKAIKACSDIPFDKVLLSIDTYRSKVAQSAIECGIDIVNDISAGSFDPTMFDV 624

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 3/59 (5%)

Query: 923 LKNQTCFMCRLTLDIP---VVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKCLVDLET 978
           LK+  C +C      P   VVF +CGH + + CL E       +     CP C   +E+
Sbjct: 827 LKDLECSICTCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNKKGSETICPNCRAAVES 885

>KLLA0D17182g 1456620..1459394 similar to sp|P27801 Saccharomyces
           cerevisiae YLR148w PEP3 vacuolar membrane protein
           singleton, hypothetical start
          Length = 924

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 376 SLSPLDVQEIHKKYGDYLFKKGLRKEATDQY 406
            LS +    +H  YGDY ++K + +EA +QY
Sbjct: 375 GLSSVQKDYVHSFYGDYYYEKQMWEEAAEQY 405

>Kwal_55.21510
          Length = 575

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 10/71 (14%)

Query: 14 NIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLNQSQVIHEFQSFPH 73
          + P+R P  GG+SL+      C  ++ +P    +A+N ++   +   Q        + P 
Sbjct: 9  DAPVRRPQLGGNSLIRKIQRACRLSLAEPD---LALNLDVADFINAKQG-------ASPR 58

Query: 74 DFQITFLKVIN 84
          +  I  +K+IN
Sbjct: 59 EAAIAIVKLIN 69

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,929,594
Number of extensions: 1477605
Number of successful extensions: 4403
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4506
Number of HSP's successfully gapped: 46
Length of query: 1011
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 899
Effective length of database: 12,718,893
Effective search space: 11434284807
Effective search space used: 11434284807
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)