Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_721.12468466023570.0
CAGL0K03399g70370423380.0
Scas_717.6967466922850.0
ABL028W72271221820.0
Kwal_26.763569168621720.0
KLLA0B12716g71656421710.0
CAGL0K07458g70470619920.0
ADL389W7114529141e-113
Kwal_47.167617443499121e-112
Scas_703.57493579001e-111
KLLA0B03586g7343528871e-109
CAGL0F09075g7463918851e-108
Scas_689.25*4092956906e-84
CAGL0M08404g4623046912e-83
KLLA0B07205g4552926815e-82
Kwal_33.138463752956702e-81
Scas_651.183712956641e-80
Scas_715.3411503387082e-80
ACR191C11493387073e-80
Kwal_56.240593533016586e-80
Kwal_27.1058111543356968e-79
YBL105C (PKC1)11513386968e-79
CAGL0M09361g11443356959e-79
KLLA0E06413g11613316941e-78
CAGL0G09020g3612956448e-78
AFL090W3463016376e-77
Scas_690.133543016282e-75
KLLA0D03190g3723016283e-75
AEL115C3862956285e-75
Kwal_56.227885153905755e-66
KLLA0F24618g5563785761e-65
CAGL0C03509g8953035772e-63
YCR091W (KIN82)7203005683e-63
CAGL0J06072g7733495686e-63
YBR028C5253605521e-62
ADR167W8733035691e-62
Kwal_23.64588683045621e-61
KLLA0C18568g7743045581e-61
AEL083W5363525452e-61
CAGL0B04301g5423685452e-61
Scas_629.169183045578e-61
Scas_720.1038043135335e-58
Scas_593.14d4952825029e-56
Scas_705.235533534672e-50
AFL101C3672674517e-50
CAGL0B04147g5663514639e-50
Kwal_23.39925713524577e-49
CAGL0E05720g3582684437e-49
YGR092W (DBF2)5724024569e-49
KLLA0B02332g3612714376e-48
CAGL0G03047g5393524452e-47
Kwal_56.240913812784334e-47
ADR033W5773534429e-47
Scas_716.335733534294e-45
KLLA0D14905g5673534277e-45
KLLA0E03487g6472764236e-44
Kwal_56.226939842734252e-43
YDR490C (PKH1)7662824187e-43
Scas_627.73492673981e-42
KLLA0C12485g9252744172e-42
CAGL0I07513g10762774102e-41
AFR335C10332974057e-41
AFR377C7262714011e-40
CAGL0G04609g9652784031e-40
KLLA0D07810g7181583869e-39
Scas_660.209572823871e-38
Kwal_33.145547141563823e-38
AFR035W7191563813e-38
YDR466W (PKH3)8982943782e-37
Scas_654.127371483752e-37
Kwal_47.182335983173704e-37
CAGL0M08910g6123173661e-36
KLLA0F13552g12672653702e-36
Scas_502.211162773684e-36
Kwal_47.183076212733634e-36
YDL101C (DUN1)5133013586e-36
Scas_616.1014613883667e-36
Kwal_26.778812672953632e-35
ABL034W14252733632e-35
YDR477W (SNF1)6333173582e-35
KLLA0A03806g6022763483e-34
Scas_660.286232613431e-33
KLLA0F11319g8432633452e-33
CAGL0K08514g14892113462e-33
AEL230W6082763412e-33
CAGL0L07326g5063023373e-33
CAGL0K06479g9913103425e-33
KLLA0E01584g4153083299e-33
Scas_693.1710493193401e-32
ACR133C8512623391e-32
Kwal_26.87098292853362e-32
AFR696C11423163354e-32
CAGL0J11638g7462783335e-32
Kwal_0.964272593211e-31
AAR009W4532513221e-31
KLLA0F23155g4272523211e-31
KLLA0C06138g7082393282e-31
ACL006W7082573282e-31
CAGL0J03872g6612863263e-31
Kwal_56.224766972573254e-31
CAGL0K05709g11032763274e-31
Kwal_33.131125053243195e-31
CAGL0K10604g4462623113e-30
CAGL0L11550g10723063203e-30
CAGL0F04741g4422473095e-30
Scas_564.712103523177e-30
CAGL0M02233g7672893157e-30
Scas_644.157262573158e-30
CAGL0M02519g7563013141e-29
AFR724C4402663052e-29
ACL104C9472453132e-29
Scas_618.84272623033e-29
YDR507C (GIN4)11422823123e-29
Scas_613.55173003063e-29
Kwal_23.35904992973054e-29
Scas_700.348643053104e-29
CAGL0M02299g8932623104e-29
YFR014C (CMK1)4462473009e-29
KLLA0C01650g11122773071e-28
KLLA0F09020g9281553042e-28
Kwal_26.87967962683033e-28
Scas_700.288962623033e-28
ACR142W8372683023e-28
CAGL0K12562g16821953043e-28
CAGL0M11396g11923133034e-28
KLLA0F19536g11042963034e-28
KLLA0C00979g4833472955e-28
YFL033C (RIM15)17701553026e-28
YHR102W (KIC1)10803023009e-28
Scas_580.610152612999e-28
Scas_573.105693182969e-28
Scas_700.546982802971e-27
AGR058W10713232972e-27
KLLA0F11143g8132692962e-27
CAGL0B01925g9443062962e-27
ACR218W15691552972e-27
Kwal_47.172528723072952e-27
YDR523C (SPS1)4902472903e-27
Kwal_26.87518482972953e-27
KLLA0D07348g9092522944e-27
Scas_493.211172802945e-27
Scas_201.1*2741982758e-27
Scas_707.315981612911e-26
Scas_673.20*7582652882e-26
AFL188C4722092822e-26
YGL158W (RCK1)5123202832e-26
ACR119W9312682873e-26
Kwal_0.1555873062834e-26
CAGL0I09504g5282812806e-26
Kwal_14.115915211552849e-26
YDR122W (KIN1)10642732839e-26
YCL024W (KCC4)10372812839e-26
Scas_640.14*7282582811e-25
Kwal_55.215458652452811e-25
KLLA0E21780g10162452821e-25
KLLA0F09031g6331492773e-25
CAGL0B03509g5972262754e-25
Kwal_56.237178582302775e-25
AER223C9022162686e-24
KLLA0C04191g7972592676e-24
ACL054W9723052677e-24
CAGL0K02673g9152672678e-24
YGL180W (ATG1)8973092678e-24
Scas_713.79832532679e-24
Kwal_23.632515422742671e-23
KLLA0C08525g15512542662e-23
CAGL0C05005g10762412632e-23
Scas_685.245152662593e-23
KLLA0C17160g8313152623e-23
Scas_707.369153332623e-23
KLLA0F12188g5462132593e-23
CAGL0L06006g9422892614e-23
AER264C14832512624e-23
AAL029W5343122567e-23
Scas_675.25272792558e-23
Kwal_26.87034442302521e-22
Kwal_26.735514462992572e-22
CAGL0M10153g8672152552e-22
Kwal_27.97638682592552e-22
CAGL0K02167g11623422562e-22
KLLA0B13607g9892112552e-22
KLLA0D07304g4652362502e-22
YHL007C (STE20)9392352552e-22
Kwal_26.78619552392516e-22
ABR014W9712062517e-22
Scas_711.2515152862527e-22
CAGL0F00649g5143222478e-22
YAR019C (CDC15)9742422501e-21
Scas_618.156203672471e-21
CAGL0L05632g6772802462e-21
Scas_668.228932492472e-21
Kwal_47.1726311273502472e-21
CAGL0H01639g5212022423e-21
Scas_720.9416832682411e-20
ACR117W5242182352e-20
KLLA0F14190g13382922392e-20
KLLA0F23507g4872252343e-20
AEL185C5152832353e-20
KLLA0B11902g4953672343e-20
Kwal_33.140815803082345e-20
CAGL0J00539g4883092325e-20
CAGL0L03520g14472892366e-20
AEL205W7931462346e-20
CAGL0M03729g8611472347e-20
Scas_582.16382972338e-20
Scas_688.144793132309e-20
KLLA0A07403g8791462339e-20
CAGL0I04422g4222872281e-19
Scas_640.165053202291e-19
KLLA0F01276g5192902282e-19
YCR073C (SSK22)13312592302e-19
Kwal_23.52908191472283e-19
Kwal_23.55765043102254e-19
YBR274W (CHK1)5272132254e-19
AER222C4233332225e-19
Scas_602.1111864032276e-19
Scas_598.67902062266e-19
AFR092W14232892277e-19
YGL179C (TOS3)5602812247e-19
CAGL0J03828g4672062227e-19
ACL191C3653052181e-18
KLLA0E15378g7242792231e-18
AER232C5693132221e-18
YHR030C (SLT2)4843172201e-18
CAGL0D02244g4873322192e-18
Kwal_14.24974181892172e-18
Kwal_33.132221481112022e-18
Kwal_55.220013633302143e-18
Scas_619.5*5102812174e-18
Scas_707.349053102194e-18
Scas_680.204823042156e-18
KLLA0D09328g10463582186e-18
ADR379C4922972148e-18
Kwal_33.141678383002169e-18
Scas_700.354392332131e-17
AFL217C6912812151e-17
KLLA0E11979g6142752141e-17
CAGL0B02739g6762652132e-17
Kwal_27.97734062542092e-17
Kwal_56.238414323372093e-17
KLLA0A02497g3622112063e-17
Scas_713.216412992104e-17
Kwal_55.203267502302114e-17
Scas_623.113782212064e-17
CAGL0I03498g4512532076e-17
CAGL0F00913g12062562098e-17
ACL053C11813552098e-17
YAR018C (KIN3)4352782059e-17
Scas_683.63772152039e-17
KLLA0E14828g3102021991e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR104C
         (665 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_721.124                                                          912   0.0  
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   905   0.0  
Scas_717.69                                                           884   0.0  
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   845   0.0  
Kwal_26.7635                                                          841   0.0  
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   840   0.0  
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   771   0.0  
