Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR171C55054125460.0
CAGL0F07799g58049814360.0
Kwal_23.348850246112691e-171
Sklu_2101.356845412271e-163
Scas_669.1058550311941e-158
KLLA0D10065g46647911631e-155
ADL279W49348211591e-154
Sklu_2430.75393993292e-32
KLLA0B12760g5422433034e-29
YKL124W (SSH4)5792712841e-26
CAGL0M06545g5872472832e-26
Kwal_26.76655512642813e-26
ABL026W4802152705e-25
Scas_721.1265732452681e-24
AFR242C82361730.81
Scas_336.148668701.9
CAGL0I04114g91075692.5
Sklu_1477.257668692.5
Kwal_47.1917383635675.1
CAGL0C02255g64848665.5
Scas_712.2397366665.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR171C
         (541 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   985   0.0  
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   557   0.0  
Kwal_23.3488                                                          493   e-171
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           477   e-163
Scas_669.10                                                           464   e-158
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   452   e-155
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   451   e-154
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         131   2e-32
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   121   4e-29
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   114   1e-26
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   113   2e-26
Kwal_26.7665                                                          112   3e-26
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   108   5e-25
Scas_721.126                                                          107   1e-24
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    33   0.81 
Scas_336.1                                                             32   1.9  
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...    31   2.5  
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          31   2.5  
Kwal_47.19173                                                          30   5.1  
CAGL0C02255g complement(228009..229955) similar to sp|P40028 Sac...    30   5.5  
Scas_712.23                                                            30   5.5  

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/541 (89%), Positives = 485/541 (89%)

Query: 1   MSFKFXXXXXXXXXXXXQIRCGRSSVIPRGDVSYGGDDTDELNMDIMLFAFGTLXXXXXX 60
           MSFKF            QIRCGRSSVIPRGDVSYGGDDTDELNMDIMLFAFGTL      
Sbjct: 1   MSFKFLIESLLLGSISGQIRCGRSSVIPRGDVSYGGDDTDELNMDIMLFAFGTLIVVYIV 60

Query: 61  XXXXXFFTKQIATRLITAYYNEHGPGQRISLFSDYDENNAHVHSRRLMENMSLRWPNNLD 120
                FFTKQIATRLITAYYNEHGPGQRISLFSDYDENNAHVHSRRLMENMSLRWPNNLD
Sbjct: 61  ICIVYFFTKQIATRLITAYYNEHGPGQRISLFSDYDENNAHVHSRRLMENMSLRWPNNLD 120

Query: 121 DADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQ 180
           DADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQ
Sbjct: 121 DADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQ 180

Query: 181 TRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTEVSFLNYNYDASISTNLPIPCINKVYYC 240
           TRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTEVSFLNYNYDASISTNLPIPCINKVYYC
Sbjct: 181 TRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTEVSFLNYNYDASISTNLPIPCINKVYYC 240

Query: 241 EFKIFETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKL 300
           EFKIFETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKL
Sbjct: 241 EFKIFETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKL 300

Query: 301 NEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGS 360
           NEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGS
Sbjct: 301 NEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGS 360

Query: 361 NVPCQIHVNFGTYGFVYIEANVKKWGYAKSNGIKLPPPSYEDYGKDTLLXXXXXXXXXXX 420
           NVPCQIHVNFGTYGFVYIEANVKKWGYAKSNGIKLPPPSYEDYGKDTLL           
Sbjct: 361 NVPCQIHVNFGTYGFVYIEANVKKWGYAKSNGIKLPPPSYEDYGKDTLLESGGEDNDFDE 420

Query: 421 XXXXXXXXXIAAGSTTNLNDDIIIRNGEILPPPPGFEFTMSPPTGKKIINEEINLDSLPM 480
                    IAAGSTTNLNDDIIIRNGEILPPPPGFEFTMSPPTGKKIINEEINLDSLPM
Sbjct: 421 DFSDGDSDNIAAGSTTNLNDDIIIRNGEILPPPPGFEFTMSPPTGKKIINEEINLDSLPM 480

Query: 481 LPPSYSDDEHHSKNDKSAISGRIIGTSRNLITDEASFDSVXXXXXXXXXXXXXPEQFSEF 540
           LPPSYSDDEHHSKNDKSAISGRIIGTSRNLITDEASFDSV             PEQFSEF
Sbjct: 481 LPPSYSDDEHHSKNDKSAISGRIIGTSRNLITDEASFDSVDNDNEDENDHERDPEQFSEF 540

