Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR105C (PGM2)56955928260.0
Scas_717.7056955824000.0
CAGL0K07480g56755723660.0
Scas_721.12356955823640.0
CAGL0K03421g56855623630.0
YKL127W (PGM1)57056022660.0
Kwal_26.762857055721950.0
Sklu_2430.457156021750.0
KLLA0B12694g56856021010.0
ABL029W56855920390.0
ABL126W624378740.65
KLLA0F14861g58943711.7
YMR278W622195692.8
Kwal_55.2015452242683.6
Scas_657.1254973649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR105C
         (559 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...  1093   0.0  
Scas_717.70                                                           929   0.0  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...   915   0.0  
Scas_721.123                                                          915   0.0  
CAGL0K03421g complement(313851..315557) highly similar to sp|P37...   914   0.0  
YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...   877   0.0  
Kwal_26.7628                                                          850   0.0  
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                           842   0.0  
KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...   813   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   790   0.0  
ABL126W [466] [Homologous to ScYMR278W - SH] complement(159209.....    33   0.65 
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    32   1.7  
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    31   2.8  
Kwal_55.20154                                                          31   3.6  
Scas_657.12                                                            29   9.9  

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/559 (95%), Positives = 532/559 (95%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG
Sbjct: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120
           GDGRYYNDVILH             LVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120

Query: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180
           NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG
Sbjct: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180

Query: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240
           PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD
Sbjct: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240

Query: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300
           EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG
Sbjct: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300

Query: 301 YGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360
           YGPSFVSPGDSV              KQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG
Sbjct: 301 YGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420

Query: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG 480
           IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG
Sbjct: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG 480

Query: 481 DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE 540
           DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE
Sbjct: 481 DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE 540

Query: 541 EYLKPIINSVIKFLNFKQV 559
           EYLKPIINSVIKFLNFKQV
Sbjct: 541 EYLKPIINSVIKFLNFKQV 559

>Scas_717.70
          Length = 569

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/558 (79%), Positives = 480/558 (86%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MSFQI+TVPTKPY+DQKPGTSGLRKKTK+FKD PNYTENFIQ+IM+AIPEGSKGATLVVG
Sbjct: 1   MSFQIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120
           GDGRYYNDVILH             LVIGQ GLLSTPAASHIMRTYEEK  GGIILTASH
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTYEEKTQGGIILTASH 120

Query: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180
           NPGG +NDMGIK+NLSNGGPAPE VTN IWEISKK+TS+KIIKDFPEL+L T+GKNKKYG
Sbjct: 121 NPGGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYG 180

Query: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240
           PLLVD+ID TK YV F+K+IFDFDLIKKF+  QR TK+WKLLFD MNGVTGPYGKAIFVD
Sbjct: 181 PLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVD 240

Query: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300
           E GLPADEVLQ WHPSPDFGG+HPDPNLTYA +LV RVDRE IEFGAASDGDGDRNMIYG
Sbjct: 241 ELGLPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIYG 300

Query: 301 YGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360
            GP+FVSPGDSV              KQGIYGLARSFPTS AIDRVAKAHGLNCYEVPTG
Sbjct: 301 AGPAFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDG+WAI+AWLN+LAIYNKHHP+ + SIK 
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIKI 420

Query: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG 480
           IQ+EFW KYGRTFFTRYD+EKV TE A K++D LR +V     VN  FP DESL V + G
Sbjct: 421 IQDEFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHVESKTFVNHKFPTDESLTVVEAG 480

Query: 481 DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE 540
           DFSYTDLDGSVS HQGL+ KLSNGAR V+RLSGTGSSGATIRLY+EKY DDKS Y + A+
Sbjct: 481 DFSYTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQNAQ 540

Query: 541 EYLKPIINSVIKFLNFKQ 558
            YLKP+I SV+KFLNFK+
Sbjct: 541 VYLKPVIQSVVKFLNFKE 558

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/557 (77%), Positives = 482/557 (86%)