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   356   e-113
Kwal_47.16761                                                         355   e-112
Scas_703.5                                                            351   e-111
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   346   e-109
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   345   e-108
Scas_689.25*                                                          270   6e-84
CAGL0M08404g complement(836791..838179) some similarities with s...   270   2e-83
KLLA0B07205g complement(624606..625973) some similarities with s...   266   5e-82
Kwal_33.13846                                                         262   2e-81
Scas_651.18                                                           260   1e-80
Scas_715.34                                                           277   2e-80
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   276   3e-80
Kwal_56.24059                                                         258   6e-80
Kwal_27.10581                                                         272   8e-79
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   272   8e-79
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   272   9e-79
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   271   1e-78
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   252   8e-78
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   249   6e-77
Scas_690.13                                                           246   2e-75
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   246   3e-75
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   246   5e-75
Kwal_56.22788                                                         226   5e-66
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   226   1e-65
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   226   2e-63
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   223   3e-63
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   223   6e-63
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   217   1e-62
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   223   1e-62
Kwal_23.6458                                                          221   1e-61
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   219   1e-61
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   214   2e-61
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   214   2e-61
Scas_629.16                                                           219   8e-61
Scas_720.103                                                          209   5e-58
Scas_593.14d                                                          197   9e-56
Scas_705.23                                                           184   2e-50
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   178   7e-50
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   182   9e-50
Kwal_23.3992                                                          180   7e-49
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   175   7e-49
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   180   9e-49
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   172   6e-48
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   176   2e-47
Kwal_56.24091                                                         171   4e-47
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   174   9e-47
Scas_716.33                                                           169   4e-45
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   169   7e-45
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   167   6e-44
Kwal_56.22693                                                         168   2e-43
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   165   7e-43
Scas_627.7                                                            157   1e-42
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   165   2e-42
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   162   2e-41
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   160   7e-41
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   159   1e-40
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   159   1e-40
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   153   9e-39
Scas_660.20                                                           153   1e-38
Kwal_33.14554                                                         151   3e-38
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   151   3e-38
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   150   2e-37
Scas_654.12                                                           149   2e-37
Kwal_47.18233                                                         147   4e-37
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   145   1e-36
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   147   2e-36
Scas_502.2                                                            146   4e-36
Kwal_47.18307                                                         144   4e-36
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   142   6e-36
Scas_616.10                                                           145   7e-36
Kwal_26.7788                                                          144   2e-35
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   144   2e-35
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   142   2e-35
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   138   3e-34
Scas_660.28                                                           136   1e-33
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   137   2e-33
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   137   2e-33
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   135   2e-33
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   134   3e-33
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   136   5e-33
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   131   9e-33
Scas_693.17                                                           135   1e-32
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   135   1e-32
Kwal_26.8709                                                          134   2e-32
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   133   4e-32
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   132   5e-32
Kwal_0.96                                                             128   1e-31
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   128   1e-31
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   128   1e-31
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   130   2e-31
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   130   2e-31
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   130   3e-31
Kwal_56.22476                                                         129   4e-31
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   130   4e-31
Kwal_33.13112                                                         127   5e-31
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   124   3e-30
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   127   3e-30
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   123   5e-30
Scas_564.7                                                            126   7e-30