Query: 541 D 541
           D
Sbjct: 541 D 541

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/498 (58%), Positives = 354/498 (71%), Gaps = 29/498 (5%)

Query: 28  PRGDVSYGG------DDTDELNMDIMLFAFGTLXXXXXXXXXXXFFTKQIATRLITAYYN 81
           P  DV Y G      +  D+L++++M   FG++           F TK + TRL+T +  
Sbjct: 46  PAEDVPYPGTPDGYTNQDDQLDINVMFIYFGSMLVMYLCICIIYFTTKIVVTRLLTRH-- 103

Query: 82  EHGPGQRISLFSDYD-ENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYY 140
                 RISL ++          SRRL E+   RWP+ LDD +EV+ KL +LSPEEQFYY
Sbjct: 104 -----ARISLLNEEGMATGLSARSRRLAESAESRWPSALDDENEVKSKLQKLSPEEQFYY 158

Query: 141 KQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPD 200
           KQGEEYIKQNPP +++ G   +S D N   T  DPI+N+QTRQ+I+EEGA AWEF PNP+
Sbjct: 159 KQGEEYIKQNPPLIISTG--SRSGDQN---TVNDPIINDQTRQFIEEEGALAWEFQPNPN 213

Query: 201 MPNHTVIVENKTEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDENVSKG 260
           +PN T+IVENKTE+SFLNYNYDAS++TNLPIPCIN+VYYCEFKIFE    +  D+   K 
Sbjct: 214 LPNDTIIVENKTEISFLNYNYDASVTTNLPIPCINRVYYCEFKIFELS--ITDDQTTLKD 271

Query: 261 --VISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVG 318
             +ISFGLST PYPYFRLPGRHHHSIAYDSNGARRFNDSFKL  +L  LFP+C+KGDI+G
Sbjct: 272 NEIISFGLSTSPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLEPELADLFPKCQKGDIIG 331

Query: 319 IGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYI 378
           IGYR+RSGTVFFTRNGKK++EKSVGGHI+GWKF+YLYP++G+NVPC+IHVNFG+YGFV+I
Sbjct: 332 IGYRTRSGTVFFTRNGKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGSYGFVFI 391

Query: 379 EANVKKWGYAKSNGIKLPPPSYEDYGKDTLLXXXXXXXXXXXXXXXXXXXXIAAGSTTNL 438
           EANVKKWGYAK NGIKLPPPSY+DY +DTLL                           ++
Sbjct: 392 EANVKKWGYAKPNGIKLPPPSYDDYVQDTLLESGYEDNDNSDNDSDDESDTDNRRQHRSI 451

Query: 439 NDDIIIRNGEILPPPPGFEFTMSPPTGKKIINEEINLDSLPMLPPSYSDDEHHSKND-KS 497
            + II  +G +LPPPPGFEF+ SP +     NEEINLDSLPM PPSYSD+E  SKN  KS
Sbjct: 452 KNTIIDIDGNLLPPPPGFEFSTSPHSHG--TNEEINLDSLPMNPPSYSDEE--SKNQVKS 507

Query: 498 AISGR-IIGTSRNLITDE 514
            I+ R  +G S  L  DE
Sbjct: 508 KITPRDSVGRSDGLTQDE 525

>Kwal_23.3488
          Length = 502

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 249/461 (54%), Positives = 317/461 (68%), Gaps = 43/461 (9%)

Query: 30  GDVSYGGDDTDELNMDIMLFAFGTLXXXXXXXXXXXFFTKQIATRLITAYYNEHGPGQRI 89
           G   Y GD  D+L++ +M+F+   +              K +  R     Y   G    I
Sbjct: 40  GSGPYDGDYEDDLDIGLMMFSLAFMVFSYFALTLVYLVVKFLLRR-----YFRTG----I 90

Query: 90  SLFSDYDENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQ 149
           SL        +   SR +   ++ RWP+ LDDAD VRDKLA++S EEQFYYKQGEE+IKQ
Sbjct: 91  SL--------SEGESRVIGPAVNARWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQ 142

Query: 150 NPPFLLNQGLLQQSEDSNPDTTRE-DPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIV 208
           NPP LL         D +P      DPI+NEQT Q+I EEGA+AWEF P+P +PN +V+V
Sbjct: 143 NPPLLL--------PDRSPVGAETVDPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLV 194

