Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR227C (TAF7)59058019890.0
Scas_594.66553259571e-121
CAGL0M11264g5493178711e-110
KLLA0B08305g7352458801e-109
Kwal_26.91765512378521e-107
AFR563C5762518201e-102
Sklu_2271.355283683.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR227C
         (580 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component...   770   0.0  
Scas_594.6                                                            373   e-121
CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021 S...   340   e-110
KLLA0B08305g 737967..740174 some similarities with sp|Q05021 Sac...   343   e-109
Kwal_26.9176                                                          332   e-107
AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH] (1444641.....   320   e-102
Sklu_2271.3 YBR255W, Contig c2271 1824-3482 reverse complement         31   3.9  

>YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component of
           the TAF(II) complex (TBP-associated factor), required
           for activated transcription by RNA polymerase II [1773
           bp, 590 aa]
          Length = 590

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/580 (71%), Positives = 412/580 (71%)

Query: 1   MAVIRIKKPRGPGEKDQPLEGEPKLKRIRIKTKVTDEDXXXXXXXXXXXXXXXXXXXXXX 60
           MAVIRIKKPRGPGEKDQPLEGEPKLKRIRIKTKVTDED                      
Sbjct: 1   MAVIRIKKPRGPGEKDQPLEGEPKLKRIRIKTKVTDEDIKPKPKLKINLKKKKESADGKE 60

Query: 61  XXXXXXXXXXXXXXXXXXXXIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI 120
                               IHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI
Sbjct: 61  KKNSLKLKLNLKKNEEPVKKIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI 120

Query: 121 LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRK 180
           LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRK
Sbjct: 121 LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRK 180

Query: 181 NLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNG 240
           NLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNG
Sbjct: 181 NLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNG 240

Query: 241 APLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQD 300
           APLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQD
Sbjct: 241 APLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQD 300

Query: 301 KQAEEVSYDLVDKSELQARQERVSSWENFKEEPGEPLSRPALKKEEIHTIASAVGKQGAX 360
           KQAEEVSYDLVDKSELQARQERVSSWENFKEEPGEPLSRPALKKEEIHTIASAVGKQGA 
Sbjct: 301 KQAEEVSYDLVDKSELQARQERVSSWENFKEEPGEPLSRPALKKEEIHTIASAVGKQGAE 360

Query: 361 XXXXXXXXXXXXXDLDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
                        DLDL                                           
Sbjct: 361 EEGEEGMEEEEEEDLDLGAAFESEEEGSGAEGDKEQQQEEVGDEVDQDTGGEDDDDDDDG 420

Query: 421 XXXXXXXXXXXXXXXXXNRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSIX 480
                            NRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 
Sbjct: 421 DIEAAGGESESDDEKDENRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSIK 480

Query: 481 XXXXXXXXXXXXXXXTEDSVQKQHQHRSDAETAXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
                          TEDSVQKQHQHRSDAETA                           
Sbjct: 481 KLEKEAELKRKQLQQTEDSVQKQHQHRSDAETANNVEEEEEEEEEEEEEDEVDEDEEDDE 540

Query: 541 XXXXXXXXXHEREHIQENKVVRELDEAPAEETLDQNDLDM 580
                    HEREHIQENKVVRELDEAPAEETLDQNDLDM
Sbjct: 541 ENDEDEDNVHEREHIQENKVVRELDEAPAEETLDQNDLDM 580

>Scas_594.6
          Length = 655

 Score =  373 bits (957), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 232/325 (71%), Gaps = 6/325 (1%)

Query: 1   MAVIRIKKPRGPGEK-DQPLEGEPKLKRIRIKTKVTDEDXXXXXXXXXXXXXXXXXXXXX 59
           M  I++K+P  P E  +     EPKLK+IRIKTK  D +                     
Sbjct: 25  MVTIKLKRPNPPKETAEDSTNKEPKLKKIRIKTKNKDNEQIPKKPKLKISLKKRKVTDPL 84

Query: 60  XXX-----XXXXXXXXXXXXXXXXXXIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIES 114
                                     +HKAP+LRLKPIRIPGE YDSEASDIEDDPLIES
Sbjct: 85  MDKPVGGPLKLKLHRKPSASPIVEKKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIES 144

Query: 115 GVILRILPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVN 174
           G+ILR+LPDIQ+EFVKNS+ESGDYSG+++KW   RHAVV IN  MYGAILVDLPTVIEVN
Sbjct: 145 GIILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLPTVIEVN 204

Query: 175 KSVDRKNLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETF 234
           KSVDRKNLLKTFDVSQML+CI+ IQ+E+EV+ L+AP++EDLV KH+  IE+EI  NK+  
Sbjct: 205 KSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHYSDIEEEILGNKKVL 264

Query: 235 LKGYNGAPLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVD 294
           +K  N   LS++E ++L EIA KGYDYKHG+SPPLYNVRNRRFRRKM P+E +Y E+VV+
Sbjct: 265 MKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRFRRKMGPSEFEYAEEVVE 324

Query: 295 MLLKQDKQAEEVSYDLVDKSELQAR 319
            LL+QD++AE V+Y+LVD+SE+  R
Sbjct: 325 TLLRQDEKAENVTYELVDESEMLGR 349

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%)

Query: 438 NRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479
           +RQH ELLADEL+ELETTL HT++KL K TNPLL+SRFID+I
Sbjct: 487 DRQHVELLADELSELETTLTHTRNKLQKVTNPLLRSRFIDNI 528

>CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67, start by
           similarity
          Length = 549

 Score =  340 bits (871), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 173/317 (54%), Positives = 220/317 (69%), Gaps = 12/317 (3%)

Query: 1   MAVIRIKKPRGPGEKDQPLEGEPKLKRIRIKTKVTDEDXXXXXXXXXXXXXXXXXXXXXX 60
           MAVI+IKKP+   E     EG PKLK+IRI                              
Sbjct: 1   MAVIKIKKPK-KNEGANESEG-PKLKKIRISA---------GNRKEEKEPKKLKINLKKT 49

Query: 61  XXXXXXXXXXXXXXXXXXXXIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI 120
                                 + P+LRLKPIRIPGE YDSEASD+EDDPLIESG+ILR+
Sbjct: 50  DVKKSGSVVKLKLGSKKEEKQSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRV 109

Query: 121 LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRK 180
           LPD+Q++F+KNS+ESGDY+GISIKWK ERHA++ +N+V YGAILVDLPT+IEVNKSVDRK
Sbjct: 110 LPDVQVDFIKNSIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRK 169

Query: 181 NLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNG 240
           NL KTFDV+QML+C++PI  E+E++ LEAP+TEDL+ KH+E   DEI ++K    K  N 
Sbjct: 170 NLFKTFDVTQMLVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANH 229

Query: 241 APL-SDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQ 299
             L S+ EAK+L+++ALK Y YKHG++PPLYNVRNRRFRR+M  +E +Y EK+VDMLLK 
Sbjct: 230 VNLHSETEAKNLEKLALKKYHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKA 289

Query: 300 DKQAEEVSYDLVDKSEL 316
           D QAE+V +DL+  S++
Sbjct: 290 DAQAEDVKFDLIAPSDV 306

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%)

Query: 439 RQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479
           RQHTELLADELNEL +TL HTK KL KATNPLLKSRF+DSI
Sbjct: 416 RQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSI 456

>KLLA0B08305g 737967..740174 some similarities with sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67 TFIID subunit
           (TBP-associated factor), 67 kD singleton, hypothetical
           start
          Length = 735

 Score =  343 bits (880), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 198/245 (80%), Gaps = 2/245 (0%)

Query: 81  IHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDYSG 140
           + K PK R+KP+R+PGE YDSEASD+EDDPLIE G+ILR+LPD+  EFVKNS+ESGDYS 
Sbjct: 139 VVKTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSD 198

Query: 141 ISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQE 200
           +SIKWK ERHAVV +N V YGA+LV+LP++IEVNKSVDRKNLLKTFDVSQML+C+R + +
Sbjct: 199 VSIKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNK 258

Query: 201 EEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYD 260
           EEEV++L+  DTEDL  KHFE  + EI E ++  L+GYNG PL+D E+K++++I  K YD
Sbjct: 259 EEEVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYD 318

Query: 261 YKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQARQ 320
           YKHGI+PPLYN RNRRFR +M P   DYVE+ V+ LLK D +AEE  Y+LV++  +Q  Q
Sbjct: 319 YKHGITPPLYNARNRRFRHRMGPTAFDYVERTVEKLLKLDAEAEEFGYELVNEDAIQ--Q 376

Query: 321 ERVSS 325
           +R +S
Sbjct: 377 QRSTS 381

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 32/40 (80%)

Query: 440 QHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479
           QH ELL DEL ELE+TL   ++K S+ TNPLLK+RF++SI
Sbjct: 540 QHRELLLDELRELESTLELNRNKASRTTNPLLKTRFLESI 579

>Kwal_26.9176
          Length = 551

 Score =  332 bits (852), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/237 (67%), Positives = 196/237 (82%)

