Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR169C (ALD3)50649825170.0
YMR170C (ALD2)50649823370.0
KLLA0D09999g50149616950.0
Kwal_23.350750249616930.0
CAGL0F07777g50449816580.0
Scas_669.950349515910.0
AFL201W49749814770.0
Kwal_23.350050349710971e-145
KLLA0D10021g50349410691e-141
KLLA0C07777g51449510411e-137
Sklu_2369.551448410391e-136
Kwal_23.591153848410301e-135
CAGL0D06688g52449610271e-134
Kwal_26.675252249610211e-134
Sklu_2427.251849610161e-133
Scas_701.1451548410121e-132
KLLA0F00440g52249610101e-132
KLLA0E23144g50748410061e-132
YER073W (ALD5)52048310071e-132
CAGL0J03212g51748410061e-131
ACL044W51348510011e-131
YOR374W (ALD4)5194929971e-130
Scas_663.45204969821e-128
CAGL0H05137g4974929721e-127
ADR417W5074969711e-126
Sklu_2315.35014849701e-126
Scas_664.244994859641e-125
Kwal_27.119765264849601e-124
YPL061W (ALD6)5005059041e-116
KLLA0F12628g5044876473e-78
Sklu_2087.35064356273e-75
YBR006W (UGA2)4974816176e-74
AER007W4954376036e-72
Scas_716.634944805844e-69
CAGL0C04191g4914975826e-69
KLLA0E17545g4974275696e-67
Kwal_56.231064954805522e-64
AAL075W6375003962e-41
Kwal_23.56996414413883e-40
YHR039C (MSC7)6444823786e-39
KLLA0C10615g6404823733e-38
CAGL0F08965g6394873733e-38
Scas_690.266514913541e-35
CAGL0D03982g5745113493e-35
KLLA0C10549g5764023388e-34
AAL071C5735033342e-33
Kwal_23.57145763983291e-32
CAGL0K03509g5274203272e-32
Scas_717.745223293235e-32
Scas_690.415813513193e-31
KLLA0B12540g5213403131e-30
YHR037W (PUT2)5754103141e-30
Kwal_26.75955243492972e-28
YMR110C5324312492e-22
CAGL0L02123g1030130692.5
KLLA0F03168g51838656.6
CAGL0L12210g298184658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR169C
         (498 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasm...   974   0.0  
YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde ...   904   0.0  
KLLA0D09999g complement(844368..845873) highly similar to sp|P47...   657   0.0  
Kwal_23.3507                                                          656   0.0  
CAGL0F07777g complement(758205..759719) similar to sp|P47771 Sac...   643   0.0  
Scas_669.9                                                            617   0.0  
AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C (...   573   0.0  
Kwal_23.3500                                                          427   e-145
KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida ...   416   e-141
KLLA0C07777g complement(682962..684506) highly similar to sp|P40...   405   e-137
Sklu_2369.5 YER073W, Contig c2369 5264-6808                           404   e-136
Kwal_23.5911                                                          401   e-135
CAGL0D06688g 639883..641457 highly similar to sp|P46367 Saccharo...   400   e-134
Kwal_26.6752                                                          397   e-134
Sklu_2427.2 YOR374W, Contig c2427 1739-3295                           395   e-133
Scas_701.14                                                           394   e-132
KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomy...   393   e-132
KLLA0E23144g complement(2052418..2053941) highly similar to sp|P...   392   e-132
YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehy...   392   e-132
CAGL0J03212g 307754..309307 highly similar to sp|P40047 Saccharo...   392   e-131
ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH] complement(...   390   e-131
YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial ald...   388   e-130
Scas_663.4                                                            382   e-128
CAGL0H05137g complement(495715..497208) highly similar to sp|P54...   379   e-127
ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH] complement(...   378   e-126
Sklu_2315.3 YPL061W, Contig c2315 5950-7455                           378   e-126
Scas_664.24                                                           375   e-125
Kwal_27.11976                                                         374   e-124
YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldeh...   352   e-116
KLLA0F12628g complement(1170396..1171910) similar to sp|P38067 S...   253   3e-78
Sklu_2087.3 , Contig c2087 4336-5856                                  246   3e-75
YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyd...   242   6e-74
AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH] complement(...   236   6e-72
Scas_716.63                                                           229   4e-69
CAGL0C04191g complement(409544..411019) highly similar to sp|P38...   228   6e-69
KLLA0E17545g 1553982..1555475 highly similar to sp|P38067 Saccha...   223   6e-67
Kwal_56.23106                                                         217   2e-64
AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH] complement(2...   157   2e-41
Kwal_23.5699                                                          154   3e-40
YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein wi...   150   6e-39
KLLA0C10615g complement(912077..913999) similar to sp|P38694 Sac...   148   3e-38
CAGL0F08965g complement(880296..882215) highly similar to sp|P38...   148   3e-38
Scas_690.26                                                           140   1e-35
CAGL0D03982g 397039..398763 highly similar to sp|P07275 Saccharo...   139   3e-35
KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1 Kluyverom...   134   8e-34
AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH] (223170..224...   133   2e-33
Kwal_23.5714                                                          131   1e-32
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...   130   2e-32
Scas_717.74                                                           129   5e-32
Scas_690.41                                                           127   3e-31
KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces...   125   1e-30
YHR037W (PUT2) [2324] chr8 (181969..183696) Delta-1-pyrroline-5-...   125   1e-30
Kwal_26.7595                                                          119   2e-28
YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protei...   100   2e-22
CAGL0L02123g complement(246322..249414) similar to sp|P18480 Sac...    31   2.5  
KLLA0F03168g 294261..295817 similar to sgd|S0005479 Saccharomyce...    30   6.6  
CAGL0L12210g complement(1312969..1321914) similar to tr|Q12150 S...    30   8.5  

>YMR169C (ALD3) [4124] chr13 complement(599351..600871) Cytoplasmic,
           stress inducible aldehyde dehydrogenase, probable
           isoform of Ald2p [1521 bp, 506 aa]
          Length = 506

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/498 (95%), Positives = 477/498 (95%)

Query: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXX 60
           MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQ       
Sbjct: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV 60

Query: 61  XXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD 120
                         WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD
Sbjct: 61  DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD 120

Query: 121 LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ 180
           LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ
Sbjct: 121 LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ 180

Query: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK 240
           GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK
Sbjct: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK 240

Query: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ 300
           ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ
Sbjct: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ 300

Query: 301 ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360
           ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY
Sbjct: 301 ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360

Query: 361 IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY 420
           IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY
Sbjct: 361 IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY 420

Query: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI 480
           DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI
Sbjct: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI 480

Query: 481 GRESGDTGVDNYLQIKSV 498
           GRESGDTGVDNYLQIKSV
Sbjct: 481 GRESGDTGVDNYLQIKSV 498

>YMR170C (ALD2) [4125] chr13 complement(601561..603081) Aldehyde
           dehydrogenase (NAD(P)+), likely cytosolic [1521 bp, 506
           aa]
          Length = 506

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/498 (87%), Positives = 460/498 (92%)

Query: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXX 60
           MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQ       
Sbjct: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV 60

Query: 61  XXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD 120
                         WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKP+HSNAK D
Sbjct: 61  DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGD 120

Query: 121 LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ 180
           LAQI++LTRY+AG+ DKF+ G TIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMAC K+Q
Sbjct: 121 LAQILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQ 180

Query: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK 240
           GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVN++PGYGS+VG+AL +HMDIDK
Sbjct: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDK 240

Query: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ 300
           ISFTGSTKVGG VLEASGQSNLKD+TLECGGKSPALVFEDADLDKAI+W+A GIF+NSGQ
Sbjct: 241 ISFTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQ 300

Query: 301 ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360
            CTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY
Sbjct: 301 NCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360

Query: 361 IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY 420
           IERGK+EEKLDMFQTSEFPIGGAKGYFIPPTIFTDVP+TSKLL+DEIFGPVVVVSKFTNY
Sbjct: 361 IERGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNY 420

Query: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI 480
           DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWIN +N E+  VPFGGFKMSGI
Sbjct: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGI 480

Query: 481 GRESGDTGVDNYLQIKSV 498
           GRE G +GVD YLQ K+V
Sbjct: 481 GRELGQSGVDTYLQTKAV 498

>KLLA0D09999g complement(844368..845873) highly similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 aldehyde
           dehydrogenase 2 (NAD+), start by similarity
          Length = 501

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/496 (62%), Positives = 379/496 (76%), Gaps = 3/496 (0%)

Query: 3   TLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXX 62
           +LY  + IPQL I+ +QPLGLFINNEF  SSDGK IE++NP+T E I SF          
Sbjct: 2   SLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPSTEESIVSFFAASEKDVNS 61

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       WSKTS EQRGI LS L  LIE ++  LAA+ETLD+GKP+HSN+  DL 
Sbjct: 62  AVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAAIETLDSGKPYHSNSLADLE 121

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
           QI++LTRYYAG  DKF  GE IPL  +K+AYT+KVP+GVVAQIVPWNYPLAMA  K+Q  
Sbjct: 122 QILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGVVAQIVPWNYPLAMASWKIQSC 181

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           LAAGNT++IKPAENTSLSLLYFA L+K+AGFPPGV+N++PGYGSV G A+ +H DIDKI+
Sbjct: 182 LAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLNILPGYGSVTGTAMASHTDIDKIA 241

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST VG  V+  + QSNLK +TLECGGKSP L+F DA+LD+AI WVA GIF+NSGQ C
Sbjct: 242 FTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLIFADANLDEAIPWVAGGIFYNSGQNC 301

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
           TANSR+YV   IY++F+ KF+E AK  W    KFDPFD+ C +GPVIS  QYDRI+SY+E
Sbjct: 302 TANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAKFDPFDKDCTLGPVISKVQYDRIQSYVE 361

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GK  EKL   + +E+P   +KGYFIPPTIF+DVP +SKL ++EIFGPV VV+ F+ Y++
Sbjct: 362 HGKASEKLGFKEFAEYP---SKGYFIPPTIFSDVPNSSKLSQEEIFGPVGVVASFSTYEE 418

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
           A+KLAND+ YGLAS VF+++ +    FARDI+AGTVWIN +N EE  VPFGGFKMSGIGR
Sbjct: 419 AIKLANDSSYGLASCVFSENARTTAQFARDIRAGTVWINSSNDEEISVPFGGFKMSGIGR 478

Query: 483 ESGDTGVDNYLQIKSV 498
           E G  GVD+YLQ K+V
Sbjct: 479 ELGRNGVDSYLQTKAV 494

>Kwal_23.3507
          Length = 502

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/496 (61%), Positives = 380/496 (76%), Gaps = 2/496 (0%)

Query: 3   TLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXX 62
           +L T+I IPQL ++ +QPLGL+INNEF  SSDG +IE+VNPATG+P+ SFQ         
Sbjct: 2   SLSTEIHIPQLDLTYQQPLGLYINNEFVASSDGGSIESVNPATGKPVASFQAATDADVDR 61

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       W  TS+EQR   L+ L +L+E+E++ LAA+ETLD+GKPFH+NAK DL 
Sbjct: 62  AVAAARKAYQSHWRHTSAEQRSALLAKLAELVEQERELLAAIETLDSGKPFHTNAKGDLD 121

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
           QI++LT+YYAG  DKFN G+ IP+  +K+AYT++ P+GVVAQ+VPWNYPLAMA  KMQG 
Sbjct: 122 QIVQLTKYYAGGADKFNKGQHIPVGPDKYAYTVQAPYGVVAQVVPWNYPLAMASWKMQGC 181

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           LAAGNTV+IKPAENTSLSLLYFA L ++AGFP GVVNV+PG+G+V G  L  HMD+DKI+
Sbjct: 182 LAAGNTVVIKPAENTSLSLLYFAQLFERAGFPAGVVNVVPGHGAVAGSRLAAHMDVDKIA 241

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST VG  V+  +  SNLK +TLECGGKSPA++F DADLD+A+EW A GI++NSGQ C
Sbjct: 242 FTGSTAVGQKVMGLAAASNLKAVTLECGGKSPAVIFADADLDQAVEWTAAGIYYNSGQNC 301

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
           TANSR+YVQ S+YD+FV KF    +K W    K DPFD +C VGPV+S  QYDRI+ YIE
Sbjct: 302 TANSRLYVQESVYDEFVAKFCAYVEKTWKFGAKHDPFDPECTVGPVVSQVQYDRIRGYIE 361

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GK  E+L + Q     +  A G+FIPPT+FTDVP+ SKL R+EIFGPV V++KF +YDD
Sbjct: 362 HGKSSEQLGIRQIGVADV--APGFFIPPTLFTDVPQDSKLSREEIFGPVAVIAKFKDYDD 419

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
           AL  ANDT YGLA+AVFT+DV+KA+ FARDI AGTVWIN +N EE  VPFGGFKMSGIGR
Sbjct: 420 ALARANDTNYGLAAAVFTEDVRKANHFARDIDAGTVWINSSNDEEVSVPFGGFKMSGIGR 479

Query: 483 ESGDTGVDNYLQIKSV 498
           E G +G+D Y QIK+V
Sbjct: 480 ELGQSGMDVYTQIKAV 495

>CAGL0F07777g complement(758205..759719) similar to sp|P47771
           Saccharomyces cerevisiae YMR170c ALD5 or sp|P54114
           Saccharomyces cerevisiae YMR169c ALD4, start by
           similarity
          Length = 504

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/498 (62%), Positives = 378/498 (75%), Gaps = 2/498 (0%)

Query: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXX 60
           MP ++ +I IPQ+  S KQP+G+FI+NEF PSS+G+ IET+NPAT E ITSF        
Sbjct: 1   MPEVFEEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPATEEVITSFYAATEDDV 60

Query: 61  XXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD 120
                         W K S  ++   L  L  LIEEE+  LAALETLDAGKP+H+NA  D
Sbjct: 61  DKAVKSARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLAALETLDAGKPYHTNAMDD 120

Query: 121 LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ 180
           + QII LT+Y+AGA DKF  G+TIP+   K  YTLK P+GV   I+PWNYPLAMA  KMQ
Sbjct: 121 IDQIIHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCGMIIPWNYPLAMASWKMQ 180

Query: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK 240
           G LAAGNT++IKPAENTSLSLLY A L KKAGFP GVVNV+PG GSVVG +LG HMD+DK
Sbjct: 181 GCLAAGNTLVIKPAENTSLSLLYLAQLFKKAGFPKGVVNVVPGKGSVVGNSLGLHMDVDK 240

Query: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ 300
           ISFTGSTKVG S+LE +G+SN+KD+TLECGGKSPA+VF+DAD+D AIE++ANGIF+NSGQ
Sbjct: 241 ISFTGSTKVGSSILELAGKSNMKDVTLECGGKSPAVVFQDADIDNAIEYIANGIFYNSGQ 300

Query: 301 ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360
            CTANSRVYVQ  IYD F+++F E  K+ W    K DPFD+ C VGPV+S  Q++ +  Y
Sbjct: 301 NCTANSRVYVQEDIYDDFIKRFTEHTKENWKFGSKCDPFDKDCTVGPVVSEKQFETVNDY 360

Query: 361 IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY 420
           I  GK+EE L + QT E      KGYFI PTIFTDVP+ SKL+++EIFGPVVVV+KF +Y
Sbjct: 361 IRHGKEEENLQIHQTVE--KCDCKGYFISPTIFTDVPQGSKLMKEEIFGPVVVVAKFKDY 418

Query: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI 480
            +A+KLANDT YGLAS VFTK++  A+ FARDIK+GTVWIN +N+E+  VPFGGFK SGI
Sbjct: 419 KEAIKLANDTNYGLASMVFTKNISVANWFARDIKSGTVWINSSNEEDPTVPFGGFKQSGI 478

Query: 481 GRESGDTGVDNYLQIKSV 498
           GRE G+TGV++Y+QIK+V
Sbjct: 479 GRELGETGVESYMQIKTV 496

>Scas_669.9
          Length = 503

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/495 (58%), Positives = 378/495 (76%), Gaps = 1/495 (0%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXX 63
           ++  IEIPQ  +S++QP+GLFI+NEF  SSDG  I+T NPAT E +TSF           
Sbjct: 1   MFKTIEIPQHHLSIRQPIGLFISNEFVKSSDGNQIDTFNPATKEKLTSFYAGSETDVNVA 60

Query: 64  XXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQ 123
                      WSKTS EQR   L  L  L+E +++ LA++ET D+GKP+++NA  D+  
Sbjct: 61  VRAARTSYTKTWSKTSPEQRTDLLLKLASLVERDKEILASIETQDSGKPYYTNALLDIDM 120

Query: 124 IIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGAL 183
           II+LT+Y+AG+ DKF  GETIP+     AYTLKVPFGVVAQIVPWNYPLAMA  K+Q  L
Sbjct: 121 IIKLTKYFAGSTDKFTTGETIPIDHETLAYTLKVPFGVVAQIVPWNYPLAMASWKLQSCL 180

Query: 184 AAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISF 243
           AAGNTV+IKP+EN+SLSLLYFA LI +AGFPPGVVN+IPGYG+VVG AL TH D+DKISF
Sbjct: 181 AAGNTVVIKPSENSSLSLLYFAQLIVEAGFPPGVVNIIPGYGTVVGDALSTHPDVDKISF 240

Query: 244 TGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICT 303
           TGSTKVG +VLE SG+SNLKD+TLECGGKSPA++F+DA+L++A++W + GIFFNSGQ CT
Sbjct: 241 TGSTKVGCNVLEQSGKSNLKDVTLECGGKSPAVIFKDANLEEAVKWTSEGIFFNSGQNCT 300

Query: 304 ANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIER 363
           ANSR+ VQ  I+D+FV KFK+  K++W+   KFDPFD+ C VGPVIS  QY++I+ Y+  
Sbjct: 301 ANSRILVQHDIFDEFVHKFKDYTKRKWNFGSKFDPFDKDCTVGPVISQKQYEKIQEYM-T 359