Query: 209 ENKTEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDENVSKGVISFGLST 268
           ENK+E++FLNYNYD S+ TNLPIP +N+VYYCEFKIFE +   +++ +    ++SFGLST
Sbjct: 195 ENKSEITFLNYNYDVSVMTNLPIPRLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLST 254

Query: 269 QPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTV 328
            PYPYFRLPGRHHHSIAYDS G RRFNDSF+L+ +L ++FP+CEKGD++GIGYR+ SGTV
Sbjct: 255 SPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTV 314

Query: 329 FFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYA 388
           FFTRNGKKLNEKS+GGHI+GWKF+Y+YPI+GSN+PC++HVNFGTYGFV+IEANVKKWGYA
Sbjct: 315 FFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYA 374

Query: 389 KSNGIKLPPPSYEDYGKDTLLXXXXXXXXXXXXXXXXXXXXIAAGSTTNLNDDIIIRNGE 448
           KSNG+KLPPPSYEDY +D LL                        ST+ ++ DII   G 
Sbjct: 375 KSNGMKLPPPSYEDYSQDVLLESSYEDDATDNE------------STSTIDGDIIDSEGH 422

Query: 449 ILPPPPGFEFTMSP-PTGKKIINEEINLDSLPMLPPSYSDD 488
           +LPPPPGFE+++SP P+       +  L+SLP  PP Y+ D
Sbjct: 423 LLPPPPGFEYSVSPQPSAAG----QFTLNSLPPEPPRYASD 459

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  477 bits (1227), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 238/454 (52%), Positives = 316/454 (69%), Gaps = 38/454 (8%)

Query: 37  DDTDELNMDIMLFAFGTLXXXXXXXXXXXFFTKQIATRLITAYYNEHGPGQRISLFSDYD 96
           D  D+++M ++ F+   +           F  + +  +  +          RISL     
Sbjct: 95  DYEDDMDMAMLFFSMAFMLLSYILLTLIYFSVRFVIKKYFST---------RISL----- 140

Query: 97  ENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPFLLN 156
            NN   + R    N    WP++LDD + V+DKL +LSPEEQFYYKQGEEYIKQNPP L+ 
Sbjct: 141 NNNNSPNIRTTTSN---SWPSSLDDEEAVKDKLVKLSPEEQFYYKQGEEYIKQNPPLLIP 197

Query: 157 QGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTEVSF 216
                +SEDS       DPI+N+QT ++I+EEG +AWEF P+P++PN T+++ENKTE++F
Sbjct: 198 H----RSEDSQ---GMLDPIINDQTIRFIEEEGVHAWEFQPDPNLPNDTILIENKTEITF 250

Query: 217 LNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDENVSKG-VISFGLSTQPYPYFR 275
           LNYNYDAS+ TNLP+P +N+VYY E KIFE +   + +  +S   +ISFGLS+ PYPYFR
Sbjct: 251 LNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFR 310

Query: 276 LPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGK 335
           LPGRHHHSIAYDS G RRFNDSF+L+ +L ++FP+ +KGDI+GIGYR+ SGTVFFTRNGK
Sbjct: 311 LPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGK 370

Query: 336 KLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAKSNGIKL 395
           KLNEK +GGHI+GWK +YLYPI+G+NVPC++HVNFG+YGFV+IEANVKKWGYAKS+G+KL
Sbjct: 371 KLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEANVKKWGYAKSHGVKL 430

Query: 396 PPPSYEDYGKDTLLXXXXXXXXXXXXXXXXXXXXIAAGSTTNLNDDIIIRNGEILPPPPG 455
           PPPSY++YG+D LL                        S + +  DI+  +GE+LPPPPG
Sbjct: 431 PPPSYDEYGQDVLLESSYEDDITDNE------------SVSTVEGDIVDSDGELLPPPPG 478

Query: 456 FEFTMSPPTGKKIINEEINLDSLPMLPPSYSDDE 489
           FEF+ +P + +  I ++I LDSLP  PPSYS D+
Sbjct: 479 FEFSTTPQS-RGNIGDQITLDSLPAQPPSYSSDD 511

>Scas_669.10
          Length = 585

 Score =  464 bits (1194), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 249/503 (49%), Positives = 325/503 (64%), Gaps = 25/503 (4%)