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   125   7e-30
Scas_644.15                                                           125   8e-30
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   125   1e-29
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   122   2e-29
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   125   2e-29
Scas_618.8                                                            121   3e-29
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   124   3e-29
Scas_613.5                                                            122   3e-29
Kwal_23.3590                                                          122   4e-29
Scas_700.34                                                           124   4e-29
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   124   4e-29
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   120   9e-29
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   122   1e-28
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   121   2e-28
Kwal_26.8796                                                          121   3e-28
Scas_700.28                                                           121   3e-28
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   120   3e-28
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   121   3e-28
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   121   4e-28
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   121   4e-28
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   118   5e-28
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   120   6e-28
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...   120   9e-28
Scas_580.6                                                            119   9e-28
Scas_573.10                                                           118   9e-28
Scas_700.54                                                           119   1e-27
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   119   2e-27
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   118   2e-27
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   118   2e-27
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   119   2e-27
Kwal_47.17252                                                         118   2e-27
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   116   3e-27
Kwal_26.8751                                                          118   3e-27
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   117   4e-27
Scas_493.2                                                            117   5e-27
Scas_201.1*                                                           110   8e-27
Scas_707.3                                                            116   1e-26
Scas_673.20*                                                          115   2e-26
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   113   2e-26
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   113   2e-26
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   115   3e-26
Kwal_0.155                                                            113   4e-26
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   112   6e-26
Kwal_14.1159                                                          114   9e-26
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   113   9e-26
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   113   9e-26
Scas_640.14*                                                          112   1e-25
Kwal_55.21545                                                         112   1e-25
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   113   1e-25
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   111   3e-25
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...   110   4e-25
Kwal_56.23717                                                         111   5e-25
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   107   6e-24
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   107   6e-24
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...   107   7e-24
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   107   8e-24
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   107   8e-24
Scas_713.7                                                            107   9e-24
Kwal_23.6325                                                          107   1e-23
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   107   2e-23
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   105   2e-23
Scas_685.24                                                           104   3e-23
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...   105   3e-23
Scas_707.36                                                           105   3e-23
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...   104   3e-23
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...   105   4e-23
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   105   4e-23
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...   103   7e-23
Scas_675.2                                                            102   8e-23
Kwal_26.8703                                                          101   1e-22
Kwal_26.7355                                                          103   2e-22
CAGL0M10153g complement(1010688..1013291) some similarities with...   102   2e-22
Kwal_27.9763                                                          102   2e-22
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...   103   2e-22
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...   102   2e-22
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...   100   2e-22
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...   102   2e-22
Kwal_26.7861                                                          101   6e-22
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...   101   7e-22
Scas_711.25                                                           101   7e-22
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   100   8e-22
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   100   1e-21
Scas_618.15                                                           100   1e-21
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    99   2e-21
Scas_668.22                                                           100   2e-21
Kwal_47.17263                                                         100   2e-21
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    98   3e-21
Scas_720.94                                                            97   1e-20
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    95   2e-20
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    97   2e-20
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    95   3e-20
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    95   3e-20
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    95   3e-20
Kwal_33.14081                                                          95   5e-20
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    94   5e-20
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    96   6e-20
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    95   6e-20
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    95   7e-20
Scas_582.1                                                             94   8e-20