Query: 364 GKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDA 423
             +   +++    ++P     GYFIPPTI+T+VP+ SK  ++EIFGP VV+S+F +YD+A
Sbjct: 360 CPEGCPVEVSHIIDYPPDDINGYFIPPTIYTNVPQDSKWCKEEIFGPAVVISEFRDYDEA 419

Query: 424 LKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRE 483
           L LANDT YGLA+AVFT++++ AH FARDI AGTVW+N +N E+  +PFGGFKMSGIGRE
Sbjct: 420 LSLANDTSYGLAAAVFTENIRIAHEFARDILAGTVWVNTSNAEDVTLPFGGFKMSGIGRE 479

Query: 484 SGDTGVDNYLQIKSV 498
            G TGV++++Q K+V
Sbjct: 480 LGRTGVESFMQTKTV 494

>AFL201W [2994] [Homologous to ScYMR170C (ALD2) - SH; ScYMR169C
           (ALD3) - SH] complement(58424..59917) [1494 bp, 497 aa]
          Length = 497

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/498 (54%), Positives = 351/498 (70%), Gaps = 6/498 (1%)

Query: 1   MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXX 60
           M  L+ +I +P+   +  QPLGLFI+NEF     G  ++T NPA GE I +F        
Sbjct: 1   MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPANGELIATFYAAGAADV 60

Query: 61  XXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD 120
                         W  TS+++RG  L+ L +L++EE++ LA +ETLD+GKP+H+NA  D
Sbjct: 61  DAAVAAARRAYEERWRHTSAQERGALLARLAELVDEEREVLAGIETLDSGKPYHTNALAD 120

Query: 121 LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ 180
           L Q+  +TRYYAG  DK + G+   L+  K AYTL+VP+GVVAQIVPWNYPLAMA  K Q
Sbjct: 121 LDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYGVVAQIVPWNYPLAMASWKAQ 180

Query: 181 GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK 240
           G LAAGN V+IKP+ENTSLSLLYFA+L+++AGFPPGV NV+PG G  VG+ L  H  +DK
Sbjct: 181 GCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVFNVLPGLGPEVGQRLAEHKGVDK 240

Query: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ 300
           I+FTGST VG  V+ A+  SNLKD+TLECGGKSPA++F DADLD A+ +VA GIF+NSGQ
Sbjct: 241 IAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAVIFADADLDSAVNYVAAGIFYNSGQ 300

Query: 301 ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY 360
            CTANSR+YVQ ++YD F++KF+   +  +        F + C +GPVIS TQYDR+  Y
Sbjct: 301 NCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGSGL--FSKDCNMGPVISKTQYDRVMGY 358

Query: 361 IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY 420
           I  G   EKL   Q    P    KGY+IPPTIF DVP++S+L R+EIFGPV VV+KF +Y
Sbjct: 359 INHGIN-EKLAYEQFGSVP---EKGYYIPPTIFLDVPQSSRLCREEIFGPVAVVAKFKDY 414

Query: 421 DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI 480
           D+A++ ANDT YGLAS VFT++++ AH F RD+++GTVW+N +N EE  VPFGGFKMSGI
Sbjct: 415 DEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSGTVWVNSSNDEEVGVPFGGFKMSGI 474

Query: 481 GRESGDTGVDNYLQIKSV 498
           GRE G  G+  YLQ K+V
Sbjct: 475 GRELGKAGLQTYLQTKAV 492

>Kwal_23.3500
          Length = 503

 Score =  427 bits (1097), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 221/497 (44%), Positives = 306/497 (61%), Gaps = 13/497 (2%)

Query: 8   IEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXX 67
           +++P L  S  QPLGLFINNE+  S   + IE+ + ATGE I + Q              
Sbjct: 6   VQLP-LGGSYTQPLGLFINNEYVDSHSSEKIESFDAATGEVIAAVQAADASVDVDLAVSA 64

Query: 68  XXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIEL 127
                  W  T + ++   L  L  L+EEE++ LAA+E+LD+GKP  SNA  D+  +  +
Sbjct: 65  ARAAFPGWRDTPTTEKRDLLLKLASLVEEEKEMLAAVESLDSGKPLGSNAIHDVEALAGI 124

Query: 128 TRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGN 187
            +YYAG VDK   G++   +  +  YTL  P GVV  I+P+NYPL M   K   A+A GN
Sbjct: 125 LKYYAGWVDK-AQGQSYAPSTQRLTYTLHQPLGVVGCIIPFNYPLGMMAWKWT-AVATGN 182

Query: 188 TVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGST 247
           T + K AE T LS+LYFA L+ +AGFPPGV NV+ G G+ VG A+  H  IDKI+FTGST
Sbjct: 183 TTVFKSAEQTPLSILYFAQLVVRAGFPPGVFNVLSGRGATVGDAMARHTGIDKIAFTGST 242

Query: 248 KVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSR 307
            VG  + + +   NLK +TLECGGKSPALVF DAD ++A+ W A GIF+N GQIC+  SR
Sbjct: 243 SVGQQI-QRTAAVNLKALTLECGGKSPALVFADADFEQAVRWTAAGIFYNMGQICSGTSR 301

Query: 308 VYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKE 367
            YV+ SIYDKFV+         + V     P      VGP +S TQ +R+++YI +G +E
Sbjct: 302 CYVEDSIYDKFVDALAAHVADTYVVG---PPSQSTTRVGPQVSRTQQERVQNYIRKGVEE 358

Query: 368 EKLDMFQTSEFPIGGAK------GYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYD 421
               +      P   A       G+++ PTI  DV ++  + R+EIFGPV+ VSKF++YD
Sbjct: 359 GARLVLGGEGLPETIANDERHRNGFYVRPTILADVKQSHTVAREEIFGPVIAVSKFSDYD 418

Query: 422 DALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIG 481
           +AL+LAND+ YGL SA+FT D+ +AH FA ++++G  +IN +N+ +   PFGG KMSG G
Sbjct: 419 EALRLANDSEYGLGSAIFTSDLNRAHKFASEVESGICYINSSNELDPACPFGGIKMSGYG 478

Query: 482 RESGDTGVDNYLQIKSV 498
           RE G+ G+ N+  +K+V
Sbjct: 479 RELGEYGLANFTNVKAV 495

>KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida
           albicans aldehyde dehydrogenase, mitochondrial (by
           homology), start by similarity
          Length = 503

 Score =  416 bits (1069), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 217/494 (43%), Positives = 305/494 (61%), Gaps = 26/494 (5%)

Query: 18  KQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSK 77
           +QPLGLFINNE+  +   +T+ + NP++GE I   Q                     W  
Sbjct: 15  QQPLGLFINNEYVEAHGSETLTSYNPSSGEEICKVQCADPKIDVDLAVKAARDAFPGWKA 74

Query: 78  TSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDK 137
           T + ++      L  L+E + D L+ +E+LD GKP  +NAK D+ +++E+ +YYAG +DK
Sbjct: 75  TPAIEKRDLFYKLAGLLERDIDILSKIESLDTGKPIANNAKYDILEVVEVLKYYAGWIDK 134

Query: 138 FNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENT 197
              G++   +  K AYTL  P GVV  I+P+NYPLAM   K   A+A GNT + K A+ T
Sbjct: 135 AG-GQSFAPSSEKLAYTLHQPLGVVGCIIPFNYPLAMMSWKWT-AIATGNTTVFKSADQT 192

Query: 198 SLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEAS 257
            LS+LYFA L+K+AGFP GV NV+ G G+ VG A+  H  +DKI+FTGST VG  +++  
Sbjct: 193 PLSILYFAKLVKEAGFPAGVFNVLSGTGASVGSAIVKHTGVDKIAFTGSTAVG-QIIQQQ 251

Query: 258 GQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDK 317
              NLK ITLECGGKS  ++FED DL++A++W A GIF N GQIC+  SRV+VQ SIY++
Sbjct: 252 SAVNLKPITLECGGKSANMIFEDCDLEQAVKWSAWGIFNNMGQICSGTSRVFVQESIYEE 311

Query: 318 FVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSE 377
           FV +  +  KK + V     P D+  IVGP +S  Q +R+  YI+ G +E         +
Sbjct: 312 FVAQLADHVKKTYIVGA---PSDDAVIVGPQVSKKQQERVLEYIKIGIEE-------GCK 361

Query: 378 FPIGG-------------AKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDAL 424
            P+GG             A GY++ PTI  DV  + ++ ++EIFGPV+VV  F +Y +AL
Sbjct: 362 VPLGGLGAPEPIANDPALANGYYVKPTILADVKASYRIAKEEIFGPVIVVGSFKDYKEAL 421

Query: 425 KLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRES 484
            +AND+ YGL SA+F+KD+   H FA+D++AG VWIN +N  +  VPFGG KMSG GRE 
Sbjct: 422 DIANDSDYGLGSAIFSKDIVTCHKFAQDVEAGMVWINSSNDVDINVPFGGVKMSGHGREL 481

Query: 485 GDTGVDNYLQIKSV 498
           G+ G+ N+  +KSV
Sbjct: 482 GEYGLANFTNVKSV 495

>KLLA0C07777g complement(682962..684506) highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 aldehyde
           dehydrogenase (NAD+), mitochondrial, start by similarity
          Length = 514

 Score =  405 bits (1041), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/495 (44%), Positives = 298/495 (60%), Gaps = 11/495 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXX 63
           L   +++P   I+ +QP GLFIN EF PS   KT E +NP+  E IT             
Sbjct: 22  LKVPVQLPN-GITYEQPTGLFINGEFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVDIA 80

Query: 64  XXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQ 123
                      WS    E R   L  L  LI++  +TLA++E+LD GK     ++ D+A 
Sbjct: 81  VAAAKKAFNNGWSTAEPEDRAKCLLKLADLIDQHAETLASIESLDNGKSLFC-SRGDVAL 139

Query: 124 IIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGAL 183
           + +  R  AG  DK   G+ I    + F+YT + P GV  QI+PWN+PL M   K+  AL
Sbjct: 140 VAKYLRSCAGWADKI-YGKVIDTGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGPAL 198

Query: 184 AAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISF 243
           A GNTV++KPAE T LS LY   L+++AG P GVVN+IPG+G +VG+ + TH DI K++F
Sbjct: 199 ATGNTVVLKPAEATPLSALYACQLVQEAGVPKGVVNIIPGFGKIVGERICTHPDIKKVAF 258

Query: 244 TGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICT 303
           TGST  G  +++    S +K +TLE GGKSP +VF DADLDKA++ +A GIF+NSG++C 
Sbjct: 259 TGSTATGRHIMKTCADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFYNSGEVCC 317

Query: 304 ANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIER 363
           A SR+YVQ ++Y++ +EKFK+ A+         +PF+E    G   S  Q D+I SY++ 
Sbjct: 318 AGSRIYVQDTVYEEVLEKFKQYAES----LKVGNPFEENVFQGAQTSQMQIDKILSYVDV 373

Query: 364 GKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDA 423
           G  E    +         G KGYFI PTIF DV E  +++++EIFGPVV VSKFT  D+ 
Sbjct: 374 GTSEGARVITGGERI---GNKGYFIKPTIFADVKEDMQIVKEEIFGPVVTVSKFTTVDEV 430

Query: 424 LKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRE 483
           +  AND+ YGLA+ + TKDV KA   +  +KAGTVWIN  N     VPFGGF  SGIGRE
Sbjct: 431 VAKANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQNVPFGGFGQSGIGRE 490

Query: 484 SGDTGVDNYLQIKSV 498
            G   +DNY Q K+V
Sbjct: 491 MGAEALDNYTQTKAV 505

>Sklu_2369.5 YER073W, Contig c2369 5264-6808
          Length = 514

 Score =  404 bits (1039), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 219/484 (45%), Positives = 298/484 (61%), Gaps = 10/484 (2%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           I+ +QP GLFIN EF PS   KT E +NP+  E +T                        
Sbjct: 32  ITYEQPTGLFINGEFVPSRQHKTFEVINPSNEEEVTHVYEAREDDVDIAVAAAKKAFDNG 91

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS    E R   L  L  LIE+  +TLA +E+LD GK     ++ D+A + +  R  AG 
Sbjct: 92  WSTAEPEFRAQCLYKLADLIEKNAETLAGIESLDNGKSLFC-SRGDVALVSKYLRSCAGW 150

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK   G+ I    + FAYT + P GV  QI+PWN+PL M   K+  ALA GNTV++KPA
Sbjct: 151 SDKL-FGKVIDTGSDHFAYTKREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPA 209

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
           E T LS LY + L ++AG P GVVN+IPG+G +VG+ L TH ++ K++FTGST  G  ++
Sbjct: 210 EATPLSALYASQLCQEAGIPKGVVNIIPGFGKIVGERLCTHPEVKKVAFTGSTATGRHIM 269

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
           + +  S +K +TLE GGKSP +VF DADLDKA++ +A GIFFNSG++C A SRVYVQ ++
Sbjct: 270 KTAADS-IKKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFFNSGEVCCAGSRVYVQDTV 328

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           Y++ ++KFKE  +    V    +PF++    G   S  Q D+I SY++ G KE    +  
Sbjct: 329 YEEVLQKFKEYTE-SLKVG---NPFEDGVFQGAQTSKMQIDKILSYVDIGTKEGARIITG 384

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
             +    G KGYFI PTIF DV E  +++++EIFGP+V VSKF++ D+ + +AND+ YGL
Sbjct: 385 GEK---KGEKGYFIKPTIFADVKEDMRIVKEEIFGPIVSVSKFSSVDEVIAMANDSEYGL 441

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
           A+ + TKDV KA   +  IKAGT+WIN  N     VPFGGF  SGIGRE G   +DNY Q
Sbjct: 442 AAGIHTKDVNKAIDVSNRIKAGTIWINTYNAFHQSVPFGGFGQSGIGREMGAEALDNYTQ 501

Query: 495 IKSV 498
           +K+V
Sbjct: 502 VKAV 505

>Kwal_23.5911
          Length = 538

 Score =  401 bits (1030), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 214/484 (44%), Positives = 290/484 (59%), Gaps = 10/484 (2%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           ++  QP GLFIN EF PS   KT E +NP+T + I                         
Sbjct: 56  VTYDQPTGLFINGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVDVAIAAAKRAFEDK 115

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS    E R   L  L  L+++  + LA +E+LD GK     ++ D+  + +  R  AG 
Sbjct: 116 WSTADPEFRSRCLYKLADLVDQHAEILAGIESLDNGKSLLC-SRTDVDLVAKYLRSCAGW 174

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK   G TI      F+YTL+ P GV AQI+PWN+PL M   K+  ALA GNTV++KPA
Sbjct: 175 ADKI-FGRTIDTGSGHFSYTLREPLGVCAQIIPWNFPLLMWSWKLGPALATGNTVVLKPA 233

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
           E T LS LY + L+++AG P GVVN++PG+G ++G+ L TH D+ KI+FTGST  G  ++
Sbjct: 234 EATPLSALYASQLVQEAGIPAGVVNILPGFGKLLGERLCTHKDVKKIAFTGSTATGRHIM 293

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
             +    +K +TLE GGKSP +VF DADL+KA+  +A GIFFNSG++C A SRVYVQ ++
Sbjct: 294 RTAA-GTIKKVTLELGGKSPNIVFADADLEKAVRNIAFGIFFNSGEVCCAGSRVYVQDTV 352

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           Y++ +EKFK  A  E    G  DPF E    G   S  Q D+I  Y++ G  E    +  
Sbjct: 353 YEEVLEKFK--AYTETLKVG--DPFQEGVFQGSQTSQMQIDKILDYVQVGTAEGARVITG 408

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
                  G KGYF+ PTIF DV E  +++++EIFGP+V +SKF+  D+ +++AND+ YGL
Sbjct: 409 GERH---GDKGYFVKPTIFADVTEDMRIVKEEIFGPIVTISKFSTVDEVIEMANDSEYGL 465

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
           A+ + TKDV KA   +  +KAGTVWIN  N     VPFGGF  SGIGRE G   +DNY Q
Sbjct: 466 AAGIHTKDVNKAIDVSNRVKAGTVWINTYNNFHQSVPFGGFGQSGIGREMGAEALDNYTQ 525

Query: 495 IKSV 498
           +K+V
Sbjct: 526 VKAV 529

>CAGL0D06688g 639883..641457 highly similar to sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4 or sp|P40047
           Saccharomyces cerevisiae YER073w ALD5, hypothetical
           start
          Length = 524

 Score =  400 bits (1027), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/496 (43%), Positives = 301/496 (60%), Gaps = 12/496 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXX 62
           L+  I++P   +  +QP GLFINN+F PS   KT E +NP+T E I   ++         
Sbjct: 35  LHVPIKLPN-GLEYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESA 93

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       W+     +RG  L  L +LIE++++ +A++E+LD GK  +S A+ D+ 
Sbjct: 94  VQAADTAFKNGSWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAINS-ARGDVQ 152

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
            +I   +  AG  DK + G  +    N F Y  K P GV  QI+PWN+PL M   K+  A
Sbjct: 153 LVINYLKSSAGVADKID-GRLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPA 211

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           L  GNTV++K AE+T LS LY +  I KAG PPGV+N++ G+G +VG+AL TH  I KI+
Sbjct: 212 LVTGNTVVLKTAESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKKIA 271

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST  G  +  ++ Q+ LK +TLE GGKSP +VF DADL KA++ +  GI++NSG++C
Sbjct: 272 FTGSTATGKHIYSSAAQT-LKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGEVC 330

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
            A SRVYV+ SIYD+F ++FK TA +   V    +PFDE    G   S  Q D+I SY+E
Sbjct: 331 CAGSRVYVEESIYDEFAQEFK-TASEALKVG---NPFDESTFQGAQTSQMQLDKILSYVE 386

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GKKE    +         G KGYFI PTIF DV E  +++++EIFGPVV V+KF + D 
Sbjct: 387 IGKKEGATLITGGERI---GEKGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDH 443

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
            +++AND+ YGLA+ + T ++  A   A  +KAGTVW+N  N     +PFGGF  SG+GR
Sbjct: 444 VVQMANDSEYGLAAGIHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGR 503