Query: 34  YGGDDTDELNMDIMLFAFGTLXXXXXXXXXXXFFTKQIATRLITAYYNEHGPGQRISLFS 93
           Y  D  ++++  +MLF+  T+              K + TR++T+  +      R  +  
Sbjct: 42  YEDDKDEDVDFHVMLFSLITMIIIYVLVILVYIVVKFVVTRMLTSNISRISLLNRTEVEE 101

Query: 94  DYDENNAHVHSRRLMENMSLRW--PNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNP 151
               NN      R       R+   + LDD + V+ KL+ L+PEEQFYYKQGEE+IKQNP
Sbjct: 102 STRTNNEGTGRSRRSTRRDQRFDLESFLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQNP 161

Query: 152 PFLLNQGLLQQ-----SEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTV 206
           P ++            + DSN +   +DPIMN QT+Q+I+EEGA AWEF  +P++PN T+
Sbjct: 162 PIIIPPNNNNNSNDISTTDSNAE---DDPIMNHQTKQFIEEEGASAWEFQADPNLPNDTI 218

Query: 207 IVENKTEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDENVSKGVISFGL 266
           ++ENKTE++FLNYNYDAS+ TNLPIPCIN+VYYCEFKIFE +            VIS GL
Sbjct: 219 LIENKTEITFLNYNYDASVMTNLPIPCINRVYYCEFKIFELNNSPEQTNLSPNEVISMGL 278

Query: 267 STQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSG 326
           +T PYPYFRLPGRHHHSIAYDSNGARRFNDSF L+ +L  LFP CE+GDI+G+GYR+RSG
Sbjct: 279 ATSPYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSG 338

Query: 327 TVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWG 386
           T FFTRNGKK++EKS+GGHI+G K +YLYPI+G+NVPC++HVNFGTYGFVYIEANVKKWG
Sbjct: 339 TFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWG 398

Query: 387 YAKSNGIKLPPPSYEDYGKDTL----------LXXXXXXXXXXXXXXXXXXXXIAAGSTT 436
           YAKS+G+K+PPPSYE+YGKD L          +                        +TT
Sbjct: 399 YAKSHGLKVPPPSYEEYGKDALVGSYQDLEDGINDEEEDYEDEEEEDEEEDYDEEDDNTT 458

Query: 437 NLNDDIIIRNGEILPPPPGFEFTMSPPTG-KKIINEEINLDSLPMLPPSYSDDEHHSKND 495
              D +    G++LPPPPGFEF+ SP +   +   E+INL+SLP  PP YS D  +  N 
Sbjct: 459 TETDPLRDEYGQLLPPPPGFEFSTSPLSNFGQNEEEDINLNSLPYDPPRYSQDVSNRTNS 518

Query: 496 KSAISGRIIGTSRNLITDEASFD 518
            +   GR    S++ I ++AS+D
Sbjct: 519 FTLDEGR----SKDFIENDASWD 537

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  452 bits (1163), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 239/479 (49%), Positives = 311/479 (64%), Gaps = 41/479 (8%)

Query: 32  VSYGGDDTDELNMDIMLFAFGTLXXXXXXXXXXXFFTKQIATRLITAYYNEHGPGQRISL 91
           VS G  D D ++MD+++F    +           F T+ +  RL TA  + H  G     
Sbjct: 26  VSEGPSDPD-VDMDLIVFTMMFMFLSYLLSILVYFVTRWLVKRLFTARISLHEEGTMNGG 84

Query: 92  FSDYDENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNP 151
            SD  E+                    LDD  EV++ L  LSP+EQFYYKQGEEY+KQNP
Sbjct: 85  QSDLSEDRY------------------LDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNP 126

Query: 152 PFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVENK 211
           P L+       ++  N +    DPI+NEQT Q+I+EEGA AWEF  +P++PN TV+++ +
Sbjct: 127 PLLVP---YLPNDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQER 183

Query: 212 TEVSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSDEN--VSKGVISFGLSTQ 269
           TE++FLN++YDAS+ T LPIP +NKVYY E KIFE    LN  +N      +IS GLST 
Sbjct: 184 TELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFE----LNQGKNHLSDNEMISIGLSTS 239

Query: 270 PYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVF 329
           PYPYFRLPGRHHHSI+YDS+G RR N SF ++ +L+TLFP+ EKGD++GIGYR+RSGT+F
Sbjct: 240 PYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIF 299