Scas_688.14                                                            93   9e-20
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    94   9e-20
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    92   1e-19
Scas_640.16                                                            93   1e-19
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    92   2e-19
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    93   2e-19
Kwal_23.5290                                                           92   3e-19
Kwal_23.5576                                                           91   4e-19
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    91   4e-19
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    90   5e-19
Scas_602.11                                                            92   6e-19
Scas_598.6                                                             92   6e-19
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    92   7e-19
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    91   7e-19
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    90   7e-19
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    89   1e-18
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    91   1e-18
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    90   1e-18
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    89   1e-18
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    89   2e-18
Kwal_14.2497                                                           88   2e-18
Kwal_33.13222                                                          82   2e-18
Kwal_55.22001                                                          87   3e-18
Scas_619.5*                                                            88   4e-18
Scas_707.34                                                            89   4e-18
Scas_680.20                                                            87   6e-18
KLLA0D09328g complement(788565..791705) some similarities with s...    89   6e-18
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    87   8e-18
Kwal_33.14167                                                          88   9e-18
Scas_700.35                                                            87   1e-17
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    87   1e-17
KLLA0E11979g complement(1060048..1061892) some similarities with...    87   1e-17
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    87   2e-17
Kwal_27.9773                                                           85   2e-17
Kwal_56.23841                                                          85   3e-17
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    84   3e-17
Scas_713.21                                                            86   4e-17
Kwal_55.20326                                                          86   4e-17
Scas_623.11                                                            84   4e-17
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    84   6e-17
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    85   8e-17
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    85   8e-17
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    84   9e-17
Scas_683.6                                                             83   9e-17
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    81   1e-16
Scas_716.73                                                            83   1e-16
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    84   1e-16
Kwal_23.4276                                                           84   1e-16
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    83   1e-16
Kwal_26.7552                                                           83   2e-16
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    83   2e-16
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    82   2e-16
Scas_628.9                                                             83   2e-16
Kwal_14.1416                                                           82   2e-16
Scas_643.20                                                            84   2e-16
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    81   2e-16
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    82   2e-16
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    83   2e-16
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    82   3e-16
Scas_633.29                                                            83   3e-16
Kwal_0.307                                                             82   3e-16
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    82   3e-16
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    82   4e-16
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    81   4e-16
Scas_713.38                                                            81   5e-16
Scas_544.6                                                             82   5e-16
Kwal_27.12559                                                          81   5e-16
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    80   9e-16
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    81   1e-15
Scas_710.28                                                            79   1e-15
Scas_721.110                                                           80   1e-15
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    79   1e-15
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    80   1e-15
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    80   2e-15
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    81   2e-15
Kwal_26.8347                                                           80   2e-15
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    79   2e-15
Scas_477.5                                                             80   2e-15
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    80   2e-15
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    80   2e-15
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    80   3e-15
Kwal_26.7154                                                           80   3e-15
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    80   3e-15
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    78   3e-15
Scas_634.5                                                             80   3e-15
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    77   3e-15
Scas_548.6                                                             79   5e-15
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    79   6e-15
Kwal_23.5668                                                           79   7e-15
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    78   7e-15
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    79   7e-15
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    78   8e-15
KLLA0C16577g complement(1451181..1452695) some similarities with...    78   9e-15
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    78   9e-15
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    77   1e-14
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    75   1e-14
Scas_667.18                                                            77   2e-14