Query: 483 ESGDTGVDNYLQIKSV 498
           E     +D YLQ K+V
Sbjct: 504 EMSKEALDGYLQAKAV 519

>Kwal_26.6752
          Length = 522

 Score =  397 bits (1021), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 220/496 (44%), Positives = 302/496 (60%), Gaps = 12/496 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXX 62
           L   +++P   I  +QP GLFINN+F  +  GKT E ++PAT E IT  ++         
Sbjct: 29  LRVPVKMPN-GIEYEQPTGLFINNKFVRAKQGKTFEVISPATEEEITHVYEAREDDVEDA 87

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       WS+     R   L+ L +LIE++ +T+A++ETLD GK   S A+ D+ 
Sbjct: 88  IAAADQAFKSGVWSQVDPLVRAKALNKLAELIEDDLETIASIETLDNGKAITS-ARGDVQ 146

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
            +    R  AG  DK + G  I      F+YT++ P GV  QI+PWN+PL M   K+  A
Sbjct: 147 LVANYLRSCAGWCDKVD-GRLINTGSTHFSYTVRQPLGVCGQIIPWNFPLLMWAWKVGPA 205

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           LA GNTV++K AE+T LS LY +  I KAG PPGVVN+I G+G ++G+AL TH  I KI+
Sbjct: 206 LATGNTVVLKTAESTPLSALYVSQFISKAGIPPGVVNIISGFGKIIGEALTTHPKIKKIA 265

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST  G  + + +G SNLK +TLE GGKSP +VF DADL +A++ +  GI++NSG++C
Sbjct: 266 FTGSTATGRHIYQNAG-SNLKKVTLELGGKSPNMVFGDADLKQAVQNIILGIYYNSGEVC 324

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
            A SRVYV+ S+YD+F+E+FK  A+         DPFD+    G   S  Q  +I  Y+E
Sbjct: 325 CAGSRVYVEESVYDQFLEEFKAAAEN----VKVGDPFDDATFQGAQTSQMQLSKILKYVE 380

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GK EE   +    E    G KG+FI PTIF +V E  +++++EIFGPVV VSKF   D+
Sbjct: 381 IGK-EEGATLVTGGERI--GNKGFFIKPTIFGNVEEDMRIVKEEIFGPVVTVSKFKTIDE 437

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
            ++ AND+ YGLA+ V T D+ KA   +  + AGTVW+N  N     VPFGGF  SGIGR
Sbjct: 438 LIEKANDSEYGLAAGVHTSDINKALEVSNRVNAGTVWVNTFNDFHHCVPFGGFNASGIGR 497

Query: 483 ESGDTGVDNYLQIKSV 498
           E G   +D+Y Q+K+V
Sbjct: 498 EMGSEALDSYTQVKAV 513

>Sklu_2427.2 YOR374W, Contig c2427 1739-3295
          Length = 518

 Score =  395 bits (1016), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/496 (43%), Positives = 300/496 (60%), Gaps = 12/496 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXX 62
           L   I++P   I  +QP GLFINN+F PS  GKT E ++P+T E I   ++         
Sbjct: 29  LSIPIKLPN-GIEYEQPTGLFINNKFVPSKQGKTFEVISPSTEEEICHIYEGREEDVDLA 87

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       WS      R   L+ L  LIE++++T+A++E+LD GK   S A+ D++
Sbjct: 88  VEAADKAFKNGSWSTVDPLVRANALNKLADLIEKDKETIASIESLDNGKAITS-ARGDIS 146

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
            ++   R  AG  DK + G  I      F+YT + P  V  QI+PWN+PL M   K+  A
Sbjct: 147 LVVNYLRSSAGYADKID-GRLINTGSTHFSYTRREPLCVCGQIIPWNFPLLMWAWKIAPA 205

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           LA GNTV++K AE+T LS LY +  I KAG PPGVVN++ G+G +VG+A+ TH  I K++
Sbjct: 206 LATGNTVVLKTAESTPLSALYVSQYIPKAGIPPGVVNIVSGFGKIVGEAITTHPKIKKVA 265

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST  G  + + +G  NLK +TLE GGKSP ++F DA+L +A++ V  GI+FNSG++C
Sbjct: 266 FTGSTATGRHIYQNAG-VNLKKVTLELGGKSPNIIFADANLKEAVKNVILGIYFNSGEVC 324

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
            A SRVYV+ SIYDK VE+ K  A  E    G  DPFDE    G   S  Q D+I  Y+E
Sbjct: 325 CAGSRVYVEESIYDKAVEEIK--AASEAVKVG--DPFDESTFQGAQTSQNQLDKILKYVE 380

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            G+KE    +         G KGYFI PTIF+DV E  +++++EIFGPVV ++KF + +D
Sbjct: 381 IGRKEGATLVTGGERL---GDKGYFIKPTIFSDVEENMRIVKEEIFGPVVTITKFKDVED 437

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
            ++ AND+ YGLA+ + T ++  A   +  + AGTVWIN  N     VPFGGF  SGIGR
Sbjct: 438 LVEKANDSEYGLAAGIHTSNINNAINVSNRLNAGTVWINTFNDFHHSVPFGGFNASGIGR 497

Query: 483 ESGDTGVDNYLQIKSV 498
           E G   +DNY Q+K+V
Sbjct: 498 EMGSEALDNYTQVKAV 513

>Scas_701.14
          Length = 515

 Score =  394 bits (1012), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/484 (44%), Positives = 287/484 (59%), Gaps = 11/484 (2%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           +  +QP GLFIN +F PS   K  E +NP+T E IT                        
Sbjct: 34  LKYEQPTGLFINGDFVPSKQNKIFEVINPSTEEVITPV-YEAMEDDVDIAVAAAKKAFKS 92

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS    E R   L  L  L+E+  + LA++ET D GK     ++ D+A + +  R   G 
Sbjct: 93  WSIADPEVRASALFKLANLVEKNAELLASIETADNGKSLLC-SRGDVALVSKYLRSCGGW 151

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK N G  I    N FAYT + P GV  QI+PWN+PL M   K+  ALA GNTV++KPA
Sbjct: 152 ADKIN-GNVINTGDNHFAYTTREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPA 210

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
           E T LS L+ + L  +AG P GVVN+IPG G VVG+ L  H D+ KI+FTGSTK G  ++
Sbjct: 211 ETTPLSALFASQLCIEAGIPKGVVNIIPGSGRVVGEKLCKHPDVKKIAFTGSTKTGSHIM 270

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
           + +  + +K +TLE GGKSP +VF DADLDKAIE +A GIF+NSG++C A SR+YVQ ++
Sbjct: 271 KTAADT-VKKVTLELGGKSPNIVFADADLDKAIENIAFGIFYNSGEVCCAGSRIYVQDTV 329

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           YD  + KFK+  +         DPFDE    G   S  Q  +I  Y++ G  E    +  
Sbjct: 330 YDTVLNKFKKYTEN----LKVGDPFDESTFQGAQTSKAQLTKILKYVKVGTDEGARVVTG 385

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
              F   G KGYF+ PTIF DV E  +++++E+FGP+V +SKF+  D+ + +AND+ YGL
Sbjct: 386 GERF---GNKGYFVKPTIFADVKEDMQIVKEEVFGPLVTISKFSTVDEVIDMANDSQYGL 442

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
           A+ + TKDV KA   ++ I+AGTVWIN  N     VPFGGF  SGIGRE G   +DNY Q
Sbjct: 443 AAGIHTKDVNKAIHVSKRIQAGTVWINTYNAFHQNVPFGGFGQSGIGREMGAAALDNYTQ 502

Query: 495 IKSV 498
           +KSV
Sbjct: 503 VKSV 506

>KLLA0F00440g 31019..32587 highly similar to sp|P46367 Saccharomyces
           cerevisiae YOR374w ALD4 aldehyde dehydrogenase,
           mitochondrial, start by similarity
          Length = 522

 Score =  393 bits (1010), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/496 (43%), Positives = 299/496 (60%), Gaps = 12/496 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXX 62
           L   +++P   IS +QP GLFINN+F PS  GKT E ++P+T E IT  ++         
Sbjct: 33  LKVKVDLPN-GISYEQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAA 91

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       WSK     R   LS L   IE++ DT+A++E+LD GK   S+AK D+ 
Sbjct: 92  VEAADKAFKSGVWSKVDPLVRSQCLSKLADYIEKDLDTIASIESLDNGKAI-SSAKGDVQ 150

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
            ++   R  AG  DK + G  I      F+YT++ P GV  QI+PWN+PL M   K+  A
Sbjct: 151 LVVNYLRSAAGYADKVD-GRVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPA 209

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           LA GNTV++K AE+T LS LY +  I KAG P GVVN++ G+G +VG+A+ TH  I K++
Sbjct: 210 LATGNTVVLKTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKVA 269

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST  G  + + +G  NLK +TLE GGKSP +VF DA+L  A++    GI++NSG++C
Sbjct: 270 FTGSTATGRHIYQNAG-VNLKKVTLELGGKSPNVVFADANLKSAVQNSLLGIYYNSGEVC 328

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
            A SR+YV+ SIYD F+++ K +A +   V    DPFD +   G   S  Q D+I  Y+E
Sbjct: 329 CAGSRLYVEESIYDDFLKEIK-SASEALKVG---DPFDAETFQGAQTSQNQLDKILKYVE 384

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GK E    +         G KGYF+ PTIF DV E+ +++++EIFGPVV V+KF   D+
Sbjct: 385 IGKNEGATLITGGERI---GDKGYFVRPTIFADVEESMRIVKEEIFGPVVTVTKFKTIDE 441

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
            ++ AND+ YGLA+ + T ++  A   +  + AGTVWIN  N     VPFGGF  SGIGR
Sbjct: 442 LIEKANDSEYGLAAGIHTSNINTAIQVSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGR 501

Query: 483 ESGDTGVDNYLQIKSV 498
           E G   +DNY Q+K+V
Sbjct: 502 EMGSEALDNYTQVKAV 517

>KLLA0E23144g complement(2052418..2053941) highly similar to
           sp|P54115 Saccharomyces cerevisiae YPL061w ALD6 aldehyde
           dehydrogenase, cytosolic, start by similarity
          Length = 507

 Score =  392 bits (1006), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/484 (43%), Positives = 294/484 (60%), Gaps = 8/484 (1%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           ++ +QP GLFINN+F  S DGKT++  NP+T E I   Q                     
Sbjct: 27  LTYQQPTGLFINNQFIKSQDGKTLKVENPSTEEIIVEVQSATSQDVEYAVEAADAAFNSE 86

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS    ++RG  L  L  LIE +++ +A++E+ D GK   + A+ D+  +I+  R  AG 
Sbjct: 87  WSTMDPKKRGSLLFKLADLIEAQKELIASIESADNGKTL-ALARGDVGLVIDYIRSAAGY 145

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK   G TI        +T K P GV  QI+PWN+PL M   K+  AL AGNTVI+KPA
Sbjct: 146 ADKLG-GRTINTGDGYANFTYKEPLGVCGQIIPWNFPLMMLSWKIAPALVAGNTVILKPA 204

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
             T L+ L+FA+L K+AG P GVVN++PG G  VG  +  H  I KI+FTGST +G  V 
Sbjct: 205 SPTPLNALFFASLCKEAGIPAGVVNIVPGPGRSVGDTITNHPKIRKIAFTGSTDIGRDVA 264

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
             + QSNLK +TLE GGKS  LVFEDA++ K I  + NGIF N+GQIC++ SR+YVQ +I
Sbjct: 265 IKAAQSNLKKVTLELGGKSAHLVFEDANIKKTIPNLVNGIFKNAGQICSSGSRIYVQDTI 324

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           YD+ + +FK   + E  V     PFDE      + +  Q++ I +YI+ GKKE    +  
Sbjct: 325 YDQLLSEFKTYLETEIKVG---SPFDESNFQAAINNKAQFETILNYIDIGKKEGASILTG 381

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
                  G KGYFI PT+F +V E  +++++EIFGPVV +SKF+  D+A+ LAND+ +GL
Sbjct: 382 GERV---GNKGYFIKPTVFYNVKEDMRIVKEEIFGPVVTISKFSTVDEAVALANDSEFGL 438

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
            + + T+++  A   A+ +KAGTVWIN  N  +A VPFGG+K SG GRE G+   ++Y Q
Sbjct: 439 GAGIETENISVALKVAKRLKAGTVWINTYNDFDAAVPFGGYKQSGYGREMGEEAFESYTQ 498

Query: 495 IKSV 498
           IK+V
Sbjct: 499 IKAV 502

>YER073W (ALD5) [1504] chr5 (304027..305589) Mitochondrial aldehyde
           dehydrogenase [1563 bp, 520 aa]
          Length = 520

 Score =  392 bits (1007), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 206/483 (42%), Positives = 291/483 (60%), Gaps = 10/483 (2%)

Query: 16  SLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXW 75
           + +QP GLFIN EF  S   KT + +NP+  E IT+                       W
Sbjct: 39  TYEQPTGLFINGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAFETKW 98

Query: 76  SKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAV 135
           S    E R   L NL  L+E+ Q+TLAA+E++D GK     A+ D+A + +  R   G  
Sbjct: 99  SIVEPEVRAKALFNLADLVEKHQETLAAIESMDNGKSLFC-ARGDVALVSKYLRSCGGWA 157

Query: 136 DKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAE 195
           DK   G  I    N F Y++K P GV  QI+PWN+PL M   K+  ALA GNTV++KPAE
Sbjct: 158 DKI-YGNVIDTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAE 216

Query: 196 NTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLE 255
            T LS L+ + L ++AG P GVVN++PG G VVG+ L  H D+ KI+FTGST  G  +++
Sbjct: 217 TTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMK 276

Query: 256 ASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIY 315
            +  + +K +TLE GGKSP +VF DADLDKA++ +A GIF+NSG++C A SR+Y+Q ++Y
Sbjct: 277 VAADT-VKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVY 335

Query: 316 DKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQT 375
           ++ ++K K+  +    V    DPFDE+   G   S  Q  +I  Y++  K E    +   
Sbjct: 336 EEVLQKLKDYTE-SLKVG---DPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGG 391

Query: 376 SEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLA 435
           +     G+KGYF+ PT+F DV    +++++E+FGP+V VSKF+  D+ + +AND+ YGLA
Sbjct: 392 ARH---GSKGYFVKPTVFADVKGDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLA 448

Query: 436 SAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQI 495
           + + T D+ KA   ++ +KAGTVWIN  N     VPFGGF  SGIGRE G+  + NY Q 
Sbjct: 449 AGIHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGEAALSNYTQT 508

Query: 496 KSV 498
           KSV
Sbjct: 509 KSV 511

>CAGL0J03212g 307754..309307 highly similar to sp|P40047
           Saccharomyces cerevisiae YER073w ALD5 or sp|P46367
           Saccharomyces cerevisiae YOR374w ALD4, start by
           similarity
          Length = 517

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 208/484 (42%), Positives = 288/484 (59%), Gaps = 10/484 (2%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           I   QP GLFIN EF  S +GKT + +NP+T E I +                       
Sbjct: 35  IKYMQPTGLFINGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAVKAAKEAFENH 94

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS+   E R   L NL  L+E   +TLA +++LD GK     ++ D+A + +  R   G 
Sbjct: 95  WSREDPEVRARALFNLADLVEANLETLAGIDSLDNGKSLLC-SRADVALVAKYLRSCGGW 153

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK   G+ I    + F Y++K P GV  QI+PWN+PL M   K+  ALA GNTV++KPA
Sbjct: 154 ADKI-YGDVIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPA 212

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
           E T LS L+ + L ++AG P GVVN+IPG G  VG+ + TH DI K++FTGST  G  ++
Sbjct: 213 ELTPLSALFASKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFTGSTATGSRIM 272

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
           + +  S +K +TLE GGKSP +VF DADL++A+E +A+GIFFNSG++C A SR+YVQ   
Sbjct: 273 KTAADS-IKKVTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCAGSRIYVQDKC 331

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           YD+ +++ K    K  +     +PF +    G   S  Q D+I  Y++ GK+E    +  
Sbjct: 332 YDEVLDRLK----KYTESLKVGNPFGDNTYQGSQTSQQQLDKILEYVDIGKQEGARIVTG 387

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
                  G KGYF  PT+F DV E  ++++DEIFGP+V VS+F+  D+ + +AND+ YGL
Sbjct: 388 GERI---GEKGYFFKPTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVIAMANDSQYGL 444

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
           A+ + T DV KA   +  +KAGT+WIN  N     VPFGGF  SGIGRE G   +DNY Q
Sbjct: 445 AAGIHTNDVNKAVEVSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREMGSAALDNYTQ 504

Query: 495 IKSV 498
           +KSV
Sbjct: 505 VKSV 508

>ACL044W [1005] [Homologous to ScYER073W (ALD5) - SH]
           complement(286308..287849) [1542 bp, 513 aa]
          Length = 513

 Score =  390 bits (1001), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 212/485 (43%), Positives = 291/485 (60%), Gaps = 15/485 (3%)

Query: 16  SLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXW 75
           S +QP GLFI+ +F PS   KT E ++P T E IT                        W
Sbjct: 33  SYEQPTGLFIDGKFVPSHQAKTFEVIDPGTEEEITHV-YEAREEDVDAAVAAAKRAFLPW 91

Query: 76  SKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAV 135
           S+   E R   L  L  LIE+ Q+TLA +E+LD GK     ++ D+A +    R   G  
Sbjct: 92  SRADPEVRAQCLFKLADLIEKHQETLANIESLDNGKSLLC-SRGDVALVARYLRTCGGWA 150

Query: 136 DKF--NMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKP 193
           DK   N+ ET P   + F+YT + P GV  QI+PWN+PL M   K+  ALA GNTV++KP
Sbjct: 151 DKIYGNVMETGP---DHFSYTRREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKP 207