Query: 330 FTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAK 389
           FT NGKKLNEK VGGHI+GWK +YLYPI+GSN+PC+IHVNFGTYGFVYIEANVKKWGY+K
Sbjct: 300 FTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSK 359

Query: 390 SNGIKLPPPSYEDYGKDTLLXXXXXXXXXXXXXXXXXXXXIAAGSTTNLNDDIIIRNGEI 449
           + GIKLPPPSYEDY +D LL                      + ++ ++N+ I  ++G I
Sbjct: 360 NAGIKLPPPSYEDYDQDVLLESAFEDDVSDS----------ESITSDSINEQITDQSGNI 409

Query: 450 LPPPPGFEFTMSPPTGKKIINEEINLDSLPMLPPSYSDDEHHSKN-DKSAISGRIIGTS 507
           LPPPPGFEF+ S      I  E I + SLP  PP+YS DE    N + + I+ + + T+
Sbjct: 410 LPPPPGFEFSTS--VASDIPVESITMHSLPAEPPNYSADEDEEHNVEDNTIANQFVATT 466

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  451 bits (1159), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 242/482 (50%), Positives = 310/482 (64%), Gaps = 51/482 (10%)

Query: 38  DTDELNMDIMLFAFGTLXXXXXXXXXXXFFT--KQIATRLITAYYNEHGPGQRISLFSDY 95
           D +EL+MD +LF F  +            +   + +  R  T         +RI+L S  
Sbjct: 33  DDNELDMDFVLFTFSLVFMLLCYGMMVLIYLGLRYVVRRCFT---------RRIALSSSD 83

Query: 96  D--ENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPF 153
               N+  V             P  LDD  EVR KLAQLSPEEQFYYKQGEE+IKQNPP 
Sbjct: 84  SSRANSGDV-------------PTVLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPA 130

Query: 154 LLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTE 213
           L+    +             DP++N+QT +YI+EEGA AWEF P+P +P   V VEN+TE
Sbjct: 131 LMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTE 190

Query: 214 VSFLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSD-ENVSKG-VISFGLSTQPY 271
           ++F+N N D S++TNLPIP  NKVYY E KIFE    L     ++S+  ++SFGL+T PY
Sbjct: 191 LTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPY 250

Query: 272 PYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFT 331
           PYFRLPGRHHHS+AYDSNGARR N+SFKL ++L +LFP+CEKGD++GIGYR+RSGTVFFT
Sbjct: 251 PYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFT 310

Query: 332 RNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAKSN 391
           RNGKKLNEK +GGHI+GWK +YLYPI+G+NVPC+IHVNFGTYGFVYIEANVKKWGYAK N
Sbjct: 311 RNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLN 370

Query: 392 GIKLPPPSYEDYGKDTLLXXXXXXXXXXXXXXXXXXXXIAAGSTTNLNDDIIIRNGEILP 451
           G+KLPPP+YEDY +D LL                    ++ G T +  +   + +G +LP
Sbjct: 371 GMKLPPPAYEDYDRDVLL-------------ESSYEDEVSEGETNSFVEH--LHDGHLLP 415

Query: 452 PPPGFEFTMSPPTGKKIINEEINLDSLPMLPPSYSDDEHHSKNDKSAISGRIIGTSRNLI 511
           PPPGFEF+ +P +      ++  L++LP  PP Y  D     N  S  +GR +G S N+ 
Sbjct: 416 PPPGFEFSTTPTSN----CDQFTLNTLPTEPPGYMSD----VNAGSKHNGRGVGRSENVQ 467

Query: 512 TD 513
           +D
Sbjct: 468 SD 469

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  131 bits (329), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 114/399 (28%), Positives = 171/399 (42%), Gaps = 112/399 (28%)

Query: 93  SDYDENNAHVHS-------RR-----LMENMSLRWPNNLDDADEV--------RDKLAQL 132
           SDYDE     H        RR     L  + S   P   DD   V        +DK ++ 
Sbjct: 72  SDYDEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKFDDEQAVQEQEDECFKDKFSKF 131

Query: 133 SPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYA 192
             E    Y++ +E+ K NPP + + G     +D                +Q I++ G  +
Sbjct: 132 EIE---LYQRAKEFQKVNPPIVKSFGTYTPLKD----------------KQLIKDRGIQS 172