Query: 3   FQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVGGD 62
            Q+ETVPTKPY+DQKPGTSGLRKKTKVF +EPNYTENFIQ+IM+AIPEG+K A LVVGGD
Sbjct: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60

Query: 63  GRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNP 122
           GR+YNDVI+              L+IGQ+GLLSTPAASH++R+Y EKCTGGIILTASHNP
Sbjct: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120

Query: 123 GGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPL 182
           GGPEND+GIKYNL+NGGPAPE VTN +WE+SK+LT YKIIKDFP++D   IGK+++YGPL
Sbjct: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180

Query: 183 LVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEF 242
           LVDIID T+DYV F+KEIFDF LIK+FI  QR  KNWKLLFDS+NG+TGPYGKAIFVDEF
Sbjct: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEF 240

Query: 243 GLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYGYG 302
            LPADEVLQNWHP PDFGG+HPDPNLTYA +LV+RVDREKIEFGAASDGDGDRNMIYG G
Sbjct: 241 DLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGAG 300

Query: 303 PSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTGWK 362
           P+FVSPGDSV              KQGIYGLARSFPTSGAIDRVAKA GLNCYEVPTGWK
Sbjct: 301 PAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGWK 360

Query: 363 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQ 422
           FFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YNKH+PE EASIKTIQ
Sbjct: 361 FFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTIQ 420

Query: 423 NEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCGDF 482
            EFWAKYGRTFFTRYD+E + TEKANK+VD L  +V      N+ FP DESL V+DCGDF
Sbjct: 421 EEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGDF 480

Query: 483 SYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAEEY 542
           SYTDLDGSVSDHQGL+VKLSNGARFVLRLSGTGS+GATIRLYIE+Y DDKS Y ++A++Y
Sbjct: 481 SYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQY 540

Query: 543 LKPIINSVIKFLNFKQV 559
           L+ +I SV  FLNFK++
Sbjct: 541 LQKMIKSVTSFLNFKEL 557

>Scas_721.123
          Length = 569

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/558 (76%), Positives = 488/558 (87%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MS QIET+ TKPY+DQKPGTSGLRKKT +F +EPNYTENFIQ++++AIPEGS+ ATLVVG
Sbjct: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120
           GDGR+YNDVI++             L+IGQ+GLLSTPAASHI+R+YEEK TGGIILTASH
Sbjct: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120

Query: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180
           NPGGPEND+GIKYNL+NGGPAPESVTNAIWE+SKKLT YKIIK+FP LDL  +GK++KYG
Sbjct: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180

Query: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240
           PLLVDIID+TKDYV+FLKEIFDF+LIKKFI  QR TKNWKLLFDS+NG+TGPYGKAIFVD
Sbjct: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240

Query: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300
           EF LPA+EVLQNWHP PDFGG+HPDPNLTYA +LV+RVDREKIEFGAASDGDGDRNMIYG
Sbjct: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300

Query: 301 YGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360
            GP+FVSPGDSV              KQGIYGLARSFPTS AIDRVAKAHGL+CYEVPTG
Sbjct: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYNKH+PE +ASIKT
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420

Query: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG 480
           IQ EFW KYGRTFFTRYD+E +  E A+K+VD L  +V+K  V+ SAFP DESL V D G
Sbjct: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDAG 480

Query: 481 DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE 540
           DFSYTDLDGSVSDHQGL+ KLSNGAR VLRLSGTGSSGATIR+Y+E Y DDK++Y+++A+
Sbjct: 481 DFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESAQ 540

Query: 541 EYLKPIINSVIKFLNFKQ 558
           ++L P I +V+KFL FK+
Sbjct: 541 DFLAPTIKTVVKFLKFKE 558

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/556 (77%), Positives = 475/556 (85%)