Query: 194 AENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSV 253
           AE+T LS LY   L  +AG P GV+N++PG+G +VG+ L TH D+ K++FTGST  G  +
Sbjct: 208 AESTPLSALYVCNLANEAGIPKGVMNIVPGFGKIVGEHLCTHPDVKKVAFTGSTATGRHI 267

Query: 254 LEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSS 313
           +    ++ +K +TLE GGKSP +VF DAD+DKA++ +  GIF+N+G++C A SRVYVQ S
Sbjct: 268 MRTCAET-VKKVTLELGGKSPNIVFADADIDKAVKNIGFGIFYNAGEVCCAGSRVYVQDS 326

Query: 314 IYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMF 373
           +YD+ +EKFK+ ++         +PF+E    G   S  Q D+I SY++ G KE    + 
Sbjct: 327 VYDEVLEKFKQFSEN----LKVGNPFEEGVFQGAQTSQMQVDKILSYVDIGVKEGARIVA 382

Query: 374 QTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYG 433
                   G KG+FI PTIF DV E  ++++DEIFGPVV VSKF+  D+ + +AN++ YG
Sbjct: 383 GGERL---GRKGFFIKPTIFADVNENMRVVKDEIFGPVVTVSKFSTVDEVIAMANNSQYG 439

Query: 434 LASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYL 493
           LA+ + T D+ KA   +  IKAGTVW+N  N     VPFGGF  SGIG E G   +DNY 
Sbjct: 440 LAAGIHTTDINKAIDVSNQIKAGTVWVNTYNDFHPNVPFGGFGQSGIGSEMGVQALDNYT 499

Query: 494 QIKSV 498
           Q K+V
Sbjct: 500 QTKAV 504

>YOR374W (ALD4) [5149] chr15 (1039836..1041395) Mitochondrial
           aldehyde dehydrogenase [1560 bp, 519 aa]
          Length = 519

 Score =  388 bits (997), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/492 (42%), Positives = 296/492 (60%), Gaps = 12/492 (2%)

Query: 8   IEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXXXXXX 66
           I++P   +  +QP GLFINN+F PS   KT E +NP+T E I   ++             
Sbjct: 33  IKLPN-GLEYEQPTGLFINNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAA 91

Query: 67  XXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIE 126
                   W+      RG  L  L +LIE+++D +A++ETLD GK   S+++ D+  +I 
Sbjct: 92  DRAFSNGSWNGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAI-SSSRGDVDLVIN 150

Query: 127 LTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAG 186
             +  AG  DK + G  I      F+YT + P GV  QI+PWN+PL M   K+  AL  G
Sbjct: 151 YLKSSAGFADKID-GRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTG 209

Query: 187 NTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGS 246
           NTV++K AE+T LS LY +  I +AG PPGV+N++ G+G +VG+A+  H  I K++FTGS
Sbjct: 210 NTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGS 269

Query: 247 TKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANS 306
           T  G  + + S  + LK +TLE GGKSP +VF DA+L KA++ +  GI++NSG++C A S
Sbjct: 270 TATGRHIYQ-SAAAGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGS 328

Query: 307 RVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKK 366
           RVYV+ SIYDKF+E+FK  A  E    G  DPFDE    G   S  Q ++I  Y++ GK 
Sbjct: 329 RVYVEESIYDKFIEEFK--AASESIKVG--DPFDESTFQGAQTSQMQLNKILKYVDIGKN 384

Query: 367 EEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKL 426
           E    +         G+KGYFI PT+F DV E  +++++EIFGPVV V+KF + D+ + +
Sbjct: 385 EGATLITGGERL---GSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINM 441

Query: 427 ANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGD 486
           AND+ YGLA+ + T ++  A   A  + AGTVWIN  N     VPFGGF  SG+GRE   
Sbjct: 442 ANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMSV 501

Query: 487 TGVDNYLQIKSV 498
             + NYLQ+K+V
Sbjct: 502 DALQNYLQVKAV 513

>Scas_663.4
          Length = 520

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 212/496 (42%), Positives = 296/496 (59%), Gaps = 12/496 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXX 62
           L   I++P   +  +QP GLFINN+  PS  GKT E +NP+T + I   ++         
Sbjct: 30  LTIPIKLPN-GLEFEQPTGLFINNKNVPSKQGKTFEVINPSTEDEICHIYEGREDDVDIA 88

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       WS      RG  L  L +LIE++++ +A++E+LD GK  +S A+ D+ 
Sbjct: 89  VKAASDAFNNGSWSTIDPIYRGQALYKLAELIEKDKEIIASIESLDNGKAINS-ARGDVE 147

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
            ++   +  AG  +K + G  I    N F YT + P GV  QI+PWN+PL M   K+  A
Sbjct: 148 LVVNYLKSSAGMANKLD-GRLIDSGSNYFNYTKREPLGVCGQIIPWNFPLLMWAWKIAPA 206

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           L  GNTV++K AE+T LS LY A  I +AG PPGVVN++ G+G +VG+A+ +H  I KI+
Sbjct: 207 LITGNTVVLKTAESTPLSALYAAKYIPEAGIPPGVVNIVSGFGKIVGEAMTSHPLIKKIA 266

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST  G  + + +  S LK +TLE GGKSP ++F DA+L KA++ V  GI++NSG++C
Sbjct: 267 FTGSTATGKHIYQNAAAS-LKKVTLELGGKSPNIIFADANLKKAVQNVITGIYYNSGEVC 325

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
            A SRVYVQ SIYD+ +E+ K  A  E    G  DPFDE    G   S  Q ++I  Y+E
Sbjct: 326 CAGSRVYVQESIYDELIEEIK--AASEAVKVG--DPFDETTFQGAQTSQMQLNKILKYVE 381

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GK E    +         G KGYF+ PTIF  V E  +++++EIFGPVV +SKF   D+
Sbjct: 382 IGKNEGAQLITGGERV---GKKGYFVKPTIFGGVQEDMRIVKEEIFGPVVTISKFKTLDE 438

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
            +++AND+ YGLA+ + T ++  A   A  +KAGTVWIN  N     VPFGGF  SG+GR
Sbjct: 439 VVQMANDSEYGLAAGIHTSNINTATKVADRLKAGTVWINTYNDFHCNVPFGGFNASGLGR 498

Query: 483 ESGDTGVDNYLQIKSV 498
           E G   ++NYLQ K+V
Sbjct: 499 EMGTEALENYLQSKAV 514

>CAGL0H05137g complement(495715..497208) highly similar to sp|P54115
           Saccharomyces cerevisiae YPL061w ALD6, hypothetical
           start
          Length = 497

 Score =  379 bits (972), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/492 (42%), Positives = 294/492 (59%), Gaps = 10/492 (2%)

Query: 8   IEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXXXXXX 66
           I++P   ++ +QP GLFINNEF  SSDGKT+   NP+T EPI   F              
Sbjct: 11  IKLPN-GLTYEQPTGLFINNEFVESSDGKTMTIENPSTQEPIVDVFSATKEDVDYAVDCA 69

Query: 67  XXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIE 126
                   W+    + R  YLS L  L+EE+ + +A++ETLD GK   + ++ D+   I 
Sbjct: 70  ERAFEKSDWATQDPKVRARYLSKLADLMEEQLELIASIETLDNGKTI-ALSRGDVQLSIN 128

Query: 127 LTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAG 186
             R  A   DK + G +I        YT++ P GV AQI+PWN+PL M   K+  ALA G
Sbjct: 129 CIRDAASYADKVD-GRSIDTGDGYMNYTIREPIGVCAQIIPWNFPLMMLSWKVGPALAMG 187

Query: 187 NTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGS 246
           N +++KPA  T L+ LYF++L K+ G P GVVN+IPG G +VG AL TH  + K++FTGS
Sbjct: 188 NCIVLKPASATPLNALYFSSLCKQVGIPAGVVNIIPGPGGMVGTALTTHPKVRKVAFTGS 247

Query: 247 TKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANS 306
           T +G  +   +  SNLK ITLE GGKS  LVF DA+L+K +  + NGIF N+GQIC++ S
Sbjct: 248 TDIGKDIAVKASASNLKKITLELGGKSAHLVFNDANLEKTLPNLVNGIFKNAGQICSSGS 307

Query: 307 RVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKK 366
           R+Y Q+ IYD+ +++FK   +K   V    +PFDE    G + +  QY+ I  YI  G K
Sbjct: 308 RIYAQAGIYDRLLKEFKAYIEKNIKVG---NPFDESNFQGAITNKEQYNTILKYINIG-K 363

Query: 367 EEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKL 426
           EE   +    E      KGYFI PT+F DV E  +++++EIFGP V +SKF   +D + +
Sbjct: 364 EEGAKVLTGGE--TAAEKGYFIKPTVFYDVKEDMRVVKEEIFGPCVTISKFEEIEDGVAM 421

Query: 427 ANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGD 486
           AND+ +GL + + T+++  A   A+ + +GTVWIN  N  +++VPFGG+K SG GRE G 
Sbjct: 422 ANDSEFGLGAGIETENLSTALKVAKMLHSGTVWINTYNDFDSRVPFGGYKQSGYGREMGS 481

Query: 487 TGVDNYLQIKSV 498
              + Y Q K+V
Sbjct: 482 EVYECYTQTKAV 493

>ADR417W [2157] [Homologous to ScYOR374W (ALD4) - SH]
           complement(1457469..1458992) [1524 bp, 507 aa]
          Length = 507

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/496 (42%), Positives = 292/496 (58%), Gaps = 12/496 (2%)

Query: 4   LYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITS-FQXXXXXXXXX 62
           L   I++P   +  +QP GLFINNEF  S  G  +E + PAT E +T  ++         
Sbjct: 18  LSVTIKLPN-GVEYEQPTGLFINNEFVRSKLGGMMEVIAPATEEVVTRVYEGTSEDVDIA 76

Query: 63  XXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLA 122
                       W       R   LS L  LIEE+ + +A++E LD GK F S+A+ D+ 
Sbjct: 77  VSAAQKAFKSGKWFGADPMVRVKALSKLADLIEEDLEVIASIEFLDNGKVF-SHARFDIG 135

Query: 123 QIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGA 182
            ++   R  AG  DK + G +I    +   YT + P GV  QI+PWN+PL M   K+  A
Sbjct: 136 MVVNYLRCCAGLADKVD-GRSIDTGSSHLTYTRREPIGVCGQIIPWNFPLLMWAWKVGPA 194

Query: 183 LAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKIS 242
           LA GNTV++K AE T LS LY +  ++KAG P GVVN+I GYG  VG+A+  H  + KI+
Sbjct: 195 LATGNTVVLKTAEFTPLSALYVSNHVRKAGIPAGVVNIISGYGKTVGEAIIRHPGVKKIA 254

Query: 243 FTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQIC 302
           FTGST  G  + E + + +LK ++LE GGKSP ++F DADL KA + V N IFFN G++C
Sbjct: 255 FTGSTATGRHIYEVAAK-DLKKVSLELGGKSPNIIFADADLKKAAQNVLNSIFFNGGEVC 313

Query: 303 TANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE 362
            A SR+Y++  IY++F+++ K  A+         DP  +    G   S  Q D+I SYIE
Sbjct: 314 CAGSRMYIEEPIYEEFLQEIKAVAES----VKVGDPSWKDTFQGAQTSQMQLDKILSYIE 369

Query: 363 RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDD 422
            GK+E    +         G KGY++ PTIF DV E  +++++EIFGPVV V+KFTN DD
Sbjct: 370 IGKQEGARVVTGGERL---GEKGYYVKPTIFADVREDMRIVKEEIFGPVVTVTKFTNIDD 426

Query: 423 ALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGR 482
            L++ANDT YGLA+ V++  +KKA   A  + AGTVWIN  N     VPFGG+K SG GR
Sbjct: 427 LLEMANDTQYGLAAGVYSSSMKKAIDVANRLDAGTVWINTYNDFHCSVPFGGYKGSGFGR 486

Query: 483 ESGDTGVDNYLQIKSV 498
           E G   V+NY Q+K+V
Sbjct: 487 EMGAEVVENYTQVKAV 502

>Sklu_2315.3 YPL061W, Contig c2315 5950-7455
          Length = 501

 Score =  378 bits (970), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 204/484 (42%), Positives = 288/484 (59%), Gaps = 8/484 (1%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           +S +QP GLFINNEF  S D KT++  NP+T E +                         
Sbjct: 21  LSYEQPTGLFINNEFIKSQDQKTLKVENPSTEEIVAEVYSATKDDVEYAVECADKAFNSS 80

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS      R  YL  L  L+EE ++ ++++E LD GK   + A+ D+  +++  +  AG 
Sbjct: 81  WSTCDPRIRASYLFKLANLVEERKELISSIEALDNGKTL-ALARGDVGLVVDYLKIAAGY 139

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK   G TI        YTL+ P GV  QI+PWN+PL M   K+  ALAAGNTV++KPA
Sbjct: 140 ADKLG-GRTINTGEGYVNYTLREPVGVCGQIIPWNFPLMMLSWKIAPALAAGNTVVLKPA 198

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
             T L+ LYFA+L K+ G P GVVN++PG G  VG  +  H  I KI+FTGST++G  V 
Sbjct: 199 SPTPLNALYFASLCKEVGIPDGVVNIVPGPGRSVGDTITNHPKIRKIAFTGSTEIGRDVA 258

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
             +  SNLK +TLE GGKS  LVF+D  L+K ++ + NGIF N+GQIC++ SR+YVQ  I
Sbjct: 259 IKAAASNLKKVTLELGGKSAHLVFDDCKLEKTLQNLVNGIFKNAGQICSSGSRIYVQEGI 318

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           +D+ +  FKE  +    V     PFDE    G + + +Q+D + +YI  G KEE   +  
Sbjct: 319 HDRLLAAFKEYLENNIKVG---SPFDESNYQGAINNKSQFDTVINYINIG-KEEGAKLLT 374

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
             E    G KGYFI PT+F DV E  +++++EIFGPVV +SKF + +D + +AND+ +GL
Sbjct: 375 GGERV--GDKGYFIRPTVFYDVKEDMRIVKEEIFGPVVTISKFKDIEDGVAMANDSEFGL 432

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
            + + T+++  A   ++ +KAGTVW+N  N  +A VPFGG K SG GRE G+   + Y Q
Sbjct: 433 GAGIETENLSTALKVSKMLKAGTVWVNTYNDFDASVPFGGCKQSGYGREMGEEVFEAYTQ 492

Query: 495 IKSV 498
           +K+V
Sbjct: 493 VKAV 496

>Scas_664.24
          Length = 499

 Score =  375 bits (964), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/485 (43%), Positives = 288/485 (59%), Gaps = 10/485 (2%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXX-XXX 73
           I+  QP GLFINNEF  S D KTI+  NPAT E +                         
Sbjct: 20  ITYNQPTGLFINNEFMKSQDYKTIKVENPATAEIVCEVSSGTSEDVEYAVESAEHAFNDT 79

Query: 74  XWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAG 133
            W+    + RG YLS L  L+EE  + +A++ETLD GK   + ++ D+   I   R  A 
Sbjct: 80  DWATQDPKIRGRYLSKLADLMEENLELMASIETLDNGKTL-ALSRGDVGLAINCIRDAAS 138

Query: 134 AVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKP 193
             DK N G TI        +T+K P GV  QI+PWN+PL M   K+  ALA GN +I+KP
Sbjct: 139 YADKIN-GRTINSGDGYMNFTVKEPIGVCGQIIPWNFPLMMLSWKIAPALAMGNVIILKP 197

Query: 194 AENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSV 253
           A  T L+ L+FA+L KK G P GVVN+IPG G  VG A+ TH  I K +FTGST++G  +
Sbjct: 198 ASATPLNALFFASLCKKVGIPAGVVNIIPGPGRTVGNAITTHPRIRKAAFTGSTEIGKDI 257

Query: 254 LEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSS 313
              +  SNLK ITLE GGKS  LVF+DA+++K +  + NGIF N+GQIC++ SR+YVQ  
Sbjct: 258 AIKASGSNLKKITLELGGKSAHLVFDDANIEKTLPNLVNGIFKNAGQICSSGSRIYVQEG 317

Query: 314 IYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMF 373
           IYDK +  FK+  +    V    DPFDE    G + +  QY+ I  YI+ G KEE   + 
Sbjct: 318 IYDKLMPAFKKYVEN-LKVG---DPFDESNFQGAITNREQYETILKYIKIG-KEEGAKIL 372

Query: 374 QTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYG 433
              E    G KGYFI PTIF DV E  +++R+EIFGPVV VSKF + +D + +AN + +G
Sbjct: 373 TGGETI--GNKGYFIKPTIFYDVKEDMEIVREEIFGPVVTVSKFKDIEDGVAMANASEFG 430

Query: 434 LASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYL 493
           L + + T+++  A   A+ +K+GTVWIN  N  +++VPFGG K SG GRE G+   D Y 
Sbjct: 431 LGAGIETENLSTALKVAKMLKSGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYDCYT 490

Query: 494 QIKSV 498
           ++K++
Sbjct: 491 EVKAI 495

>Kwal_27.11976
          Length = 526

 Score =  374 bits (960), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/484 (42%), Positives = 283/484 (58%), Gaps = 8/484 (1%)

Query: 15  ISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           ++ +QP GLFINNEF  S +G TI   +PAT + I   Q                     
Sbjct: 46  LTYEQPTGLFINNEFVKSHNGATIAVEDPATEKKIVEVQSGTKEDVEYAVECAEKAFNSS 105

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           WS      R   L  L  LIE+ ++ ++++E +D GK     AK D+  +I+  R  AG 
Sbjct: 106 WSTGDPRVRARALLKLADLIEQRKELISSIECMDNGKALFL-AKNDVRIVIDYIRSSAGF 164

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPA 194
            DK + G TI        YTL+ P GV  QI+PWN+PL M   K+  ALAAGNTVI+KPA
Sbjct: 165 ADKLD-GRTINTGDGYVNYTLREPVGVCGQIIPWNFPLLMLSWKIAPALAAGNTVILKPA 223