Query: 193 WEFSP----NPDMPNH---TVIVENKTEVSFLNYNYDASISTNLPIPCINK-VYYCEFKI 244
           + F P    N D   +   + ++++K ++ F  YN  +S   N P+P   K   Y E K+
Sbjct: 173 YYFLPSINDNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKV 232

Query: 245 FETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQL 304
           F+     NS       + + GL T PYPYFR+PG + HSIAY+S G  R ++ F  N   
Sbjct: 233 FKYPSKSNS-------IFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYAN--- 282

Query: 305 RTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKK---------------------------- 336
            TL P+ E+GD+VG GYR RSGT+F T NGKK                            
Sbjct: 283 -TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYT 341

Query: 337 ------------LNEKSVGGHIR---------GWKFQYLYPIIGSNVP---CQIHVNFGT 372
                       L+E+ V   +            + + ++     ++P    ++ VN G 
Sbjct: 342 LEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQ 401

Query: 373 YGFVYIEANVKKWGYAKSNGIKLPPPSY--EDYGKDTLL 409
            GFV+IEANVKK+ +    G    PPSY  ++  +DT+L
Sbjct: 402 LGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVL 440

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  121 bits (303), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 122/243 (50%), Gaps = 39/243 (16%)

Query: 107 LMENMSLRWPNNLDDADEVR----DKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQ 162
           L+ + S   P   DD + ++     +L ++S  E   Y++ +E+ K +PP +   G    
Sbjct: 96  LLLDSSFMTPGKFDDDESLKVREAKELPKMSSFEVELYERTKEFQKMSPPMVKPLG---- 151

Query: 163 SEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSP----NPDMPNH---TVIVENKTEVS 215
                         +N Q +Q I++ G  ++ F P    N D+      +  VE+K  VS
Sbjct: 152 ------------SFLNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLPSFFVEDKLNVS 199

Query: 216 FLNYNYDASISTNLPIPCINK-VYYCEFKIFETDGPLNSDENVSKGVISFGLSTQPYPYF 274
           F  +N  +S   N P+P   K   Y E K+++        +  S  + S GL T PYPYF
Sbjct: 200 FTKFNISSSAIMNYPLPMNKKDAVYFEVKVYKF-------KTCSNSIFSIGLMTCPYPYF 252

Query: 275 RLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNG 334
           R+PG   +SIAY+S G  R N++F  +    TL P+ E+GD+VG GYR  SGT+F T NG
Sbjct: 253 RIPGTAAYSIAYESTGKLRINNAFGAD----TLLPKLEEGDVVGFGYRYSSGTIFITHNG 308

Query: 335 KKL 337
           KK+
Sbjct: 309 KKM 311

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 364 CQIHVNFGTYGFVYIEANVKKWGYAKSNGIKLPPPSY--EDYGKDTLL 409
            ++HVN G  GFV+IEANVKK+ +    G    PP+Y  +D  +D LL
Sbjct: 397 IELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDMLL 444

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  114 bits (284), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 132/271 (48%), Gaps = 54/271 (19%)

Query: 93  SDYDENNA--------------HVHSRRLMENMSLRWPNNLDDADEVRDK----LAQLSP 134
           S+YDE NA                HS  L+++ S   P   DD   ++++    L ++S 
Sbjct: 77  SEYDEENALGTRTSGTLHSLFGKKHSGILLDS-SFASPGGFDDEIVLQERELEELPKMSA 135

Query: 135 EEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWE 194
            E   Y + +E+   +PP + + G    S+D                +Q+I++ G  ++ 
Sbjct: 136 YEVELYIRAKEFQMMSPPMVKDFGTYLDSDD----------------QQFIKDRGIQSYF 179

Query: 195 FSP--NPDMPNH-----TVIVENKTEVSFLNYNYDASISTNLPIPCINK-VYYCEFKIFE 246
             P  N ++  +     + IV++K ++ F  +N  +S   N P+P   K   Y E KIF 
Sbjct: 180 LLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFR 239

Query: 247 TDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRT 306
                NS       + S GL+T PYPYFR+PG   +SIAY+S G  R N+ F  +    T
Sbjct: 240 HIQKSNS-------IFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTAS----T 288

Query: 307 LFPQCEKGDIVGIGYRSRSGTVFFTRNGKKL 337
           L P+ E+GD VG GYR ++GT+F T NGKKL
Sbjct: 289 LLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 121/247 (48%), Gaps = 39/247 (15%)