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    75   2e-14
Kwal_56.24584                                                          76   2e-14
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    76   2e-14
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    77   2e-14
Scas_651.3                                                             77   2e-14
Scas_721.132                                                           75   5e-14
Scas_635.1                                                             74   5e-14
Scas_568.9*                                                            74   5e-14
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    75   5e-14
Kwal_47.17868                                                          74   6e-14
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    75   6e-14
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    74   7e-14
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    76   7e-14
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    75   7e-14
Kwal_14.1273                                                           74   9e-14
Kwal_27.11803                                                          72   9e-14
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    75   1e-13
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    73   1e-13
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    73   1e-13
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    74   1e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    75   1e-13
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    75   1e-13
Scas_336.1                                                             74   1e-13
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    74   2e-13
Scas_613.13*                                                           72   2e-13
Kwal_33.13984                                                          74   2e-13
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    74   2e-13
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    74   3e-13
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    71   4e-13
Scas_678.13                                                            72   5e-13
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    71   5e-13
Kwal_17.2687                                                           71   7e-13
Kwal_27.10004                                                          72   7e-13
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    70   7e-13
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    72   7e-13
Kwal_26.7682                                                           72   8e-13
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    72   1e-12
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    69   2e-12
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    70   2e-12
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    70   2e-12
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    70   2e-12
Scas_721.46                                                            69   2e-12
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    70   2e-12
Scas_678.24                                                            71   2e-12
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    70   4e-12
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    68   4e-12
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    67   5e-12
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    67   9e-12
Kwal_33.13831                                                          69   9e-12
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    68   1e-11
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    66   1e-11
Kwal_33.13681                                                          67   3e-11
Kwal_23.3471                                                           64   3e-11
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    65   4e-11
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    64   6e-11
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    65   9e-11
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    65   9e-11
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    64   2e-10
Scas_684.28                                                            64   2e-10
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    63   2e-10
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    63   4e-10
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    63   4e-10
Scas_22.1                                                              60   6e-10
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    61   9e-10
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    62   1e-09
Kwal_27.11919                                                          59   1e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    60   2e-09
Scas_671.16                                                            61   2e-09
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    61   2e-09
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    61   2e-09
Scas_568.13                                                            60   2e-09
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    61   2e-09
Scas_695.33                                                            60   3e-09
Scas_711.15                                                            60   3e-09
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    60   3e-09
Scas_649.30                                                            60   3e-09
Scas_689.24                                                            60   4e-09
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    60   5e-09
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    60   5e-09
Kwal_47.18098                                                          59   5e-09
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    58   5e-09
Scas_653.25                                                            59   6e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    59   7e-09
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    59   7e-09
Kwal_27.11777                                                          59   7e-09
Scas_673.34*                                                           59   8e-09
Scas_704.50                                                            58   8e-09
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    58   8e-09
KLLA0F22297g complement(2083448..2085547) some similarities with...    59   8e-09
KLLA0A06820g complement(615686..618004) some similarities with s...    59   9e-09
Kwal_55.21900                                                          59   9e-09
Kwal_33.14434                                                          59   1e-08
Scas_648.17                                                            58   1e-08
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    58   1e-08
Scas_651.19                                                            59   1e-08
Scas_677.18                                                            58   1e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    58   1e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    58   2e-08
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    57   2e-08