Query: 195 ENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
             T L+ LYFA+L K+AG P GVVN+IPG G  VG+ L TH  I KI+FTGST  G  + 
Sbjct: 224 SPTPLNALYFASLCKEAGIPAGVVNIIPGPGRDVGETLTTHPKIRKIAFTGSTGTGKGIA 283

Query: 255 EASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSI 314
             + QSNLK +TLE GGKS  +VF DA+L+K I  + NGIF N+GQIC++ SR+YVQ  I
Sbjct: 284 VKAAQSNLKKVTLELGGKSAHMVFNDANLEKTIPNLVNGIFLNAGQICSSGSRIYVQEGI 343

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           YDK +  FK+  ++   V     PFDE    G + +  Q+D I +Y+  GK+E    +  
Sbjct: 344 YDKLLPAFKKYVEEVITVG---SPFDESNFQGAINNKAQFDTIMNYVGIGKEEGAKVLTG 400

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGL 434
                  G +GYFI PTIF DV E  +++++EIFGPVV +SKF   +D + +AN++ +GL
Sbjct: 401 GKR---SGDQGYFIRPTIFYDVNEDMRIVKEEIFGPVVTISKFKEIEDGVAMANNSEFGL 457

Query: 435 ASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQ 494
            + + T+ V  A   ++ +KAGTVW+N  N  ++ VPFGG K SG G E G    D+Y  
Sbjct: 458 GAGIQTESVSTALKVSKMLKAGTVWVNTYNDFDSSVPFGGCKQSGYGSEMGIEAFDSYTT 517

Query: 495 IKSV 498
            K+V
Sbjct: 518 TKAV 521

>YPL061W (ALD6) [5380] chr16 (432583..434085) Cytosolic acetaldehyde
           dehydrogenase [1503 bp, 500 aa]
          Length = 500

 Score =  352 bits (904), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/505 (40%), Positives = 287/505 (56%), Gaps = 16/505 (3%)

Query: 1   MPTLYTDIEIPQLKISL------KQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQX 54
           M  L+ D   P +KI+L      +QP GLFINN+F  + DGKT    +P+T   +     
Sbjct: 1   MTKLHFDTAEP-VKITLPNGLTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSS 59

Query: 55  XXXXXXXXXXXXXXXX-XXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPF 113
                                W+     +RG  LS L   +E + D ++++E LD GK  
Sbjct: 60  ATTEDVEYAIECADRAFHDTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTL 119

Query: 114 HSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLA 173
            + A+ D+   I   R  A   DK N G TI        +T   P GV  QI+PWN+P+ 
Sbjct: 120 -ALARGDVTIAINCLRDAAAYADKVN-GRTINTGDGYMNFTTLEPIGVCGQIIPWNFPIM 177

Query: 174 MACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALG 233
           M   K+  ALA GN  I+KPA  T L+ LYFA+L KK G P GVVN++PG G  VG AL 
Sbjct: 178 MLAWKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALT 237

Query: 234 THMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANG 293
               I K++FTGST+VG SV   S +SNLK ITLE GGKS  LVF+DA++ K +  + NG
Sbjct: 238 NDPRIRKLAFTGSTEVGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNG 297

Query: 294 IFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQ 353
           IF N+GQIC++ SR+YVQ  IYD+ +  FK   + E  V    +PFD+    G + +  Q
Sbjct: 298 IFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEIKVG---NPFDKANFQGAITNRQQ 354

Query: 354 YDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVV 413
           +D I +YI+ GKKE    +    +    G KGYFI PT+F DV E  +++++EIFGPVV 
Sbjct: 355 FDTIMNYIDIGKKEGAKILTGGEKV---GDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVT 411

Query: 414 VSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFG 473
           V+KF   ++ +++AN + +GL S + T+ +      A+ +KAGTVWIN  N  +++VPFG
Sbjct: 412 VAKFKTLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFG 471

Query: 474 GFKMSGIGRESGDTGVDNYLQIKSV 498
           G K SG GRE G+     Y ++K+V
Sbjct: 472 GVKQSGYGREMGEEVYHAYTEVKAV 496

>KLLA0F12628g complement(1170396..1171910) similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase P9.1.f7. 1, start by
           similarity
          Length = 504

 Score =  253 bits (647), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 151/487 (31%), Positives = 256/487 (52%), Gaps = 30/487 (6%)

Query: 24  FINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQR 83
           FIN ++  + D       NP+TG+ I                         + +T+  +R
Sbjct: 32  FINGKWTETDD--KFAVTNPSTGDTIREV-TNCGVSDFNKAIEIAHDAFGTFRQTNVRER 88

Query: 84  GIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQII---ELTRYYAGAVDKFNM 140
              L N+  L+ E +  LA + TL+ GKP+    K  L +I+      +++A    +   
Sbjct: 89  AQILDNIYNLMLENKQDLAKILTLENGKPY----KDSLGEIVYSAMFFKWFAEEAPRI-Y 143

Query: 141 GETIP--LTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTS 198
           G+ IP  ++ ++  +T++ P GV+  + PWN+P AM  RK+   +A GNT +IKPA  T 
Sbjct: 144 GDIIPSAVSSDQKIFTIRQPLGVIGILTPWNFPSAMIARKLAPVIATGNTCVIKPAHETP 203

Query: 199 LSLLYFATLIKKAGFPPGVVNVIP-GYGSVVGKALGTHMDIDKISFTGSTKVGGSVL-EA 256
           LS L    + +KAG P GV N++P  + S +G+ +  H  + KI+FTGSTK+G  ++ ++
Sbjct: 204 LSALALGVIAEKAGLPAGVCNILPTNHTSEIGEYVCEHELVKKITFTGSTKIGQLLMGQS 263

Query: 257 SGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYD 316
           S   N+K  ++E GG +P +VF+DADLD+A++ +    F  SGQ C   +R++V   +YD
Sbjct: 264 SKGKNIKKFSMELGGNAPYIVFKDADLDRALDGIIGCKFRQSGQTCICANRIFVHEDLYD 323

Query: 317 KFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTS 376
           +F ++  +   K + +    D F +    GP+I     D++ S ++  K        + +
Sbjct: 324 EFSKRLVDKIDKTFKLG---DGFQDGVTHGPLIHDKSIDKVASLVQDAKT-------KGA 373

Query: 377 EFPIGGAKG-----YFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTC 431
           +  IGG++       F  PT+  +V E+  +  +EIFGPV  + KF + D+ +K ANDT 
Sbjct: 374 DVLIGGSRASSLGPLFYQPTVLGNVTESMDIFYEEIFGPVAPLIKFKDVDEVIKRANDTD 433

Query: 432 YGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDN 491
            GLA   +++++      A  +  G V +N     E  VPFGG K SG+G+E    G+D+
Sbjct: 434 VGLAGYFYSQNISTIFDAAEKLNVGMVGVNTGEISEPAVPFGGVKNSGLGKEGSKYGIDD 493

Query: 492 YLQIKSV 498
           Y ++K++
Sbjct: 494 YTELKAI 500

>Sklu_2087.3 , Contig c2087 4336-5856
          Length = 506

 Score =  246 bits (627), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 148/435 (34%), Positives = 237/435 (54%), Gaps = 28/435 (6%)

Query: 77  KTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQI---IELTRYYAG 133
           +TS  +R   L N+  LI+E +  LA L TL+ GKP     K  L +I       R++A 
Sbjct: 83  ETSLRERSQILYNIYDLIQEHKKDLARLITLENGKPI----KDSLGEIEYSASYFRWFAE 138

Query: 134 AVDKFNMGETIPLTFN--KFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVII 191
              +   G  IP + +  K  +T++ P GVV  + PWN+P AM  RK+   +A GN+ +I
Sbjct: 139 EAPRI-YGNIIPSSGSSKKQIFTIRQPLGVVGILTPWNFPSAMIARKLAPCIATGNSCVI 197

Query: 192 KPAENTSLSLLYFATLIKKAGFPPGVVNVIPG-YGSVVGKALGTHMDIDKISFTGSTKVG 250
           KPA  T LS L F  L+++AG   G+ N++P  Y SV G+ + +H  I K++FTGST VG
Sbjct: 198 KPAHETPLSALAFGWLVEQAGLAAGLCNILPTTYTSVTGEYICSHDLIRKVTFTGSTAVG 257

Query: 251 GSVLEASGQSN--LKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRV 308
            +++    + +  +K I++E GG +P +VF+DADL ++I+ +    F  SGQ C   +R+
Sbjct: 258 KALMGQCLKDSKVIKKISMELGGNAPFIVFKDADLMRSIDGLIGCKFRQSGQTCICANRI 317

Query: 309 YVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEE 368
           +V   IYD+F +K  E  +  + +   FDP   K   GP+I  +  D++   +   K   
Sbjct: 318 FVHEDIYDEFAKKLVERIETSFTLGDGFDP---KVTHGPLIHESAVDKVVKLVHDAKT-- 372

Query: 369 KLDMFQTSEFPIGGAKG-----YFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDA 423
                + ++   GG +       F  PT+ + V E+  +   EIFGPV  + KF + D+ 
Sbjct: 373 -----KGAQVLTGGTRASSLGPLFYRPTVLSGVNESMDIFHTEIFGPVASLVKFKSVDEV 427

Query: 424 LKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRE 483
           ++ AN T  GLA   ++ +++     A  ++ G V +N +   +A +PFGG K SGIGRE
Sbjct: 428 IERANATDVGLAGYFYSSNLQTVFDVATRLEVGMVGVNSSAISDAAMPFGGIKNSGIGRE 487

Query: 484 SGDTGVDNYLQIKSV 498
               G+++Y ++KSV
Sbjct: 488 GSMFGIEDYTELKSV 502

>YBR006W (UGA2) [199] chr2 (246974..248467) Succinate semialdehyde
           dehydrogenase (4-Aminobutyrate catabolic enzyme) [1494
           bp, 497 aa]
          Length = 497

 Score =  242 bits (617), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 160/481 (33%), Positives = 243/481 (50%), Gaps = 20/481 (4%)

Query: 24  FINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQR 83
           +I+ ++   +D +  E V+PA+GE I                         +  T+  +R
Sbjct: 22  YIDGKWVKGTD-EVFEVVDPASGEIIARVPEQPVSVVEEAIDVAYETFKT-YKNTTPRER 79

Query: 84  GIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGET 143
             +L N+  L+ E  D LA + TL+ GK     AK ++        +YA    +      
Sbjct: 80  AKWLRNMYNLMLENLDDLATIITLENGKAL-GEAKGEIKYAASYFEWYAEEAPRLYGATI 138

Query: 144 IPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLY 203
            PL  +   +T++ P GV   I PWN+P AM  RK   ALA G TV+IKP   T LS L 
Sbjct: 139 QPLNPHNRVFTIRQPVGVCGIICPWNFPSAMITRKAAAALAVGCTVVIKPDSQTPLSALA 198

Query: 204 FATLIKKAGFPPGVVNVIPGYGSV--VGKALGTHMDIDKISFTGSTKVGGSVLEASGQSN 261
            A L +KAGFP G  NVI  + +   +GK L     + K++FTGST VG  +L     S 
Sbjct: 199 MAYLAEKAGFPKGSFNVILSHANTPKLGKTLCESPKVKKVTFTGSTNVG-KILMKQSSST 257

Query: 262 LKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEK 321
           LK ++ E GG +P +VFEDADLD+A+E      F   GQ C   +R+YV SSI DKF + 
Sbjct: 258 LKKLSFELGGNAPFIVFEDADLDQALEQAMACKFRGLGQTCVCANRLYVHSSIIDKFAKL 317

Query: 322 FKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY----IERGKKEEKLDMFQTSE 377
             E  KK + +    DP   K   G VI+S+  ++++ +    I++G K   L+  + +E
Sbjct: 318 LAERVKK-FVIGHGLDP---KTTHGCVINSSAIEKVERHKQDAIDKGAKV-VLEGGRLTE 372

Query: 378 FPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASA 437
                    F  P I + VP T+ + ++E FGP+  +  F   ++ +  ANDT +GLA+ 
Sbjct: 373 LGPN-----FYAPVILSHVPSTAIVSKEETFGPLCPIFSFDTMEEVVGYANDTEFGLAAY 427

Query: 438 VFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIKS 497
           VF+K+V   +  +  ++ G V  N     +  +PFGG K SG GRE    G+++Y  +K+
Sbjct: 428 VFSKNVNTLYTVSEALETGMVSCNTGVFSDCSIPFGGVKESGFGREGSLYGIEDYTVLKT 487

Query: 498 V 498
           +
Sbjct: 488 I 488

>AER007W [2512] [Homologous to ScYBR006W (UGA2) - SH]
           complement(644674..646161) [1488 bp, 495 aa]
          Length = 495

 Score =  236 bits (603), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 163/437 (37%), Positives = 227/437 (51%), Gaps = 32/437 (7%)

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           + KTS  QR  +L NL  LI E  + LAA+ T + GK      ++ L +I    RY A  
Sbjct: 70  YKKTSPTQRSEWLRNLYDLIMENAEDLAAIVTWENGKSL----REALVEI----RYGATF 121

Query: 135 VDKFN------MGETI-PLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGN 187
              F+       G TI P      A+T++ P GV A I PWN+P AM  RK   ALAAG 
Sbjct: 122 FKWFSEEALRLYGTTIQPSNPGNRAFTIRQPVGVCALICPWNFPNAMISRKAAPALAAGC 181

Query: 188 TVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPG--YGSVVGKALGTHMDIDKISFTG 245
           TVIIKP   T LS L  A L +KAGFPPGV+NV+P   Y   +G  L     + K+SFTG
Sbjct: 182 TVIIKPDPQTPLSSLALAHLAEKAGFPPGVINVVPTSKYTKDIGVLLCESSLVRKVSFTG 241

Query: 246 STKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTAN 305
           ST V G +L     S +K ++ E GG +P ++  DAD++K +E V    F   GQ C   
Sbjct: 242 STAV-GKILMQQAASTVKKVSFELGGNAPVIIMGDADMEKTVEEVLATKFRGMGQTCICA 300

Query: 306 SRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY----I 361
           +R+YV  SI D F  +     K E    G  + F E    G +I++   ++++ +    I
Sbjct: 301 NRLYVHRSIIDDFSSRL--VKKVEGLKLG--NGFQEGVTHGSLINNAAIEKVERHAKDAI 356

Query: 362 ERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYD 421
           ERG K     +      P  G   +F  PT+ +DV   S L R+E FGP+  +  F   +
Sbjct: 357 ERGAKV----LLPGGRAPELGP--HFYSPTVLSDVKPDSVLTREETFGPLCAMIPFDTVE 410

Query: 422 DALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIG 481
           + +  ANDT YGLAS VF++++K  +  A  +  G V  N     ++ VPFGG K SG G
Sbjct: 411 EVVGYANDTQYGLASYVFSENIKTVYSIAEALDFGMVACNTGLFSDSMVPFGGIKESGFG 470

Query: 482 RESGDTGVDNYLQIKSV 498
            E    G+++Y  +K+V
Sbjct: 471 IEGSLHGINDYTVLKTV 487

>Scas_716.63
          Length = 494

 Score =  229 bits (584), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 155/480 (32%), Positives = 237/480 (49%), Gaps = 14/480 (2%)

Query: 22  GLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSE 81
           G  IN  +  S+  +T +  +PA+G  I +                       +  T+  
Sbjct: 17  GSLINGNWI-SAAKETFDVTDPASGSKIATLPEQTSSDVEQAIDAAAKAFKT-YKNTTPR 74

Query: 82  QRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMG 141
           QR  +L N+  L+ E  + LA L + + GK   S ++ ++        +YA    +   G
Sbjct: 75  QRAQWLRNMFNLMMENLEDLAKLISWENGKAL-SESRGEIKYAASFFEWYAEEAPRI-YG 132

Query: 142 ETI-PLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLS 200
            TI   T +   +TL+ P GV   I PWN+P AM  RK+  AL AG TVI+KP   T LS
Sbjct: 133 TTIQTATASNRVFTLRQPVGVCGIICPWNFPSAMITRKVAAALTAGCTVIVKPDSQTPLS 192

Query: 201 LLYFATLIKKAGFPPGVVNVIPGYGS--VVGKALGTHMDIDKISFTGSTKVGGSVLEASG 258
            L    L+++AGFP GV NVI  + +    G  L     + KISFTGST VG  +++ S 
Sbjct: 193 GLALGYLLEEAGFPEGVCNVILSHKNTPACGLTLCESPVVKKISFTGSTSVGKILMKQSA 252

Query: 259 QSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKF 318
            S LK ++ E GG +P +VFEDADL+ A+E      F   GQ C  ++R+YV SSI DKF
Sbjct: 253 -STLKKLSFELGGNAPVIVFEDADLEVAVEQTIASKFRGLGQTCVCSNRIYVHSSIIDKF 311

Query: 319 VEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEF 378
            E      +K     G  D     CI    I+    ++++S++     +    + +    
Sbjct: 312 AELVAAKVRKFTIGPGLSDGVTHGCI----INGKAIEKVESHVNDAITKGAQIIEKGGLI 367

Query: 379 PIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAV 438
           P  G    F  P + + V + + + ++E FGP+  +  F   ++ +  ANDT +GLA+ +
Sbjct: 368 PSLGPN--FYAPVVLSHVTKDALVAKEETFGPLCPIFSFDTLEEVIGYANDTEFGLAAYI 425

Query: 439 FTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIKSV 498
           F+KD+   +  A  ++AG V  N     +  +PFGG K SG GRE    G+++Y  +KSV
Sbjct: 426 FSKDIDTVYTAAEALEAGMVSCNTGIFSDCAMPFGGVKESGFGREGSLHGIEDYTVLKSV 485

>CAGL0C04191g complement(409544..411019) highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, hypothetical start
          Length = 491

 Score =  228 bits (582), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 166/497 (33%), Positives = 248/497 (49%), Gaps = 26/497 (5%)