Query: 103 HSRRLMENMSLRWPNNLDDADEV----RDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQG 158
           +S  L+ + +   P   DD +E     R+ L ++SP E   Y + +E+   +PP +   G
Sbjct: 96  NSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFG 155

Query: 159 LLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSP----NPDMPNH---TVIVENK 211
               S+D                 Q I++ G  ++ F P    N D   H   + +V++K
Sbjct: 156 TYLDSKD----------------LQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDK 199

Query: 212 TEVSFLNYNYDASISTNLPIPCINK-VYYCEFKIFETDGPLNSDENVSKGVISFGLSTQP 270
            EV F  +N  +S   N P+P   K   Y E K++      N   N S  + S GL T P
Sbjct: 200 LEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVY------NHKPN-SNSIFSIGLVTVP 252

Query: 271 YPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFF 330
           YPYFR+PG    SIAY+S G  R ND F  +    TL P+  +GD+VG GYR ++GT+F 
Sbjct: 253 YPYFRIPGMCKFSIAYESTGKLRINDPFFPS----TLLPKLVEGDVVGFGYRFKTGTIFI 308

Query: 331 TRNGKKL 337
           T NGKKL
Sbjct: 309 THNGKKL 315

>Kwal_26.7665
          Length = 551

 Score =  112 bits (281), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 127/264 (48%), Gaps = 46/264 (17%)

Query: 93  SDYDENNAHV-----HSRR--LMENMSLRWPNNLDDADEVRDK----LAQLSPEEQFYYK 141
           S+YDE  A         +R  ++ + S   P   DD   + ++    L ++S  E   Y+
Sbjct: 108 SEYDEEVASAIPNMFRKKRSGVLLDGSFLTPGQFDDEHALLEQEAVELPRMSRFEVELYQ 167

Query: 142 QGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNP-D 200
           +  E+ K  PP +   G    + D                +Q+I++ G  ++ F P+  D
Sbjct: 168 RCREFQKMCPPNVTEFGTYTSASD----------------KQFIKDRGVQSYYFLPSIND 211

Query: 201 MPNH------TVIVENKTEVSFLNYNYDASISTNLPIPCINK-VYYCEFKIFETDGPLNS 253
             +H      + IV++K +V F  +N  AS   N P+P   K   Y E K+F+     NS
Sbjct: 212 NVDHYGNFLPSFIVQDKLDVLFTKFNRSASTIMNYPLPQNKKEAVYFEVKVFKFPAKSNS 271

Query: 254 DENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEK 313
                  + S GL T PYPYFR+PG    SIAY+S G  R N+ F  N    TL P+ ++
Sbjct: 272 -------IFSCGLVTCPYPYFRIPGMAQFSIAYESTGKLRMNNPFYAN----TLLPKLQE 320

Query: 314 GDIVGIGYRSRSGTVFFTRNGKKL 337
           GD++G GYR ++GT+  T NGKKL
Sbjct: 321 GDVIGFGYRYKTGTILITHNGKKL 344

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  108 bits (270), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 109/215 (50%), Gaps = 33/215 (15%)

Query: 131 QLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGA 190
           ++S  E   Y + +E+   NPP +   G     ED                RQ +++ G 
Sbjct: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPED----------------RQCVRDRGI 104

Query: 191 YAWEFSP----NPDMPNH---TVIVENKTEVSFLNYNYDASISTNLPIPCINK-VYYCEF 242
            A+   P    N D   +   + +V++K  V+F  YN  +S   N P+P   +   Y E 
Sbjct: 105 QAYYLLPSINDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEV 164

Query: 243 KIFETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNE 302
           K+++    L S+      + S GL T PYPYF +PG   +SIAY+S G  R N+SF  + 
Sbjct: 165 KVYKFRNYLASNS-----IFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS- 218

Query: 303 QLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKL 337
              TL P+ ++GD+VG+GYR R+GTVF T NGKK+
Sbjct: 219 ---TLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250

>Scas_721.126
          Length = 573

 Score =  107 bits (268), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 119/245 (48%), Gaps = 43/245 (17%)

Query: 107 LMENMSLRWPNNLDDADEVRDK----LAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQ 162
           ++ + S   P   DD  E +++    L ++SP E   YK+  E+ +  PP +   G   +
Sbjct: 103 ILLDSSFTSPGQFDDECEHQEREHTELNRMSPFELELYKRSNEFQEVAPPHIDEFGTYLK 162