Query: 4   QIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVGGDG 63
           QIE+VPTKPY+DQKPGTSGLRKKTKVF+D+PNY ENFIQS+MEAIPEG+KGA LVVGGDG
Sbjct: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62

Query: 64  RYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNPG 123
           RYYNDVIL              LVIGQ+GLLSTPAASHIMRTY+EKCTGGIILTASHNPG
Sbjct: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPG 122

Query: 124 GPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLL 183
           GPENDMGIKYNLSNGGPAPE VTN IWEISKKLT YKI+KDFPELDL  + +NKKYGPLL
Sbjct: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182

Query: 184 VDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFG 243
           VD+ID T  Y+  LKEIFDF+LI KFI  QR  K WKLL DSMNGVTGPY KAIFVDEFG
Sbjct: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242

Query: 244 LPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYGYGP 303
           L + EVLQNWHP PDFGG+HPDPNLTYA +LV+RV++EKIEFGAASDGDGDRNMIYGYGP
Sbjct: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302

Query: 304 SFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTGWKF 363
           +FVSPGDSV              KQGIYGLARSFPT+ AIDRVAK HGLNCYEVPTGWKF
Sbjct: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362

Query: 364 FCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQN 423
           FCALFDAKKLSICGEESFGTGSNHVREKDG+WAIMAWLNILAI+N+ HP+ EASIKTIQN
Sbjct: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422

Query: 424 EFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCGDFS 483
           EFW  YGRTFFTRYD+EKVET+KANK+++ LR YV  SG   S FP D +L V D GDFS
Sbjct: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482

Query: 484 YTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAEEYL 543
           YTDLDG++S HQGLYV LSNGARFV+RLSGTGSSGATIRLYIE+Y DDKS+Y   A+EYL
Sbjct: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542

Query: 544 KPIINSVIKFLNFKQV 559
           KPII S+++FL+ K +
Sbjct: 543 KPIIKSIVQFLDLKTI 558

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/560 (74%), Positives = 472/560 (84%), Gaps = 1/560 (0%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MS  I++VPT  Y+DQKPGTSGLRKKTKVF DEP+YTENFIQ+ M++IP GS+G TLVVG
Sbjct: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGG-IILTAS 119
           GDGR+YNDVI++             LVIGQ GLLSTPAASHI+RTYEEKCTGG IILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120

Query: 120 HNPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKY 179
           HNPGGPEND+GIKYNL NGGPAPESVTNAIWE SKKLT YKIIK+FP+L+L  +GKN+KY
Sbjct: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY 180

Query: 180 GPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFV 239
           GPLLVDIID  K YV FLKEIFDFDLIK F+  QR  K WKLLFDS+NG+TGPYGKAIFV
Sbjct: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240

Query: 240 DEFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIY 299
           DEFGLPA+EVLQNWHP PDFGG+HPDPNLTYA +LV RVDREKI FGAASDGDGDRNMIY
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300

Query: 300 GYGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPT 359
           GYGP+FVSPGDSV              KQGIYGLARSFPTS AIDRVA   GL CYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360

Query: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIK 419
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLNILAIY++ +PE EASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK 420

Query: 420 TIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDC 479
           TIQ+EFW +YGRTFFTRYD+E +E E+A K+V  L  +V++  V  S FPADESL V DC
Sbjct: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480

Query: 480 GDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTA 539
           GDFSY DLDGS+S++QGL+VK SNG +FVLRLSGTGSSGATIRLY+EKY D K  Y +TA
Sbjct: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540

Query: 540 EEYLKPIINSVIKFLNFKQV 559
           + +LKP+INS++KFL FK++
Sbjct: 541 DVFLKPVINSIVKFLRFKEI 560

>Kwal_26.7628
          Length = 570

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/557 (72%), Positives = 464/557 (83%), Gaps = 1/557 (0%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MS  IE+VPTKP++DQKPGTSGLRKKTKVFKDEP+YTENFIQ+I+EAIPEGS+ ATLVVG
Sbjct: 1   MSLTIESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120
           GDGRYYN+ ++              +++GQ+G+LSTPAASHI+R+Y EKCTGGIILTASH
Sbjct: 61  GDGRYYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPEKCTGGIILTASH 120

