Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR228W (MTF1)34133617930.0
Sklu_2383.233833610861e-149
Kwal_26.91803413389481e-128
Scas_594.53433419171e-123
CAGL0M11286g3383398991e-120
KLLA0B08283g3353236445e-82
AFR564W3343216341e-80
Kwal_55.2120627541671.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR228W
         (336 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA p...   695   0.0  
Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement        422   e-149
Kwal_26.9180                                                          369   e-128
Scas_594.5                                                            357   e-123
CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces...   350   e-120
KLLA0B08283g complement(736483..737490) gi|3024184|sp|P87250|MTF...   252   5e-82
AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH] complement(...   248   1e-80
Kwal_55.21206                                                          30   1.9  

>YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA
           polymerase specificity factor, distantly related to
           bacterial sigma factors [1026 bp, 341 aa]
          Length = 341

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/336 (100%), Positives = 336/336 (100%)

Query: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60
           MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ
Sbjct: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60

Query: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP 120
           SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP
Sbjct: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP 120

Query: 121 EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL 180
           EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL
Sbjct: 121 EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL 180

Query: 181 LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK 240
           LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK
Sbjct: 181 LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK 240

Query: 241 PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLK 300
           PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLK
Sbjct: 241 PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLK 300

Query: 301 KCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336
           KCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ
Sbjct: 301 KCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336

>Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement
          Length = 338

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 258/336 (76%), Gaps = 1/336 (0%)

Query: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60
           MSV IP +   +K+K +YGFKYL N +V+ +I++KL L  TYK  +ELKVLDLYPG    
Sbjct: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKM-DELKVLDLYPGPSQH 59

Query: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP 120
           SAIF N + P+QY L++ R    KF+   F G+ +++ +RDPY+WS+Y+++I++E+ FVP
Sbjct: 60  SAIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVP 119

Query: 121 EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL 180
             QS D I+++FL +AN+TG   EGL MQWLSCIGNKNWL RFG+VKML+W+P  TA K+
Sbjct: 120 NRQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKV 179

Query: 181 LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK 240
           LARPG   R+KCSVV EAFTDTKL+A SD++ L+ F S  +EE DPI+FS  + W   GK
Sbjct: 180 LARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGK 239

Query: 241 PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLK 300
           PI+L+E++PID D D+DNWDYVT+HL+ILK TPL+T +DSLGHGG+QYF+ ++ DK L+ 
Sbjct: 240 PISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMD 299

Query: 301 KCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336
           KCP DLTN EF+YLT +F  WPFKPDI MDF+D++Q
Sbjct: 300 KCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQ 335

>Kwal_26.9180
          Length = 341

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 241/338 (71%), Gaps = 2/338 (0%)

Query: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60
           M++ +  +++++K++ +YGF+YL N  V+ KIF KL L  TY    +LKVLDLYPG    
Sbjct: 1   MALKVQPLQELAKIQHYYGFRYLLNKAVHEKIFSKLKLKDTYSDVNKLKVLDLYPGPAQH 60

Query: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNA-KFEGSP-LQILKRDPYDWSTYSNLIDEERIF 118
           S +  N   P Q+ L++ R    K + A   E +  LQ+  RDPYDW +Y+N+I++E++F
Sbjct: 61  SVVLNNYLKPSQHVLMDARPDFVKHIRALSLESNGNLQLYNRDPYDWQSYTNMIEKEKLF 120

Query: 119 VPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTAR 178
           VP  Q  D I+ +FL +AN+TG   EGL MQWL+CIGNKNWL RFG+VKML+W+  +TA 
Sbjct: 121 VPTKQPQDAIHKEFLVMANLTGMIGEGLFMQWLACIGNKNWLQRFGRVKMLVWVQESTAL 180

Query: 179 KLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTK 238
           KLLARPG H RSKCSVV EAFTDTKL+A  D+  +  F +  +   +PI+F + ++W   
Sbjct: 181 KLLARPGEHLRSKCSVVAEAFTDTKLVATMDSKNISKFSTSVLSTHEPIVFPSQDVWAPS 240