Query: 13  LKISLKQP-----LGLFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXX 67
           +K  LK P     LG +IN E+   S+ +  E  +P+TGE I                  
Sbjct: 1   MKPELKNPDLIKGLG-YINGEWVKDSN-EFFEVDDPSTGEIIAKLPEHDIAVVDRAVDAA 58

Query: 68  XXXXXXXWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIEL 127
                  +  T   QR  +L NL  L+ E  + LA + T + GK    +++ ++      
Sbjct: 59  YDAFQK-YKNTLPRQRATWLRNLFNLMTENAEDLAKIITWENGKSL-PDSRAEIKYAASY 116

Query: 128 TRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGN 187
             +YA    +       P   N    T + P GV   I PWN+P AM  RK+  ALAAG 
Sbjct: 117 YEWYAEEAPRIYGATIQPSIPNNRVITKRQPVGVCGIICPWNFPSAMITRKVGAALAAGC 176

Query: 188 TVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSV--VGKALGTHMDIDKISFTG 245
           TV++KP  +T LS L    L++KAGFP GV NV+    +   +GK L  H  + K++FTG
Sbjct: 177 TVVVKPDSHTPLSALAMTVLVEKAGFPKGVFNVVLSQHNTPKLGKRLCEHPKVKKVTFTG 236

Query: 246 STKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTAN 305
           ST++G +++E +  S LK  + E GG +P +VF+DADLD A++      F   GQ C   
Sbjct: 237 STRIGKTLMEQA-SSTLKKCSFELGGNAPFIVFDDADLDLAVDQAIASKFRGMGQTCVCT 295

Query: 306 SRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRI----KSYI 361
           +R YVQ +I D+F EK   T  K++ +    D   E    G + ++ Q D++    K  I
Sbjct: 296 NRFYVQDTIADEFAEKLV-TKVKQFKIG---DGMKEGVTHGCLTNAKQADKVDEHKKDAI 351

Query: 362 ERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYD 421
           E+G K     + +    P  G    F  P +  +VP+++ + ++E FGP+  +  F   +
Sbjct: 352 EKGAKV----LLEGGRMPDLGKN--FYAPVVLKNVPQSAMVAKEETFGPLCPIFTFKTVE 405

Query: 422 DALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIG 481
           + L  ANDT  GLAS VFTK+V      +  ++AG V  N     ++ VPFGG K SG G
Sbjct: 406 EVLGYANDTELGLASYVFTKNVNTLFTVSEALEAGMVSCNTGLFSDSSVPFGGVKESGFG 465

Query: 482 RESGDTGVDNYLQIKSV 498
           RE    G+D+Y  +KS+
Sbjct: 466 REGSLYGIDDYTTVKSI 482

>KLLA0E17545g 1553982..1555475 highly similar to sp|P38067
           Saccharomyces cerevisiae YBR006w UGA2 succinate
           semialdehyde dehydrogenase, start by similarity
          Length = 497

 Score =  223 bits (569), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 149/427 (34%), Positives = 222/427 (51%), Gaps = 12/427 (2%)

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGA 134
           + KT+ + R  +L NL  L+ E  D LA + T + GK   S A+ ++        +YA  
Sbjct: 71  FKKTTPKTRSTWLRNLYNLMMENVDDLAKIITWENGKAL-SEAQGEVKYAASYFEWYAEE 129

Query: 135 VDKFNMGETI-PLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKP 193
             +   G TI P   +  A+T++ P GV   I PWN+P AM  RK   ALAAG TV++KP
Sbjct: 130 AVRM-YGTTIQPNNGSNRAFTVRQPVGVCGIICPWNFPSAMITRKAGAALAAGCTVVVKP 188

Query: 194 AENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSV--VGKALGTHMDIDKISFTGSTKVGG 251
              T LS L  A L +KAGFP GV NV+         G AL     + KISFTGST VG 
Sbjct: 189 DSQTPLSALALAHLAEKAGFPKGVFNVVLTATRTPEFGLALCESPKVKKISFTGSTNVGK 248

Query: 252 SVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQ 311
            +++ S  S +K ++ E GG +P +VF+DADL++A+       F   GQ C   +R+YVQ
Sbjct: 249 ILMKQSA-STMKKLSFELGGNAPVIVFDDADLEQAVTQTILSKFRGLGQTCVCANRIYVQ 307

Query: 312 SSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLD 371
            +I D F EK  +   +     G     D K   G +I+     +++++++   ++    
Sbjct: 308 RTIIDSFAEKLAKQVNEFVIGHG----LDSKTTHGCLINENAIKKVEAHVKDALEKGAKT 363

Query: 372 MFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTC 431
           +      P  G    F  PT+ + VP T+ + +DE FGP+  +  F   ++ +  ANDT 
Sbjct: 364 VVAGGRLPELGPN--FYAPTVLSHVPSTAVVNKDETFGPLCALIPFDTMEEVVGYANDTE 421

Query: 432 YGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDN 491
            GLAS VF+K++   +  A  ++ G V  N     E  +PFGG K SG GRE    G+++
Sbjct: 422 LGLASYVFSKNIDTVYTVAEALETGMVSCNTGLFSECTIPFGGVKESGFGREGSLHGIED 481

Query: 492 YLQIKSV 498
           Y  IK++
Sbjct: 482 YTVIKTI 488

>Kwal_56.23106
          Length = 495

 Score =  217 bits (552), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 158/480 (32%), Positives = 233/480 (48%), Gaps = 18/480 (3%)

Query: 24  FINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQR 83
           F+N ++   S G   E  +PA GE I                         + KT+  +R
Sbjct: 20  FVNGKWIKDS-GAEFEVTDPANGEVIAKLPDQDVGIVDEAIDAAYEAFQS-FKKTTGRER 77

Query: 84  GIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGET 143
              L  +  L+ E  + L  + + + GKP  +    ++        +YA    + N G T
Sbjct: 78  ATLLRKMHSLMLENVEDLGKILSWENGKPL-AEGIGEIKYAASFYEWYAEEAPRIN-GTT 135

Query: 144 I--PLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSL 201
           I   ++ N+  +T + P GV   I PWN+P AM  RK+  ALAAG TV+IKP   T LS 
Sbjct: 136 INSAISTNR-VFTERQPVGVCGIICPWNFPSAMITRKVGAALAAGCTVVIKPDSQTPLSA 194

Query: 202 LYFATLIKKAGFPPGVVNVIPGYGSV--VGKALGTHMDIDKISFTGSTKVGGSVLEASGQ 259
           L  A L +KAG P GV NV+  +      G  L     + K+SFTGST VG  +++ S  
Sbjct: 195 LALAHLAEKAGVPAGVFNVVLSHTKTPEFGLKLCESPKVKKVSFTGSTNVGKILMKQSA- 253

Query: 260 SNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFV 319
           S +K ++ E GG +P +VFEDADLDKA+E      F   GQ C   +R+YVQ SI D+F 
Sbjct: 254 STMKKLSFELGGNAPFIVFEDADLDKAVEQAIACKFRGLGQTCVCANRLYVQKSILDEFE 313

Query: 320 EKFKETAKKEWDVAGKF-DPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEF 378
            +F E    ++ +   F +     C++ P          K  IE+G K     + +    
Sbjct: 314 TRFAEKVN-QFVIGHAFKEGVTHGCLINPKAIEKVEAHTKDAIEKGAKV----VVEGGRL 368

Query: 379 PIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAV 438
           P  G    F  PT+ + VP+ + +   E FGP+  +  F   ++ ++ ANDT  GLA+ V
Sbjct: 369 PDLGPS--FYAPTVVSQVPQDAIVASQETFGPLCAIIPFETTEEVVRWANDTEVGLAAYV 426

Query: 439 FTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIKSV 498
           F+K++   +  +  ++ G V  N     E  VPFGG K SG GRE    G+++Y  IKSV
Sbjct: 427 FSKNIDTIYTVSEALETGMVSCNTGVFSECAVPFGGVKESGFGREGSLHGIEDYTVIKSV 486

>AAL075W [112] [Homologous to ScYHR039C (MSC7) - SH]
           complement(213684..215597) [1914 bp, 637 aa]
          Length = 637

 Score =  157 bits (396), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 136/500 (27%), Positives = 213/500 (42%), Gaps = 36/500 (7%)

Query: 23  LFINNEFCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQ 82
           LF  + + P   G  I+   PATG+ + SF+                     W+KTS  Q
Sbjct: 93  LFSASVYDPQQPG-MIQNYCPATGQFLGSFRSMSKEDIDERFAAAAKAQVS-WAKTSFAQ 150

Query: 83  RGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGE 142
           R   L  + K + E Q+ LA +   D+GK     +  ++   +E  ++     ++     
Sbjct: 151 RRQVLKTMQKFVLENQEMLARVACRDSGKTMLDASLGEIMVTMEKLQWMIKHGERTLRPS 210

Query: 143 TIPLTFNKFAYTLK------VPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAEN 196
                 N F    K       P GVV  +V WNY        +  +  AGN V+IK +E 
Sbjct: 211 KRAGPANFFMKLYKGGEVRYEPLGVVGAVVSWNYSFHNTLGPIIASTFAGNGVVIKCSEQ 270

Query: 197 TSLSLLYFATL----IKKAGFPPGVVNVI----PGYGSVVGKALGTHMDIDKISFTGSTK 248
              S  +F  L    +K  G  P +V +     P           +H  +  ++F GS  
Sbjct: 271 VVWSSEFFVKLARESLKVCGHDPELVQLCYCFPPSETDDTANYFTSHPSLRHLTFIGSKP 330

Query: 249 VGGSVLEASGQSNLKDITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSGQICTANSR 307
           V   VL  + +S L  + +E GGK   +V + A DL+     +  G F ++GQ C    R
Sbjct: 331 VAHHVLACAAKS-LTPVVVELGGKDALVVLDSAKDLESLSSIIMRGTFQSAGQNCIGIER 389

Query: 308 VYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKE 367
           V V    YD  V K  E    E  V    D   E   VG +IS  ++D ++  I+     
Sbjct: 390 VIVCQKNYDALV-KILEHRISELRVGADIDNL-EDVDVGAMISDNRFDYMEELIQDA--- 444

Query: 368 EKLDMFQTSEFPIGGAK--------GYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTN 419
               + Q +    GG++        G++  PT+  DV    ++ ++E+FGPV+ V K  +
Sbjct: 445 ----VSQGARLLHGGSRYTHPKYPQGHYFQPTLLVDVTTDMRISQNEVFGPVLTVMKAKD 500

Query: 420 YDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQ-TNQEEAKVPFGGFKMS 478
            +D +++ANDT +GL  +VF K+ K  +  A  +  G V IN        ++PFGG   S
Sbjct: 501 IEDCIRIANDTPFGLGGSVFGKNRKDCNYVANHMNVGNVAINDFATYYVCQLPFGGIGSS 560

Query: 479 GIGRESGDTGVDNYLQIKSV 498
           G GR  G+ G+      KS+
Sbjct: 561 GYGRFGGEEGLLGLCNSKSI 580

>Kwal_23.5699
          Length = 641

 Score =  154 bits (388), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 115/441 (26%), Positives = 198/441 (44%), Gaps = 20/441 (4%)

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYY--- 131
           W+KT+ E+R   L +L   I E QD++A +   D+GK     +  ++   +E  ++    
Sbjct: 147 WAKTTLEERTRVLVSLQDYILENQDSIARVACRDSGKTMLDASMGEILVTLEKLQWIIKN 206

Query: 132 ---AGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNT 188
              A    K +      + + K A     P GVV  +V WNYP       +  A+  GN 
Sbjct: 207 GEKALQPSKRSGPTNFFMKWYKGAEVRYEPLGVVGALVSWNYPFHNLLGPIMAAIFTGNA 266

Query: 189 VIIKPAENTSLSLLYFATLIKKA----GFPPGVVNVI----PGYGSVVGKALGTHMDIDK 240
           ++IK +E    S  +FA++ KK     GF P ++ +     P           +H  +  
Sbjct: 267 IVIKCSEQVVWSSEFFASMCKKCLESNGFDPNLIQLCYCRPPSATDNAANHYSSHPGLKH 326

Query: 241 ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSG 299
           ++F GS  V   VL A+ +S L  + +E GGK   +  +   DL      +  G F +SG
Sbjct: 327 LTFIGSKPVAHHVLAAASKS-LTPVVVELGGKDALIALDSVKDLPALSSIIMRGTFQSSG 385

Query: 300 QICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKS 359
           Q C    RV V +  YD+ V    E    +  +    D   E   +G +IS  +++ ++ 
Sbjct: 386 QNCIGIERVIVSAKNYDELVSIL-EKRVGQLRLGSDIDNL-EDVDMGAMISDNRFEELER 443

Query: 360 YIERGKKEEKLDMFQTSEFPIGG-AKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFT 418
            ++   K+    +   S +      +G++  PT+  DV    ++ ++E+FGP++ V +  
Sbjct: 444 MVQDAIKQGARLLHGGSRYKHPNYPQGHYFQPTLLVDVTPLMEIAQNEVFGPIMTVMRAE 503

Query: 419 NYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQ-TNQEEAKVPFGGFKM 477
           +  D ++LAN   +GL  +VF  D  + +  A  +  G V IN        ++PFGG   
Sbjct: 504 DTQDCIRLANSAPFGLGGSVFGSDYAECNYVANHLTTGNVAINDFATFYVCQLPFGGING 563

Query: 478 SGIGRESGDTGVDNYLQIKSV 498
           SG G+  G+ G+      KS+
Sbjct: 564 SGYGKFGGEEGLTGLCNAKSI 584

>YHR039C (MSC7) [2326] chr8 complement(184867..186801) Protein with
           strong similarity to aldehyde dehydrogenases [1935 bp,
           644 aa]
          Length = 644

 Score =  150 bits (378), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 125/482 (25%), Positives = 206/482 (42%), Gaps = 27/482 (5%)

Query: 38  IETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEE 97
           I+   PATG+ + SF                      W  +   +R   L++L   I   
Sbjct: 112 IQCHCPATGQYLGSFPSKTEADIDEMVSKAGKAQST-WGNSDFSRRLRVLASLHDYILNN 170

Query: 98  QDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLK- 156
           QD +A +   D+GK     +  ++   +E  ++      +       P   N F    K 
Sbjct: 171 QDLIARVACRDSGKTMLDASMGEILVTLEKIQWTIKHGQRALQPSRRPGPTNFFMKWYKG 230

Query: 157 -----VPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKA 211
                 P GV++ IV WNYP       +  AL  GN +++K +E    S  +F  LI+K 
Sbjct: 231 AEIRYEPLGVISSIVSWNYPFHNLLGPIIAALFTGNAIVVKCSEQVVWSSEFFVELIRKC 290

Query: 212 ----GFPPGVVNVI----PGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLK 263
                  P +V +     P           +H     I+F GS  V   +L+ + +S L 
Sbjct: 291 LEACDEDPDLVQLCYCLPPTENDDSANYFTSHPGFKHITFIGSQPVAHYILKCAAKS-LT 349

Query: 264 DITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKF 322
            + +E GGK   +V + A +LD     +  G F +SGQ C    RV V    YD  V+  
Sbjct: 350 PVVVELGGKDAFIVLDSAKNLDALSSIIMRGTFQSSGQNCIGIERVIVSKENYDDLVKIL 409

Query: 323 KETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERG-KKEEKL----DMFQTSE 377
            +         G      E   +G +IS  ++D +++ ++    K  +L      F+  +
Sbjct: 410 NDRMTANPLRQGSDIDHLENVDMGAMISDNRFDELEALVKDAVAKGARLLQGGSRFKHPK 469

Query: 378 FPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASA 437
           +P    +G++  PT+  DV    K+ ++E+FGP++V+ K  N D  ++LAN   +GL  +
Sbjct: 470 YP----QGHYFQPTLLVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGS 525

Query: 438 VFTKDVKKAHMFARDIKAGTVWINQ-TNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIK 496
           VF  D+K+ +  A  ++ G V IN        ++PFGG   SG G+  G+ G+      K
Sbjct: 526 VFGADIKECNYVANSLQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLGLCNAK 585

Query: 497 SV 498
           SV
Sbjct: 586 SV 587

>KLLA0C10615g complement(912077..913999) similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, start by similarity
          Length = 640

 Score =  148 bits (373), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 124/482 (25%), Positives = 208/482 (43%), Gaps = 29/482 (6%)

Query: 38  IETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLKLIEEE 97
           I++  PATG+ + SF+                     W+KTS ++R   L +L   I E 
Sbjct: 110 IQSYCPATGQFLGSFKSMSDTDIDEIVLLAERAQLQ-WAKTSLKERLQVLLSLKNFILEN 168

Query: 98  QDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIP------LTFNKF 151
           Q+ +A +   D+GK     +  ++   +E  ++     +        P      + + K 
Sbjct: 169 QEAIARVACRDSGKTMLDASMGEILVTLEKIQWIIEHGEDVLKPSARPGPTNFFMKWYKG 228

Query: 152 AYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKA 211
           A     P GVV  IV WNYP       +  ++  GN V++K +E    S  +F  L+++A
Sbjct: 229 AEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIFTGNAVVVKCSEQVVWSSKFFTLLVQEA 288

Query: 212 ----GFPPGVVNVI----PGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLK 263
               G  P +V +     P           +H     ++F GS  V   VL+A+  S L 
Sbjct: 289 LKACGHDPNLVQLCYCLPPTGNDDAANYFTSHPVFKHLTFIGSKPVAHHVLKAAADS-LT 347

Query: 264 DITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKF 322
            + +E GGK   +V +   DL      +  G F ++GQ C    RV V +  YD  V   
Sbjct: 348 PVVVELGGKDAFIVLDSVKDLQALSSIIMRGTFQSAGQNCIGIERVIVSAKNYDALVSIL 407

Query: 323 KETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERG-KKEEKL----DMFQTSE 377
            +    +  +    D   E   +G +IS  ++ ++++ I     K  KL      +    
Sbjct: 408 NDRVG-QLRLGSDIDNL-EDVDMGAMISDNRFGQLENLISDALSKGAKLLHGGSRYNHPN 465