Query: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180
           NPGGPEND GIKYNLSNGGPAPESVTNAI+E SK+LT YKI+K+FP++D   IGK++KYG
Sbjct: 121 NPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKYG 180

Query: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240
           PLLVD++D T DYV  +KEIFDFDLIKKFIDNQRSTK +K+LFDS+NGVTGPYG+AIFV 
Sbjct: 181 PLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVK 240

Query: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300
           E GLPA+EVLQN+ P PDFGG+HPDPNLTYA +LV+RVD+E+I FGAASDGDGDRNMIYG
Sbjct: 241 ELGLPAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIYG 300

Query: 301 YGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360
            GP+FVSPGDSV              KQGIYGLARSFPTS AIDRVAK  GL CYEVPTG
Sbjct: 301 CGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPTG 360

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAI+AWLNILAIYN+ HP+++ SIK 
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIKV 420

Query: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYV-TKSGVVNSAFPADESLKVTDC 479
           IQ +FWAKYGRTFFTRYDFE+V +E A +++  L   V  K   V   F  + +L V DC
Sbjct: 421 IQEKFWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVADC 480

Query: 480 GDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTA 539
           GDFSYTDLDGSVS+HQGLY KLSNG RFV+RLSGTGSSGATIRLY+EKY DD S+Y    
Sbjct: 481 GDFSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLDV 540

Query: 540 EEYLKPIINSVIKFLNF 556
           E++L   I S++KFL F
Sbjct: 541 EQFLGDDIKSILKFLKF 557

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/560 (72%), Positives = 464/560 (82%), Gaps = 2/560 (0%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MSF+IET+PT PY DQKPGTSGLRKKTKVF +EPNYTENFIQ++M+AIPEGS+ ATLVVG
Sbjct: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTY-EEKCTGGIILTAS 119
           GDGR+YNDV++              LVIGQ+G+LSTPAASHI+RTY   K TGGIILTAS
Sbjct: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120

Query: 120 HNPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKY 179
           HNPGG +ND GIKYNLSNGGPAPESVTN I+E SK+LTSYKI+ +FP+LDL   G +++Y
Sbjct: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180

Query: 180 GPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFV 239
           GPLLVDIID T+ YV  +K IFDFDLIKKFI  Q+ T  +KLLFDS+NGVTGPYGKA+FV
Sbjct: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240

Query: 240 DEFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIY 299
           DE GL A+E LQN+ P PDFGG+HPDPNLTYA +LV+RVD++KI FGAASDGDGDRNMIY
Sbjct: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300

Query: 300 GYGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPT 359
           GYGP+FVSPGDSV              KQGIYGLARSFPTS AIDRVAKAHGLNCYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360

Query: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIK 419
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYN+ +P  EASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420

Query: 420 TIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKS-GVVNSAFPADESLKVTD 478
           TIQ EFW KYGRTFFTRYDFE++ +E A+K++  L  +V+K   VVN AFPA   L V D
Sbjct: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480

Query: 479 CGDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKT 538
            GDFSYTDLDGSVS +QGL+VKLSNG +FV+RLSGTGSSGATIRLY+E+Y D+KS Y  T
Sbjct: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540

Query: 539 AEEYLKPIINSVIKFLNFKQ 558
           A+++L   I  V++FL FK+
Sbjct: 541 ADQFLGNDIKHVLQFLKFKE 560

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/560 (69%), Positives = 453/560 (80%), Gaps = 3/560 (0%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MS +  +V T PY DQKPGTSGLRKKTKVF++ PNYTENFIQ+IMEAIPEGS+GATLV+G
Sbjct: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120
           GDGRYYNDV++              +VIG +G+LSTPAASHI+R Y EKCTGGIILTASH
Sbjct: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120