Query: 239 GKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDL 298
           GKPI+L+E++P+D   D+DN+DY T+HL+ILK TPL+  +DSLGHGG++YF   I DK+L
Sbjct: 241 GKPISLLEVNPLDHIIDLDNFDYATKHLLILKSTPLSESLDSLGHGGKEYFRRVIRDKNL 300

Query: 299 LKKCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336
           L++CP DLT  EFI +T LF +WPFKPDI MDF+D++Q
Sbjct: 301 LQRCPKDLTCREFIEITDLFDKWPFKPDIYMDFIDVFQ 338

>Scas_594.5
          Length = 343

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 235/341 (68%), Gaps = 8/341 (2%)

Query: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60
           MS+ +P    +SK+   YG +YL NP V++KIF KLD  +   +   LKVLD+YPG  +Q
Sbjct: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKE---YSSTLKVLDMYPGPCVQ 57

Query: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFE-GSPLQILKRDPYDWSTYSNLIDEERIFV 119
           S +FYNKY P+QY L+E RS   K + ++F   SPL+  +RDPY W ++  +I++E++ V
Sbjct: 58  STMFYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLV 117

Query: 120 PEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARK 179
           PE Q   HI++ FL V NVT   +E LIMQW  CIGN+NWL RFG+V+MLLW+P +TA K
Sbjct: 118 PEKQPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASK 177

Query: 180 LLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKG 239
           L+A P    RSK SV+REAFTDT+L+AIS+  ELK FD   ++E +PI+F    +    G
Sbjct: 178 LMAEPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAG 237

Query: 240 ----KPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITD 295
                 IAL+E++P + D D++NWDYVT+HLMILK+T L   ++SLGHG + YF  +I D
Sbjct: 238 VSSATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIED 297

Query: 296 KDLLKKCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336
              L K P ++TND+FIYLTK+F  WPFKPDI MDFVD+ Q
Sbjct: 298 STYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQ 338

>CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces
           cerevisiae YMR228w MTF1 RNA polymerase specific factor,
           start by similarity
          Length = 338

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 237/339 (69%), Gaps = 9/339 (2%)

Query: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60
           M V +P I  +  +K +YGF+YL +P  + K+F+KL L+        +KVLDLYPG GI 
Sbjct: 1   MKVAVPTISQLH-IKSYYGFRYLLDPDWHQKVFEKLGLSSN----PNMKVLDLYPGPGIH 55

Query: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP 120
           SA+ YNK  P+QY+++E R      L   +   P++++K+DPY W +Y+ LID+E++FVP
Sbjct: 56  SAVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVP 115

Query: 121 EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL 180
           +    + +N  F  +AN+T +  EGL+MQW++C+GN+NWL+RFG+  ML+WMP+ TA KL
Sbjct: 116 KKADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKL 175

Query: 181 LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK 240
           LA  G HSR KCS+VREAFTDTKL+A+S   ++K F+S C+++ +P++      +  K  
Sbjct: 176 LADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDF 235

Query: 241 PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKD--- 297
           PIALVE  P   D D+DNW++VT+HLM+L +TPL   +D LGHG + YF++ I DKD   
Sbjct: 236 PIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANI-DKDHIH 294

Query: 298 LLKKCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336
           LLKKCP D TN++F+YLT LF  WPFKPD+ MDF+D+YQ
Sbjct: 295 LLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQ 333

>KLLA0B08283g complement(736483..737490)
           gi|3024184|sp|P87250|MTF1_KLULA Kluyveromyces lactis
           MITOCHONDRIAL REPLICATION PROTEIN MTF1 (MITOCHONDRIAL
           TRANSCRIPTION FACTOR MTTFB), start by similarity
          Length = 335

 Score =  252 bits (644), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 132/323 (40%), Positives = 201/323 (62%), Gaps = 7/323 (2%)