Query: 163 SEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPD---------MPNHTVIVENKTE 213
           + D                 Q I++ G  ++   P+ +         +P  + ++++K +
Sbjct: 163 ATD----------------LQVIKDRGIQSYFLLPSINDNVNKQGNFLP--SFLIQDKLD 204

Query: 214 VSFLNYNYDASISTNLPIPCINK-VYYCEFKIFETDGPLNSDENVSKGVISFGLSTQPYP 272
           + F  YN  +S   N P+P   +   Y E K+F+        + VS  + S GL T PYP
Sbjct: 205 MVFTKYNKSSSTVMNYPLPYTKRDAVYFEVKVFK-------HQPVSNTIFSIGLVTVPYP 257

Query: 273 YFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTR 332
           YFR+PG    SIAY+S G  R N+ F  +    TL P+  +GD+VG GYR  SGT+F T 
Sbjct: 258 YFRIPGMAKFSIAYESTGKLRINNPFMAS----TLLPKLVEGDVVGFGYRYSSGTIFITH 313

Query: 333 NGKKL 337
           NGKKL
Sbjct: 314 NGKKL 318

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 313 KGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGT 372
           + D++G G     GT+FFT+NG  L     G   +      L P +       I  NFG 
Sbjct: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458

Query: 373 Y 373
           Y
Sbjct: 459 Y 459

>Scas_336.1
          Length = 486

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 196 SPNPDMPNHTVIVENKTEVSFLNYNYDASISTNLPIPCINKVYYC-EFKIFETDGPLNSD 254
           +PNPD P++   + ++ E S      +  +  ++  PCI K+Y   + K FET  PL+S 
Sbjct: 205 APNPDSPSYKDTL-SRLESSL---TRELDVLKSISHPCIIKLYAINDLKFFETKRPLSSR 260

Query: 255 ENVSKGVI 262
           ++  KG +
Sbjct: 261 KHGDKGFL 268

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 7/75 (9%)

Query: 313 KGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGT 372
           + D++G G    +G+VFFT+NG  L     G  +         P I       +  NFG 
Sbjct: 504 RDDVIGCGINYVNGSVFFTKNGVFL-----GEAVSSLMNVNAIPYIALKSGNSVRTNFGL 558

Query: 373 Y-GFVY-IEANVKKW 385
           Y  FV+ I    K W
Sbjct: 559 YEEFVFDINQYQKNW 573

>Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement
          Length = 576

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 196 SPNPDMPNHTVIVENKTEVSFLNYNYDASISTNLPIPCINKVYYC-EFKIFETDGPLNSD 254
           +PNPD P++   + ++ E S      +  +  ++  PCI K+Y   + K FET  PL+S 
Sbjct: 295 APNPDSPSYKDTL-SRLESSL---TRELDVLKSISHPCIIKLYAINDLKFFETKRPLSSR 350

Query: 255 ENVSKGVI 262
           ++  KG +
Sbjct: 351 KHGDKGFL 358

>Kwal_47.19173
          Length = 836

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 303 QLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKL 337
           Q +    Q  + D++G G     GT+FFT+NG  L
Sbjct: 431 QYKIYGKQYGRNDVIGCGVNYVDGTIFFTKNGLHL 465

>CAGL0C02255g complement(228009..229955) similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1, start by
           similarity
          Length = 648

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 8/48 (16%)

Query: 321 YRSRSGTVFFTRNGKKLNEKSVGGHIRGW-----KFQYLYPIIGSNVP 363
           Y   +G   F RN + L  K    + RGW      F Y+YPII  NVP
Sbjct: 324 YCQDNGRELFGRNYRILLSKE---NFRGWPEPYIVFHYIYPIIDKNVP 368

>Scas_712.23
          Length = 973

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 15/66 (22%)

Query: 313 KGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLY-----PIIGSNVPCQIH 367
           + DI+G G     GT+FFT+NG  L          G  F  +Y     P I       + 
Sbjct: 582 RDDIIGCGINYIDGTIFFTKNGVFL----------GTAFTNVYDLNVVPSIALKPGNSVR 631

Query: 368 VNFGTY 373
            NFG Y
Sbjct: 632 TNFGIY 637

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,518,591
Number of extensions: 861231
Number of successful extensions: 2428
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2455
Number of HSP's successfully gapped: 42
Length of query: 541
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 435
Effective length of database: 12,926,601
Effective search space: 5623071435
Effective search space used: 5623071435
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)