Query: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180
           NPGGP ND GIKYNL+NGGPAPESVTN+IW  S++LT YKI++ FP +DL  IG+++KYG
Sbjct: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180

Query: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240
            LLVDI+D T  YV  +KEIFDF LIK FID Q +   +K+LFD+MNGVTGPYG+A+FV 
Sbjct: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQ-AKNGFKILFDAMNGVTGPYGEALFVK 239

Query: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300
           E GLP +  LQN+HP PDFGG+HPDPNLTYA +LV+RVD+  I+FGAASDGDGDRNMIYG
Sbjct: 240 ELGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYG 298

Query: 301 YGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360
            GP+FVSPGDSV              KQGIYGLARSFPTS AIDRVAK  GLNCYEVPTG
Sbjct: 299 AGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTG 358

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYN+  P  EASIK+
Sbjct: 359 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKS 418

Query: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTK-SGVVNSAFPADESLKVTDC 479
           IQ +FW KYGRTFFTRYDFE + +E A K++  L+ YV     +  + FPAD+SL V + 
Sbjct: 419 IQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEG 478

Query: 480 GDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTA 539
           GDFSYTDLDGSVS HQGLYV+LSNG RFV+RLSGTGSSGATIRLY+E+Y +D S+Y++TA
Sbjct: 479 GDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTA 538

Query: 540 EEYLKPIINSVIKFLNFKQV 559
           EE+L   I +++KFL FK+ 
Sbjct: 539 EEFLGKDIKTILKFLKFKEA 558

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/559 (66%), Positives = 447/559 (79%), Gaps = 1/559 (0%)

Query: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60
           MS  IE+VPTK + DQKPGTSGLRKKTKVF+   +YTENFIQ+IME+IPEGS+ A LV+G
Sbjct: 1   MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIG 60

Query: 61  GDGRYYNDVILHXXXXXXXXXXXXXLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120
           GDGRYYND ++              L+IGQ+GLLSTPAASHI+RTY +K TGGIILTASH
Sbjct: 61  GDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTYHDKVTGGIILTASH 120

Query: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180
           NPGGP+ND GIKYNL+NG PAPE VTN+++E S+ LT YKI +  P+LDLG IG+N++YG
Sbjct: 121 NPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYG 180

Query: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240
            LLVD+ID T+ YV  +KEIFDF LIKKF+++ +     K+LFD++NG+TGPYGKAIFVD
Sbjct: 181 NLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVD 240

Query: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300
           E GL  D  LQN+ P PDFGG+HPDPNLTYA +LV RVDRE I FGAASDGDGDRNMIYG
Sbjct: 241 ELGLSEDS-LQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIYG 299

Query: 301 YGPSFVSPGDSVXXXXXXXXXXXXXXKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360
            GP+FVSPGDSV              K GI+GLARSFPTSGAID VAK   L+CYEVPTG
Sbjct: 300 AGPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPTG 359

Query: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420
           WKFFC LFD+KKLSICGEESFGTGS+HVREKDG+WAI+AWLN+LAIY++ HP+ E SIKT
Sbjct: 360 WKFFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIKT 419

Query: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDCG 480
           IQ EFWAKYGRTFFTRYDFE+ +TE ANK+++ LR +     VV   FPA   + V+  G
Sbjct: 420 IQEEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAENPAVVGQPFPAWHEVSVSAAG 479

Query: 481 DFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAE 540
           DFSYTDLDGSVS+HQGLY+KLSNG R+V+RLSGTGSSGATIRLY+E+Y +D + Y +TA+
Sbjct: 480 DFSYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQTAD 539

Query: 541 EYLKPIINSVIKFLNFKQV 559
           ++L P I +V+KFL FK +
Sbjct: 540 QFLAPDIKAVLKFLRFKDL 558

>ABL126W [466] [Homologous to ScYMR278W - SH]
           complement(159209..161083) [1875 bp, 624 aa]
          Length = 624