Query: 378 FPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASA 437
           +P    +G+F  PT+  DV E  ++  +E+FGP++ V +  + DD ++LAN   +GL  +
Sbjct: 466 YP----QGHFFQPTLLVDVTEDMQISHNEVFGPILTVMRAKDTDDCIRLANAAPFGLGGS 521

Query: 438 VFTKDVKKAHMFARDIKAGTVWINQ-TNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIK 496
           +F  D  + +  A  +  G V IN        ++PFGG   SG G+  G+ G+      K
Sbjct: 522 IFGADFGECNRVANSLTTGNVAINDFATFYVCQLPFGGLNGSGYGKFGGEEGLLGLCNAK 581

Query: 497 SV 498
           SV
Sbjct: 582 SV 583

>CAGL0F08965g complement(880296..882215) highly similar to sp|P38694
           Saccharomyces cerevisiae YHR039c, hypothetical start
          Length = 639

 Score =  148 bits (373), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 122/487 (25%), Positives = 211/487 (43%), Gaps = 27/487 (5%)

Query: 33  SDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLK 92
           S  + I++  PATG+ +  F+                     W+++S  +R   L+ L K
Sbjct: 102 SKPRHIQSYCPATGQYLGEFKSMTADEIDELVGNANAAQMK-WAESSIAKRLEVLATLQK 160

Query: 93  LIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIP------L 146
            I E QD +A +   D+GK     +  ++   +E  ++              P      +
Sbjct: 161 FILENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWILKHGPSTLEPSRRPGPTNFFM 220

Query: 147 TFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFAT 206
            F K A     P GV++ IV WNYP       +  ++  GN +I+K +E    S  +F  
Sbjct: 221 KFYKGAEVRYEPLGVISSIVSWNYPFHNLMGPIIASIFTGNAIIVKCSEQVVWSSEFFIE 280

Query: 207 LIKKA----GFPPGVVNVI----PGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASG 258
           +++K          +V +     P           +H  I  I+F GS  V   +L  + 
Sbjct: 281 MVRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPGIKHITFIGSQSVASHILNCAS 340

Query: 259 QSNLKDITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDK 317
           +S L  + +E GGK   +V +   DLD     +  G F +SGQ C    RV V    YD+
Sbjct: 341 KS-LTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQSSGQNCIGIERVIVSEKNYDQ 399

Query: 318 FV----EKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMF 373
            V    ++ KET  ++       +  D    +G +IS  ++  +++ I+    +    ++
Sbjct: 400 LVNILEKRMKETPLRQGSDIDHLEVVD----MGAMISDNRFKTLEALIQDAVSKGARLLY 455

Query: 374 QTSEFPIGG-AKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCY 432
             S++      +G++  PT+  DV     + ++E+FGPV+V+ K  +  + ++LAN   +
Sbjct: 456 GGSQYNHPKYPQGHYFQPTLLVDVTPDMDIAQNEVFGPVLVMMKAKDTSNCIELANAAPF 515

Query: 433 GLASAVFTKDVKKAHMFARDIKAGTVWINQ-TNQEEAKVPFGGFKMSGIGRESGDTGVDN 491
           GL  +VF  D  + +  A  +K G V IN        ++PFGG   SG G+  G+ G+  
Sbjct: 516 GLGGSVFGSDYSECNFVANKLKTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLG 575

Query: 492 YLQIKSV 498
               KSV
Sbjct: 576 LCNAKSV 582

>Scas_690.26
          Length = 651

 Score =  140 bits (354), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 122/491 (24%), Positives = 207/491 (42%), Gaps = 31/491 (6%)

Query: 33  SDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTSSEQRGIYLSNLLK 92
           S+   I+   PATG+ I SF                      WS +S E+R   L++L +
Sbjct: 110 SNPNHIQCYCPATGQYIASF-PSKTKTELDDMIQRAEIAQSKWSTSSMERRLRVLTSLRE 168

Query: 93  LIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKFA 152
            I   Q+ +A++   D+GK     +  ++   +E  ++              P   N F 
Sbjct: 169 YILSNQEMIASIACRDSGKTKLDASMGEILVTLEKLQWLITHGPSVLKPSRRPGPTNFFM 228

Query: 153 YTLK------VPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFAT 206
              K       P GVV+ IV WNYP       +  +L  GN +++K +E    S   F  
Sbjct: 229 KWYKGAEIRYEPLGVVSAIVSWNYPFHNLWGPIIDSLFTGNAIVMKCSEQVVWSSEIFVQ 288

Query: 207 LIK----KAGFPPGVV--------NVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVL 254
           L++    + G  P ++        N+             +H     I+F GS +V   +L
Sbjct: 289 LLRECLIQCGEDPELIQLFYCLPPNLEEDSNEETANYFTSHKAFKSITFIGSQQVSHQIL 348

Query: 255 EASGQSNLKDITLECGGKSPALVFEDA-DLDKAIEWVANGIFFNSGQICTANSRVYVQSS 313
             + ++ +  + +E GGK   +V +   DL      +  G F +SGQ C    RV V   
Sbjct: 349 RCAAEA-ITPVVVELGGKDAFIVLDSVKDLQSISSIILRGTFQSSGQNCIGIERVIVSEK 407

Query: 314 IYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERG-KKEEKL-- 370
            Y   VE             G      +   VG +IS  ++D ++  ++    K  +L  
Sbjct: 408 NYATLVEILSNRMNASPMRQGSDIDSIDDIDVGAMISDNRFDELELLVKDAVSKGARLLC 467

Query: 371 --DMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLAN 428
               FQ  ++P    +G +  PT+  DV    K+ ++E+FGP++V+ +  + +  +KLAN
Sbjct: 468 GGSRFQHPKYP----QGNYFQPTLLVDVTPDMKIAQNEVFGPILVMMRANDTEHCIKLAN 523

Query: 429 DTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQ-TNQEEAKVPFGGFKMSGIGRESGDT 487
              +GL  +VF  ++++ +  A ++K G V IN        ++PFGG   SG G+  G+ 
Sbjct: 524 SAPFGLGGSVFGSNMQECNYVANELKTGNVAINDFATFYVCQLPFGGIHGSGYGKFGGEE 583

Query: 488 GVDNYLQIKSV 498
           G+      KSV
Sbjct: 584 GLLRLCNAKSV 594

>CAGL0D03982g 397039..398763 highly similar to sp|P07275
           Saccharomyces cerevisiae YHR037w PUT2
           1-pyrroline-5-carboxylate dehydrogenase, start by
           similarity
          Length = 574

 Score =  139 bits (349), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 226/511 (44%), Gaps = 38/511 (7%)

Query: 16  SLKQPLGLFINNEFCPSSDGKTI-ETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXX 74
           SL+ PL   IN E   +  G+ +    NPA  E + +                       
Sbjct: 57  SLEVPL--VINGERVYADRGRAVFAQTNPANHEQVLANVAQATRDDIKSAIGAAKQAKEK 114

Query: 75  WSKTSSEQRGIYLSNLLKLIEEEQ--DTLAALETLDAGKPFHSNAKQDLAQIIELTRY-- 130
           W       R         LI  +   D LAA   L  GK  +      + ++ +  R+  
Sbjct: 115 WYNMPFYDRAAIFMKAADLISTKYRYDMLAAT-MLGQGKNVYQAEIDCITELSDFFRFNV 173

Query: 131 -YAGAVDKFNMGETIPLTFNKFAYTLKVPF-GVVAQIVPWNYPLAMACRKMQGALAAGNT 188
            YA  +      E++P  +N+  Y    P  G V  + P+N+  A+A   +      GNT
Sbjct: 174 KYADELYATQPIESVPGIWNRAEYR---PLEGFVYAVSPFNF-TAIAANLIGAPALMGNT 229

Query: 189 VIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTK 248
           V+ KP++  +LS     T++++AG P GV+N +PG    +   +    D   + FTGST 
Sbjct: 230 VVWKPSQTAALSNYLLLTVLEEAGLPKGVINFVPGDPVEITDEVLASRDFSALHFTGSTA 289

Query: 249 V----GGSVLEASGQSNLKD---ITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQI 301
           V     G +     ++  +D   I  E GGK+  LV   A++  A+     G F   GQ 
Sbjct: 290 VFKQLYGKIQSGVAENKYRDYPRIVGETGGKNYHLVHPSANVPHAVFNTIRGAFEFQGQK 349

Query: 302 CTANSRVYVQSSIYDKFVEKFKETAKKEWDV-----AGKFDPFDEKCIVGPVISSTQYDR 356
           C+A SR+Y+  S+ ++F      T      V     A      +    +GPVI    +++
Sbjct: 350 CSATSRLYLPKSMSEEFFRDMFGTLSNNKVVPVNTSASAISGGNLHGFMGPVIHEQSFNK 409

Query: 357 IKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSK 416
           + + IE  KK+ +L++    ++    ++G++I PTI        K L  E FGP++ V +
Sbjct: 410 LSAAIEEAKKDPELEILYGGQY--DKSQGWYIGPTIIRTTNPNHKFLTTEFFGPILTVYE 467

Query: 417 F--TNYDDALKLANDTC-YGLASAVFTKDVKKAHMFARD---IKAGTVWINQ--TNQEEA 468
           +  + + D  +L N+T  YGL  ++F++D + A ++A +     AG  +IN   T    A
Sbjct: 468 YQDSQFKDICELINETGEYGLTGSIFSRD-RDAIIYASEKLRFSAGNFYINDKCTGAVVA 526

Query: 469 KVPFGGFKMSGIGRESGDTGV-DNYLQIKSV 498
           +  FGG +MSG   ++G   +   ++ I+S+
Sbjct: 527 QQWFGGARMSGTNDKAGGPSILSRFVSIRSI 557

>KLLA0C10549g 903888..905618 gi|31043861|emb|CAD91310.1
           Kluyveromyces lactis delta 1-pyrroline-5-carboxylate
           dehydrogenase, start by similarity
          Length = 576

 Score =  134 bits (338), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 114/402 (28%), Positives = 188/402 (46%), Gaps = 33/402 (8%)

Query: 120 DLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPF-GVVAQIVPWNYPLAMACRK 178
           +LA        YA  +      E+ P  +N+  Y    P  G V  + P+N+  A+A   
Sbjct: 168 ELADFFRFNVKYANELYAQQPIESSPGVWNRAEYR---PLEGFVYAVTPFNF-TAIAGNL 223

Query: 179 MQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDI 238
           +      GNTV+ KP++N +LS     T++++AG P GVVN +PG    V K + +  + 
Sbjct: 224 IGAPALMGNTVVWKPSQNANLSNYLLLTVLEEAGLPNGVVNFVPGNAVEVTKEVLSDSEF 283

Query: 239 DKISFTGSTKV----GGSVLEASGQSNLKD---ITLECGGKSPALVFEDADLDKAIEWVA 291
             + FTGST V     G + +       +D   I  E GGK+  L+   A++  ++    
Sbjct: 284 AALHFTGSTAVFKQLYGDIQKGVVNGLYRDYPRIVGETGGKNFHLIHPSANIPHSVLSTL 343

Query: 292 NGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDV---AGKFDPFDEKCIVGPV 348
            G F   GQ C+A SRVY+  S  ++F         +   V   A K +  D    +GPV
Sbjct: 344 RGAFEFQGQKCSATSRVYLPESKSEEFFRDLGGVLSEVQPVNTSASKINGGDLHGFIGPV 403

Query: 349 ISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGG----AKGYFIPPTIFTDVPETSKLLR 404
           I    +D++   I+  K + +L      E   GG    +KGY+I PTI          L 
Sbjct: 404 IHEGSFDKLAKVIDDAKNDPEL------EIVFGGFHDKSKGYYIQPTIIKTTNPRHPYLS 457

Query: 405 DEIFGPVVVVSKFTN--YDDALKLANDTC-YGLASAVFTKDVKKAHMFARDIK--AGTVW 459
            E FGP++ V ++ +  ++D  +L + T  YGL  ++F +D +   +    +K  AG  +
Sbjct: 458 QEFFGPILTVYEYPDAKFEDVCELVDSTSQYGLTGSIFARDREAIKIADEKLKYSAGNFY 517

Query: 460 IN--QTNQEEAKVPFGGFKMSGIGRESGDTGVDN-YLQIKSV 498
           IN   T    A+  FGG +MSG   ++G   + N ++ ++++
Sbjct: 518 INDKSTGAVVAQQWFGGARMSGTNDKAGSGNILNRFVSVRNI 559

>AAL071C [116] [Homologous to ScYHR037W (PUT2) - SH]
           (223170..224891) [1722 bp, 573 aa]
          Length = 573

 Score =  133 bits (334), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 134/503 (26%), Positives = 215/503 (42%), Gaps = 34/503 (6%)

Query: 23  LFINNE---FCPSSDGKTIETVNPATGEPITSFQXXXXXXXXXXXXXXXXXXXXXWSKTS 79
           L IN E   F  +   +  + VNPA    + +                       W +T 
Sbjct: 61  LVINGERIYFNDAGKRELFKQVNPARHTQVLAHVTQASREDVRAAVRAAQDAKQKWYETP 120

Query: 80  SEQRGIYLSNLLKLI--EEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRY---YAGA 134
              R         L+  +   D LAA   L  GK         + ++ +  R+   YA  
Sbjct: 121 FYDRAAVFLKAADLVATKYRYDMLAA-TMLGQGKNVQQAEIDCITELADFFRFNVKYAEE 179

Query: 135 VDKFNMGETIPLTFNKFAYTLKVPF-GVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKP 193
           + +    E+ P  +N+  Y    P  G V  + P+N+  A+A   +      GNTV+ KP
Sbjct: 180 LYQQQPAESSPGVWNRSEYR---PLEGFVYAVSPFNF-TAIAGNLVGAPALMGNTVVWKP 235

Query: 194 AENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKV---- 249
           ++N +LS     T++++AG P GV+N +PG    V + +     +  + FTGST V    
Sbjct: 236 SQNAALSNYLLLTVLEEAGLPRGVINFVPGNPVDVTEEVLADKALGGLHFTGSTAVFKQL 295

Query: 250 GGSVLEASGQSNLKD---ITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANS 306
            G + +       +D   I  E GGK+  LV   A+L  A+     G F   GQ C+A S
Sbjct: 296 YGKIQQGVVSGLYRDYPRIVGETGGKNFHLVHPSANLPHAVLSTLRGAFEFQGQKCSAAS 355

Query: 307 RVYVQSSIYDKFVEKFKETA---KKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIER 363
           R+Y+  S  D F+     T    K     A   +  D    +GPVI    +D++ + IER
Sbjct: 356 RLYLPQSKADAFLADLAGTLAAIKPANTSASSINGGDLHAFMGPVIHEQSFDKLAAAIER 415

Query: 364 GKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKF--TNYD 421
            + + +L++    +     ++GYF+ PT+          +  E FGP++ V ++    +D
Sbjct: 416 ARTDPELEILYGGDH--SKSQGYFVGPTVVRTSNPRHDFMTAEFFGPILTVYEYPDAQFD 473

Query: 422 DALKLANDT-CYGLASAVFTKDVKKAHMFARDIK--AGTVWINQ--TNQEEAKVPFGGFK 476
               L + T  YGL  AVF +D        R +K  AG  +IN   T    A+  FGG +
Sbjct: 474 QVCDLIDSTSAYGLTGAVFARDRDAIAAADRRLKYAAGNFYINDKATGAVVAQQWFGGAR 533

Query: 477 MSGIGRESGDTGV-DNYLQIKSV 498
           MSG   ++G   V   ++ ++SV
Sbjct: 534 MSGTNDKAGSPNVLSRFVSVRSV 556

>Kwal_23.5714
          Length = 576

 Score =  131 bits (329), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 113/398 (28%), Positives = 181/398 (45%), Gaps = 25/398 (6%)

Query: 120 DLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPF-GVVAQIVPWNYPLAMACRK 178
           +LA        YA  +      E+ P  +NK  Y    P  G V  + P+N+  A++   
Sbjct: 165 ELADFFRFNVKYASELYNQQPCESSPGVWNKAEYR---PLEGFVYAVTPFNF-TAISGNL 220

Query: 179 MQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDI 238
           +      GNTV+ KP++   LS     T++++AG P GVVN IPG    V  A+    + 
Sbjct: 221 IGAPALMGNTVVWKPSQAACLSNYLLLTVLEEAGLPHGVVNFIPGNPVEVTDAVLADKEF 280

Query: 239 DKISFTGSTKVGGSVLEASGQSNLKD-------ITLECGGKSPALVFEDADLDKAIEWVA 291
             + FTGST V   +     Q  + D       I  E GGK+  LV   A +  A+    
Sbjct: 281 AALHFTGSTAVFKQLYGKIQQGVVNDLYRDYPRIVGETGGKNFHLVHPSASIPHAVLSTL 340

Query: 292 NGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDV---AGKFDPFDEKCIVGPV 348
            G F   GQ C+A SR+Y+ +S   +F+E    T K+   V   A K +  D    +GPV
Sbjct: 341 RGAFEYQGQKCSAASRLYLPASRSAEFLEDLAGTLKEVRTVNTSASKLNGGDLHGFMGPV 400

Query: 349 ISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIF 408
           I    ++++ + +E  K + +L++    E     + G+FI PT+        K +  E F
Sbjct: 401 IHQQSFEKLANALEEAKNDPELEIICGGE--CDKSNGWFIEPTVVKTTNPLHKFMSTEFF 458

Query: 409 GPVVVVSKFTNYD---DALKLANDTCYGLASAVFTKDVKKAHMFARDIK--AGTVWINQ- 462
           GP++ V ++ + +       +   T YGL  AVF +D     +    +K  AG  +IN  
Sbjct: 459 GPLLTVCEYPDAEFTQVCETIDKTTSYGLTGAVFARDRDAIAIADEKLKYSAGNFYINDK 518

Query: 463 -TNQEEAKVPFGGFKMSGIGRESGDTGV-DNYLQIKSV 498
            T     +  FGG +MSG   ++G   +   ++ I++V
Sbjct: 519 CTGAVVGQQWFGGARMSGTDDKAGSGNILSRFVSIRNV 556