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    57   2e-08
KLLA0C03938g complement(358851..360632) some similarities with s...    58   2e-08
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    58   2e-08
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    58   2e-08
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    58   2e-08
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    58   2e-08
Kwal_26.7276                                                           57   2e-08
Kwal_33.14192                                                          57   2e-08
Scas_683.12                                                            57   2e-08
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    57   3e-08
Kwal_27.11830                                                          57   3e-08
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    56   3e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    57   4e-08
Scas_718.90                                                            57   4e-08
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    56   4e-08
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    57   5e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    57   5e-08
KLLA0B06501g complement(576636..579089) some similarities with s...    57   5e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    57   5e-08
Scas_610.7                                                             56   5e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    56   6e-08
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    56   6e-08
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    55   7e-08
Kwal_55.21709                                                          55   7e-08
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    56   8e-08
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    55   1e-07
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    55   2e-07
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    55   2e-07
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    55   2e-07
Kwal_55.20189                                                          55   2e-07
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    54   2e-07
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    54   2e-07
CAGL0K11990g complement(1155395..1158370) some similarities with...    54   3e-07
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    54   4e-07
Kwal_47.17345                                                          54   4e-07
Kwal_26.8941                                                           54   5e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    53   5e-07
Scas_703.47                                                            54   5e-07
Scas_458.1                                                             53   5e-07
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    53   5e-07
Scas_698.37                                                            52   7e-07
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    52   8e-07
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    52   9e-07
Scas_584.11                                                            52   9e-07
Kwal_27.11542                                                          52   9e-07
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    52   1e-06
Scas_654.17                                                            52   1e-06
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    52   1e-06
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    52   1e-06
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    52   1e-06
Scas_655.2                                                             52   2e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    51   2e-06
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    51   2e-06
CAGL0K01661g complement(146952..148400) some similarities with t...    51   2e-06
Scas_601.6                                                             51   2e-06
Scas_697.12                                                            51   3e-06
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    50   3e-06
Kwal_14.1249                                                           50   4e-06
CAGL0M08360g complement(833220..835520) some similarities with s...    50   4e-06
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    50   5e-06
Scas_721.61                                                            50   5e-06
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    50   6e-06
Kwal_27.10945                                                          50   7e-06
Scas_707.7                                                             49   7e-06
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    49   8e-06
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    49   9e-06
Scas_692.24                                                            49   9e-06
Kwal_33.14596                                                          49   9e-06
Kwal_33.13225                                                          49   1e-05
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    49   1e-05
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    49   1e-05
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    48   1e-05
Scas_689.22                                                            49   2e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    48   2e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    48   2e-05
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    47   3e-05
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    47   4e-05
Scas_661.27                                                            47   5e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    47   5e-05
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    46   7e-05
Kwal_55.20221                                                          46   1e-04
Kwal_56.24274                                                          45   1e-04
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    44   2e-04
Kwal_14.2554                                                           45   2e-04
Kwal_47.17314                                                          44   3e-04
Scas_718.72                                                            44   4e-04
Kwal_33.15381                                                          44   4e-04
Scas_627.4                                                             43   5e-04
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    43   6e-04
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    43   8e-04
Scas_584.8                                                             43   0.001
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    43   0.001
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    43   0.001
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    42   0.001
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    42   0.001
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    42   0.001
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    42   0.001
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...    42   0.002
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...    42   0.002