Query: 12  SKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPR 71
           +K+   YG ++  NP V N+I DKL+L   YK  E L++LD+Y G  IQS I   +  P+
Sbjct: 15  NKIHTSYGSQFEKNPKVINQILDKLNLESYYKS-ESLQILDIYAGPLIQSVILNERLKPK 73

Query: 72  QYSLLEKRSSLYKFLNAKFEGSPLQI-LKRDPYDWSTYSNLIDEERIFVPEVQSSDHIND 130
           ++ LLE R    +   A  +  P  +   ++PY W T+  + +E+R+  P +Q  DHI++
Sbjct: 74  KHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHN 133

Query: 131 KFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRS 190
           +FL  AN+T +  E L +Q+L CI N+NW+ RFG VKML+W+P  TARKL A      R+
Sbjct: 134 EFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRN 193

Query: 191 KCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPI 250
           + +++ E  T+TKL+A S+ N +K F   CIE++DP++  +    P     ++LVE++P 
Sbjct: 194 RLTLLSELATNTKLVATSE-NSVKKFLPDCIEKFDPVIIPSDNKSPDD---LSLVEINPR 249

Query: 251 DFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDE 310
           D   D+D+WD+VT+ LMILK  P+  +++ LGHG + +F SR+ D  LLKK P +LT  E
Sbjct: 250 DHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELTYLE 308

Query: 311 FIYLTKLFMEWPFKPDILMDFVD 333
              + K+F  WPFKP +L+DF D
Sbjct: 309 IDEIAKVFALWPFKPSLLVDFYD 331

>AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH]
           complement(1446758..1447762) [1005 bp, 334 aa]
          Length = 334

 Score =  248 bits (634), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 195/321 (60%), Gaps = 11/321 (3%)

Query: 14  LKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQY 73
           +KF YG   L +PT     + +L+L + Y    +++VL+LYPG G+ S IF++ Y P+  
Sbjct: 19  VKFSYGRTLLHSPTAIELAYKRLNLQEHYDM-SKVQVLELYPGTGLPSYIFHDIYKPKLQ 77

Query: 74  SLLEKRSSLYKFLNAKFEG-SPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKF 132
            L+E + +  K +         +++ K DPY W ++ +LIDE++I  PEVQ+ DHI+D F
Sbjct: 78  VLMESKPAYAKVIEQHLTLLDNIKLHKEDPYMWESFVSLIDEKKIMQPEVQTRDHIHDSF 137

Query: 133 LTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKC 192
           + + N+T +  E L MQ+L CI NKNW+ RFG V+ML W+P TTA KLL+  G  SRS+C
Sbjct: 138 IVMGNLTDKRGEQLYMQYLQCIANKNWMQRFGLVRMLFWVPQTTAIKLLSPCGFKSRSRC 197

Query: 193 SVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDF 252
           SV+ EA TDT+LIA +  N L  F    +++ DP+      I P      AL+E+ P++ 
Sbjct: 198 SVITEAVTDTRLIATTPDN-LASFGPGVLDKHDPL------ILPENKTDYALLEVLPLNH 250

Query: 253 DFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFI 312
           +  ++ WDY  + L++ K TPL  +++ LGHG   +   RI D +LLKK P+ LTN EF 
Sbjct: 251 NMKLEYWDYCMQRLLVCKSTPLEDILEVLGHGASDFLKCRI-DPELLKKKPMQLTNQEFT 309

Query: 313 YLTKLFMEWPFKPDILMDFVD 333
            +  L+  WPFKP I  DF D
Sbjct: 310 KIASLYALWPFKPSI-YDFYD 329

>Kwal_55.21206
          Length = 275

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 184 PGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEW 224
           PG  SR+ C++ +E F     + +   N +  F + CI++W
Sbjct: 112 PGADSRTTCAICQEDFNKLNNVCLLGCNHV--FHTYCIDQW 150

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,220,658
Number of extensions: 565067
Number of successful extensions: 1322
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1332
Number of HSP's successfully gapped: 15
Length of query: 336
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 234
Effective length of database: 13,065,073
Effective search space: 3057227082
Effective search space used: 3057227082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)