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score =  130 bits (327), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 120/420 (28%), Positives = 197/420 (46%), Gaps = 43/420 (10%)

Query: 80  SEQRGIYLSNLL-KLIEEEQDTLAALETLDAGKPFHSNAKQDLA----QIIELTRYYAGA 134
           ++QR  +L  L   + + E+  L ALE     K FH + ++ ++    +++    +    
Sbjct: 42  NKQRQFWLKKLYWSVKDHEEQILEALE-----KDFHRSRQESISLEYVKLLGDILHLIEG 96

Query: 135 VDKFNMGETI-----PLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTV 189
           + K+N  + +     P  F       K+  G V  I P+N+P+ +A   +  AL+AGNTV
Sbjct: 97  IPKWNKPKKVRDNSAPFMFGNINIE-KISRGNVLVISPFNFPVLLALAPVACALSAGNTV 155

Query: 190 IIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKV 249
           I+KP+E T    L    ++K    P GV+ ++ G      K + +   +D I +TGS +V
Sbjct: 156 ILKPSEMTPHCALVLEDIVKSCQLPEGVLQIVQGGVEQTTKLINSE-SLDMIFYTGSPRV 214

Query: 250 GGSVLEASGQSNLKDITLECGGKSPALV---FEDADLDKAIEWVANGIFFNSGQICTANS 306
           G  V +A+ + NL    LE GGKSP  +    +  +L+ A++ +  G F N+GQIC +  
Sbjct: 215 GSIVAQAAAK-NLVPCVLELGGKSPTFITGSLQKKNLETALKRIFFGAFGNAGQICVSPD 273

Query: 307 RVYVQSSIYDKFVEKFKETAKKEWDVAGKFDP-FDEKCIVGPVISSTQYDRIKSYIERGK 365
            + V  SIYD  V   KE+ K    V  +  P  +E      +I    YD+    +++ K
Sbjct: 274 YLLVHESIYDDVV---KESGK----VMKELYPDLNEHTEYTHMIHKASYDKTLEKLQKTK 326

Query: 366 KEEKLDMFQTSEFPIGGAKG-YFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYD--- 421
             +       ++  I    G   IPPTI  D      L+ +E F PV+ V K+T+ D   
Sbjct: 327 GRK----VSAADVKIDNTSGKLMIPPTIVFDSDWDDALMEEENFAPVLPVIKYTDIDATI 382

Query: 422 DALKLANDTCYGLASAVFTKDVKKA-HMFARDIKAGTVWINQTNQEEA--KVPFGGFKMS 478
           D +   +DT   L   +F++  K+  H+ AR +++G   I  T         PFGG   S
Sbjct: 383 DKILSKHDT--PLVQYIFSEKQKEIDHILAR-LRSGDCIICDTTIHVGIKDAPFGGIGQS 439

>Scas_717.74
          Length = 522

 Score =  129 bits (323), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 103/329 (31%), Positives = 161/329 (48%), Gaps = 28/329 (8%)

Query: 156 KVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPP 215
           K+  G V  I P+N+P+ +A   +  A+ AGN+VI+KP+E T+ + L    +I++AGFP 
Sbjct: 121 KIARGNVLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRIIEEAGFPD 180

Query: 216 GVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPA 275
           G+V V+ G      + L T  D+D I +TGS  V GS++      NL    LE GGKSP 
Sbjct: 181 GLVQVVQGAIDETQR-LITSKDLDMIFYTGSPTV-GSIIAQEAAKNLTPCVLELGGKSPT 238

Query: 276 LV---FEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDV 332
            +   F D +L  A++ +  G F NSGQIC +   + V  S Y+K     KE       +
Sbjct: 239 FITENFNDKNLKTALKRIFFGAFGNSGQICVSPDYLLVHESKYNKVAALAKEV------L 292

Query: 333 AGKFDPFDEKCIVGPVISSTQYDRIKSYIE--RGKK-EEKLDMFQTSEFPIGGAKGYFIP 389
              F   ++      +IS T Y+     +E   G+K + K D+  T+           +P
Sbjct: 293 IEMFPEVNDSTEFTHLISETAYNTTLKKLEATSGEKFQAKSDLSDTN---------ICVP 343

Query: 390 PTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDAL-KLANDTCYGLASAVFTKDVKK-AH 447
           PT+  +       ++ E F P++ V K++N DD L K+       L   +F+   ++ +H
Sbjct: 344 PTLIFNCQWEDSTMQQENFAPILPVLKYSNLDDTLDKIIATHNNPLVQYIFSDSNEEISH 403

Query: 448 MFARDIKAGTVWINQTNQEEA--KVPFGG 474
           +  R +K+G   IN T         PFGG
Sbjct: 404 ILLR-LKSGDCVINDTILHVGIQDAPFGG 431

>Scas_690.41
          Length = 581

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 100/351 (28%), Positives = 168/351 (47%), Gaps = 22/351 (6%)

Query: 160 GVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVN 219
           G +  + P+N+  A+A   +      GNTVI KP+++ +LS     T++++AG P GV+N
Sbjct: 210 GFIYAVSPFNF-TAIAANLIGAPALMGNTVIWKPSQSAALSNYLLLTVLEEAGLPKGVIN 268

Query: 220 VIPGYGSVVGKALGTHMDIDKISFTGSTKV----GGSVLEASGQSNLKD---ITLECGGK 272
            +PG   +V   L    +   + FTGST+V     G +         +D   I  E GGK
Sbjct: 269 FVPGDPILVTDQLLASKEFGGLHFTGSTQVFKQLYGKIQTGVVNGLYRDYPRIVGETGGK 328

Query: 273 SPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEW-- 330
           +  L+ + A++  A+     G F   GQ C+A SR+Y+  S  ++F      T +++   
Sbjct: 329 NFHLIHKSANIPNAVFSTIRGAFEFQGQKCSATSRLYIPQSKSEEFFRDLIGTLQQQKVT 388

Query: 331 ---DVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYF 387
                A      D    +GPVI    Y+++   IE  K + +L++    ++  G  +G+F
Sbjct: 389 PVNTAASPISGGDLHGFMGPVIHEQSYNKLIKVIEEAKTDPELEIIYGGQYDKG--EGWF 446

Query: 388 IPPTIFTDVPETSKLLRDEIFGPVVVVSKFTN--YDDALKLANDTC-YGLASAVFTKDVK 444
           + PTI        K +  E FGP++ V ++ +  + +   L + T  YGL  +VF KD +
Sbjct: 447 VGPTIIKCKDPKHKFMTTEFFGPILSVYEYPDNKFSETCDLIDQTSMYGLTGSVFAKDRE 506

Query: 445 KAHMFARDIK--AGTVWINQ--TNQEEAKVPFGGFKMSGIGRESGDTGVDN 491
             ++    +K   G  +IN   T    A+  FGG +MSG   +SG   + N
Sbjct: 507 AINLADEKLKFSCGNFYINDKCTGAVVAQQWFGGARMSGTDDKSGGPSILN 557

>KLLA0B12540g 1094239..1095804 similar to sp|Q04458 Saccharomyces
           cerevisiae YMR110c, start by similarity
          Length = 521

 Score =  125 bits (313), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 104/340 (30%), Positives = 155/340 (45%), Gaps = 29/340 (8%)

Query: 156 KVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPP 215
           K+  G V  I P+N+P+ +A   + GA+A GN+V+ KP+E T         +  +A F  
Sbjct: 121 KIALGTVLVISPFNFPILLALDPLAGAIAGGNSVVFKPSELTPACAEVMEEICNEA-FEK 179

Query: 216 GVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPA 275
           G V  + G G+    AL      DKI +TGST VG  + E + +S L    LE GGKSP 
Sbjct: 180 GQVETVQG-GAEETSALVESGKFDKIFYTGSTTVGTIIAEKAAKS-LTPCVLELGGKSPV 237

Query: 276 LV---FEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDV 332
            +      +  + AI  +      N+GQIC A   V    SIYD+FV+  K+   + +  
Sbjct: 238 FISPNLPKSQWETAIRRIYYSSMGNAGQICVAADYVLCPDSIYDEFVDSCKKVLNEFYPS 297

Query: 333 AGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTI 392
                 +        +I    Y+RI++ IE  K ++ +     +  P+       IPPTI
Sbjct: 298 VTSDTEYTH------MIHERAYNRIQTVIETTKGQKTVAQHSDNLPPLC------IPPTI 345

Query: 393 FTDVPETSKLLRDEIFGPVVVVSKFTNYD---DALKLANDTCYGLASAVFTKDVKKAHMF 449
            +DV      +  E FGP++ + ++T+ D   D L    DT   L   +FT    +    
Sbjct: 346 ISDVSWDDPSMTGENFGPILPIMRYTDLDETIDTLIKRFDT--PLVQYIFTNSKDEIDHI 403

Query: 450 ARDIKAGTVWINQT----NQEEAKVPFGGFKMSGIGRESG 485
              I++G   +N T      EEA  PFGG   SG G   G
Sbjct: 404 LTRIRSGACVVNDTLLHVGIEEA--PFGGIGTSGYGNYHG 441

>YHR037W (PUT2) [2324] chr8 (181969..183696)
           Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C
           dehydrogenase), carries out the second step in proline
           degradation, allows proline to be used as a nitrogen
           source [1728 bp, 575 aa]
          Length = 575

 Score =  125 bits (314), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 115/410 (28%), Positives = 190/410 (46%), Gaps = 30/410 (7%)

Query: 99  DTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAG-AVDKFNMG--ETIPLTFNKFAYTL 155
           D LAA   L  GK  +      + ++ +  RYY   A D +     E+   T+NK  Y  
Sbjct: 142 DMLAA-TMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYR- 199

Query: 156 KVPF-GVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFP 214
             P  G V  + P+N+  A+A   +      GNTV+ KP++  +LS     T++++AG P
Sbjct: 200 --PLEGFVYAVSPFNF-TAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLP 256

Query: 215 PGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKV----GGSVLEASGQSNLKD---ITL 267
            GV+N IPG    V   +    D   + FTGST V     G +     +   +D   I  
Sbjct: 257 KGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIG 316

Query: 268 ECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAK 327
           E GGK+  LV   A++  A+     G F   GQ C+A SR+Y+  S  ++F+       +
Sbjct: 317 ETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQ 376

Query: 328 KEWDV-----AGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGG 382
            +  V     A      + +  +GPVI    +D++   IE  KK+ +L++    ++    
Sbjct: 377 SQNVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPELEILYGGQY--DK 434

Query: 383 AKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKF--TNYDDALKLANDTC-YGLASAVF 439
           ++G+F+ PT+          +  E FGP++ V ++  T +++   + ++T  Y L  A+F
Sbjct: 435 SQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNTSQYALTGAIF 494

Query: 440 TKDVKKAHMFARDIK--AGTVWINQ--TNQEEAKVPFGGFKMSGIGRESG 485
            KD K        +K  AG  +IN   T    ++  FGG +MSG   ++G
Sbjct: 495 AKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAG 544

>Kwal_26.7595
          Length = 524

 Score =  119 bits (297), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 101/349 (28%), Positives = 157/349 (44%), Gaps = 21/349 (6%)

Query: 156 KVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPP 215
           +   G V  I P+NYP+ ++   + GA+A GN+V+ KP+E    + +    ++K +    
Sbjct: 120 RTSLGAVLVISPFNYPVLLSLDPIAGAIAGGNSVVWKPSELVPATSIILEQILKDS-LGS 178

Query: 216 GVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPA 275
             ++V+ G      K L  +   DKI +TGST VG  V   +G+ NL   TLE GGKSP 
Sbjct: 179 DWISVVQGAIPETTK-LIKNAQFDKIFYTGSTAVGSIVALEAGK-NLVPYTLELGGKSPV 236

Query: 276 LV---FEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDV 332
            +   F  + +  A+  V  G F NSGQ C A+  V V SS  +   +  +E   + W  
Sbjct: 237 FITEHFSKSKIRAALSRVYFGAFSNSGQTCVASDYVLVHSSQEELVKQLTREILDEFW-- 294

Query: 333 AGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTI 392
                  DE      +I    Y+         KK E  +  +     +G      IPPT+
Sbjct: 295 ----PQLDENTEYTSMIHERAYNNTV------KKLENTNGIKILPSNVGSLPERCIPPTV 344

Query: 393 FTDVPETSKLLRDEIFGPVVVVSKFTNYDDAL-KLANDTCYGLASAVFTKDVKKAHMFAR 451
             DV     L+++E F PV+    ++N D A+ K+     Y LA  +F+ + ++      
Sbjct: 345 VFDVDWDDALMKEENFAPVLPFVTYSNLDSAISKVVELHNYPLALYIFSDNRREIDQIMF 404

Query: 452 DIKAGTVWINQTNQEEAKV--PFGGFKMSGIGRESGDTGVDNYLQIKSV 498
            IK+G   I  T    A +  PFGG + SG G   G      +   ++V
Sbjct: 405 QIKSGGCVIGDTVIHVAAMDAPFGGIRSSGSGNYHGKWSFSTFTHERTV 453

>YMR110C (YMR110C) [4067] chr13 complement(490393..491991) Protein
           with similarity to aldehyde dehydrogenases [1599 bp, 532
           aa]
          Length = 532

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 115/431 (26%), Positives = 194/431 (45%), Gaps = 58/431 (13%)

Query: 77  KTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAG-KPFHSNAKQ-----------DLAQI 124
           K   E R + L  L   +++ ++     E +DA  K FH N  +           D+  +
Sbjct: 43  KKDLEFRQLQLKKLYYAVKDHEE-----ELIDAMYKDFHRNKIESVLNETTKLMNDILHL 97

Query: 125 IELT------RYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRK 178
           IE+       R  + +   F  G+TI           K+  G V  I P+N+PL +A   
Sbjct: 98  IEILPKLIKPRRVSDSSPPFMFGKTI---------VEKISRGSVLIIAPFNFPLLLAFAP 148

Query: 179 MQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDI 238
           +  ALAAGNT+++KP+E T  + +    L+  AGFP G++ V+ G      + L      
Sbjct: 149 LAAALAAGNTIVLKPSELTPHTAVVMENLLTTAGFPDGLIQVVQGAIDETTRLLDCG-KF 207

Query: 239 DKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALV---FEDADLDKAIEWVANGIF 295
           D I +TGS +VG  V E + +S L    LE GGKSP  +   F+ +++  A++ +  G F
Sbjct: 208 DLIFYTGSPRVGSIVAEKAAKS-LTPCVLELGGKSPTFITENFKASNIKIALKRIFFGAF 266

Query: 296 FNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDP-FDEKCIVGPVISSTQY 354
            NSGQIC +   + V  SIY K +++ +        V  +F P FDE+     +I    Y
Sbjct: 267 GNSGQICVSPDYLLVHKSIYPKVIKECES-------VLNEFYPSFDEQTDFTRMIHEPAY 319

Query: 355 DRIKSYIE--RGKK--EEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGP 410
            +  + I    G K    K+ +   +E          +PPTI  ++     L++ E F P
Sbjct: 320 KKAVASINSTNGSKIVPSKISINSDTE------DLCLVPPTIVYNIGWDDPLMKQENFAP 373

Query: 411 VVVVSKFTNYDDAL-KLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQT--NQEE 467
           V+ + ++ + D+ + K+  +    L   +F+    + +     +++G   +  T  +   
Sbjct: 374 VLPIIEYEDLDETINKIIEEHDTPLVQYIFSDSQTEINRILTRLRSGDCVVGDTVIHVGI 433

Query: 468 AKVPFGGFKMS 478
              PFGG   S
Sbjct: 434 TDAPFGGIGTS 444

>CAGL0L02123g complement(246322..249414) similar to sp|P18480
            Saccharomyces cerevisiae YBR289w SNF5, start by
            similarity
          Length = 1030

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 10/130 (7%)

Query: 239  DKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNS 298
            ++++ T   +V  +  EA   S+    ++E G KSP         ++  E  +N     S
Sbjct: 895  EQVNGTPPLEVNTTQKEAKSPSDEVPQSIESGMKSPE--------EENKEGSSNDNRLES 946

Query: 299  GQICTANSRVYVQSSIYDKFVEKFKETAK--KEWDVAGKFDPFDEKCIVGPVISSTQYDR 356
              I T+N      + +  K  E+ +   K  KE +VAGK +   E   +G   S  QYD 
Sbjct: 947  ENINTSNENDNADTEVAGKDNEETEVAGKDNKETEVAGKDNEETEATRMGSEESGNQYDD 1006

Query: 357  IKSYIERGKK 366
             +++ E  +K
Sbjct: 1007 NQTHNETTEK 1016

>KLLA0F03168g 294261..295817 similar to sgd|S0005479 Saccharomyces
           cerevisiae YOL119c, start by similarity
          Length = 518

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 84  GIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDL 121
           G+ L+  + LI+E+ +  AA+E  DA  PFH N   ++
Sbjct: 254 GVCLTVSMFLIKEDPEKRAAVEPKDASTPFHKNLLYNI 291

>CAGL0L12210g complement(1312969..1321914) similar to tr|Q12150
           Saccharomyces cerevisiae YLR087c, hypothetical start
          Length = 2981

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 315 YDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQ 374
           +D F++K+K  +    D+ G+FD FD+   +   ISS +Y +  S ++  +     D   
Sbjct: 354 HDNFMQKWKGLSMYRNDMFGEFDEFDD---IEFDISSHEYAKFTSLLKSPRVTIHHDYDM 410

Query: 375 TSEFPIGGAKGYFIPPTIFTDVPE 398
               P G       PP+ + D P+
Sbjct: 411 PGWVPHGAH-----PPSSYADGPD 429

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,057,782
Number of extensions: 693198
Number of successful extensions: 1948
Number of sequences better than 10.0: 57
Number of HSP's gapped: 1771
Number of HSP's successfully gapped: 57
Length of query: 498
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 392
Effective length of database: 12,926,601
Effective search space: 5067227592
Effective search space used: 5067227592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)