Query: 83  KAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDYSGIS 142
           KAP+ R+KP+R+PGE YDSEASDIEDDPLIE GVILR+LPD+Q EFVKN +ESGD+SG+S
Sbjct: 83  KAPRFRIKPVRVPGEGYDSEASDIEDDPLIEEGVILRVLPDVQTEFVKNCIESGDFSGLS 142

Query: 143 IKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQEEE 202
           +KWK ERHAVV IN   YGA+LV+LPT IEVNKS+DRKNLLKTFDVSQMLLC+R I  EE
Sbjct: 143 LKWKGERHAVVKINGYQYGAVLVNLPTTIEVNKSIDRKNLLKTFDVSQMLLCVRTIDHEE 202

Query: 203 EVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYDYK 262
           EV++L  PD+EDLV KH++  ++EI E K+T  +G+NG PL+D EA ++  I  KGYDYK
Sbjct: 203 EVFSLVPPDSEDLVTKHYDEYKNEIIECKKTLYRGFNGGPLTDAEANNIDNIVKKGYDYK 262

Query: 263 HGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQAR 319
           HG++PPLYNVRNRRFRR++   E+DYVEK V+ LL+QD +AE VSYDLVD+  L  R
Sbjct: 263 HGLTPPLYNVRNRRFRRRLTTQEVDYVEKTVEHLLEQDAEAEGVSYDLVDEDILAQR 319

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/41 (75%), Positives = 34/41 (82%)

Query: 439 RQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479
           RQH+ELL DEL ELE+TL   K KL KATNPLLKSRFI+SI
Sbjct: 418 RQHSELLQDELEELESTLHQNKQKLEKATNPLLKSRFIESI 458

>AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH]
           (1444641..1446371) [1731 bp, 576 aa]
          Length = 576

 Score =  320 bits (820), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 158/251 (62%), Positives = 198/251 (78%)

Query: 81  IHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDYSG 140
           + KAP++R+KP RIPGE YDSEASDIEDDPL+E G+ILR+LPD+Q EFVKNS+ESGDYS 
Sbjct: 93  LTKAPRIRVKPPRIPGEGYDSEASDIEDDPLMEEGIILRVLPDLQAEFVKNSIESGDYSN 152

Query: 141 ISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQE 200
           ISIKWK ERHAVV+IN   YGA+LV+LPTVIEVNKSVDRKN+LK FDVSQMLLC+  I  
Sbjct: 153 ISIKWKGERHAVVSINGHQYGAVLVNLPTVIEVNKSVDRKNMLKAFDVSQMLLCVALISR 212

Query: 201 EEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYD 260
           EE+V+ L+ PDTEDLV KHFE  E EI + ++  ++G+ G  L+D E+KH+  I  KGYD
Sbjct: 213 EEDVFDLQPPDTEDLVKKHFENYEKEICDARKIMIQGFQGGSLTDAESKHMDAILEKGYD 272

Query: 261 YKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQARQ 320
           YKHGI+ PLYNVRNRRFRR+M  +EIDYV++ V+ LLKQD +AEE +Y+LVD+  +  + 
Sbjct: 273 YKHGITAPLYNVRNRRFRRRMTGSEIDYVDRTVEFLLKQDGEAEEFTYELVDEDAVLQKS 332

Query: 321 ERVSSWENFKE 331
                  +F +
Sbjct: 333 ASTIDLAHFAQ 343

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%)

Query: 440 QHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSI 479
           QH ELL DEL ELE+ L   + KL+KATNPLLKSRF+DSI
Sbjct: 439 QHNELLRDELGELESILQQNRDKLAKATNPLLKSRFVDSI 478

>Sklu_2271.3 YBR255W, Contig c2271 1824-3482 reverse complement
          Length = 552

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 261 YKH----GISPPLYNVRNRRFRRKMD---PNEIDYVEKVVDMLLKQDKQAEEVSYDLVDK 313
           Y+H    GI  PL  +RNR+ R+K     P ++ +V++ V  + K  K+  +V+  LVD 
Sbjct: 131 YQHEGVEGIYNPLQIIRNRKIRKKYHQPAPRKLTFVKEPVIAIKKFTKKPNQVTPWLVDI 190

Query: 314 SELQA-RQERVSSWENFKEEPGE 335
           +E  +    R   W+  K+  G+
Sbjct: 191 NERASDLTWRTLHWDELKKPDGK 213

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,062,631
Number of extensions: 539937
Number of successful extensions: 1511
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1538
Number of HSP's successfully gapped: 29
Length of query: 580
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 473
Effective length of database: 12,891,983
Effective search space: 6097907959
Effective search space used: 6097907959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)