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 83/378 (21%), Positives = 146/378 (38%), Gaps = 50/378 (13%)

Query: 111 TGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIIKDFP 166
           + G+++TASHN   P+ D G K   +NG     P  E +      I   L  +    D  
Sbjct: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGR---HIDANLEPWTRAWDSK 211

Query: 167 ELDLGTIGKNKKYGPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSM 226
            L    I   K +        D+ K+ +   K+     L+K+   N +       ++  M
Sbjct: 212 ALIEEAIKSGKLH--------DVRKEMLQKYKDSIQTMLVKQ--SNLKFAGGPWFVYTPM 261

Query: 227 NGVTGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGMH-PDPNLTYASSLVKRV-DR 280
           +GV   + K       G+  D+    V +  +P P+F  +  P+P    A  +  +V D 
Sbjct: 262 HGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADA 321

Query: 281 EKIEFGAASDGDGDR--NMIYGYGPSFVSPGDSVXXXXXXXXXXXXXXKQGI----YGLA 334
             I    A+D D DR    +  +G      G+ +              +  +      + 
Sbjct: 322 NGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAML 381

Query: 335 RSFPTSGAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSN 386
            S  +S  + ++A+  G    E  TG+K+      A++L + G       EE+ G   S 
Sbjct: 382 TSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQ 439

Query: 387 HVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVETEK 446
            V +KDG+ A   +L +   + K       S + +  E + KYG  +F  Y+   + +  
Sbjct: 440 VVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISSAP 493

Query: 447 A--NKIVDQLRAYVTKSG 462
           A   ++ D  R   T +G
Sbjct: 494 AVTKEVFDYFRNEYTPAG 511

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 200 IFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEF 242
           + +  L + FI    ST N K++FD   GV+  YG   FV+E 
Sbjct: 161 VTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEM 203

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 20/195 (10%)

Query: 109 KCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPE 167
           K + G+++TASHN   P+ D G K   SNG        +AI + I   L  +  + DF +
Sbjct: 148 KASVGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDFDD 204

Query: 168 LDLGTIGKNKKYGPLLVDIIDITKDYVNFL-KEIFDFDLIKKFIDNQRSTKNWKLLFDSM 226
           +    + K  K G L+    ++ K Y+  + K + + + +K     +   K W  ++  M
Sbjct: 205 V----LNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL----EVKAKPW-FVYTPM 255

Query: 227 NGVTGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGM-HPDPNLTYASSL-VKRVDR 280
           +GV       I      L   +    V +  +P P F  +  P+P    A  + +   ++
Sbjct: 256 HGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEK 315

Query: 281 EKIEFGAASDGDGDR 295
             I+   A+D D DR
Sbjct: 316 HDIDLLVANDPDADR 330

>Kwal_55.20154
          Length = 522

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 200 IFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDE 241
           + +  L + FI    ST N K++FD M GV+  YG   F  E
Sbjct: 146 VTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQE 187

>Scas_657.12
          Length = 549

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 15/73 (20%)

Query: 166 PELDLGTIGKNKKYGPLLVDIIDITKDYVNF------LKEIFDFDLIKKFIDNQRSTKNW 219
           P+L   T   N KY     D+I +   Y  F       +E++DF+  K F +        
Sbjct: 169 PQLHFITSLWNAKYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFEN-------- 220

Query: 220 KLLFDSMNGVTGP 232
            L+ DS NG+ GP
Sbjct: 221 -LIIDSANGIGGP 232

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,379,282
Number of extensions: 881513
Number of successful extensions: 2122
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2160
Number of HSP's successfully gapped: 21
Length of query: 559
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 452
Effective length of database: 12,891,983
Effective search space: 5827176316
Effective search space used: 5827176316
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)