>Scas_721.124
          Length = 684

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/660 (68%), Positives = 527/660 (79%), Gaps = 19/660 (2%)

Query: 23  DENEKSWGNGLFHFHHGEKHHDGSPKNH-----NHEHEHHIRKINTNETL-PSSLSSPKL 76
           +E EK    G F F+ G+   + SP +      ++  +     IN+  T+ P   S    
Sbjct: 15  EEKEKPSKYGGF-FNSGDSKKESSPTSKTQSSGDYSSDRKETIINSPNTMAPMRSSYEAS 73

Query: 77  RNDASFKNPSGIGND---NSKASERKASQSSTETQGPS--------SESGLMTVKVYSGK 125
            + ++F N S   +D   N+ + E   SQ S +T            S SG+MT+K+Y+G 
Sbjct: 74  SSTSTFDNGSHTSSDENSNNISHESSVSQISQDTASNDPHPQNTHISSSGIMTIKIYNGD 133

Query: 126 DFTLPFPITSNSTILQKLLSSGILTSSSNDASEVAAIMRQLPRYKRVDQDSAGEGLIDRA 185
            FTLPFPITSN  IL KLL SGI +  S    +V  ++ QL R +  +Q  A E L+   
Sbjct: 134 AFTLPFPITSNQQILSKLLGSGI-SPPSTATPDVDTLVSQLSRVQLQNQGPAEENLLASD 192

Query: 186 FATKFIPSSILLPGSTNSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKISTFDVTRKLR 245
            ++KFIP++I LPGS+  +PLLYFTIEFDN++ TI P+ GTM +PVFNKISTFDVTRKL 
Sbjct: 193 VSSKFIPATIKLPGSSVLNPLLYFTIEFDNTVATIEPEYGTMTKPVFNKISTFDVTRKLP 252

Query: 246 FLKIDVFARIPSLLLPSKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSA 305
           FLKIDVFARIPS+LLPSK WQQE+   DE LKE+L+KIN+NQD+HLDSF LP+NLK D+A
Sbjct: 253 FLKIDVFARIPSILLPSKMWQQEMSANDEKLKEMLEKINSNQDVHLDSFQLPINLKFDTA 312

Query: 306 AQIRLYNHHWISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKD 365
           + IRLYNHHW+SLE G G++NI++DYKPS+NKPLSIDDFDLLKVIGKGSFGKVMQVRKKD
Sbjct: 313 SNIRLYNHHWVSLENGLGRINISIDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKD 372

Query: 366 TQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFIN 425
           TQKIYALKA+RKAYIVSK EVTHTLAERTVLAR+DCPFIVPLKFSFQSP+KLYLVLA IN
Sbjct: 373 TQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSPDKLYLVLACIN 432

Query: 426 GGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCD 485
           GGELFYHLQ EGRF L+RSRFY AELLCAL++LH L+VIYRDLKPENILLDYQGHIALCD
Sbjct: 433 GGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLDYQGHIALCD 492

Query: 486 FGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545
           FGLCKLNMKD+DKTDTFCGTPEYLAPE+LLGQGYTK VDWWTLG+LLYEM+TGLPPYYDE
Sbjct: 493 FGLCKLNMKDDDKTDTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDE 552

Query: 546 NVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
           +VP MYKKILQ PL FPDGFD  AKDLLIGLLSRDP+RRLG NG DEI+NHPFF  +SWK
Sbjct: 553 DVPKMYKKILQDPLRFPDGFDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWK 612

Query: 606 KLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDEQ 665
           +LL+KGYIPPYKP V S IDT+NFDQEFT+EKP+DSVVDE+LS S+QKQFGGWTY+G EQ
Sbjct: 613 RLLMKGYIPPYKPPVTSAIDTSNFDQEFTREKPVDSVVDEFLSESVQKQFGGWTYVGSEQ 672

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/704 (64%), Positives = 537/704 (76%), Gaps = 52/704 (7%)

Query: 1   MHSWRISKFKLGRSKEDDGSSEDENEKSWGNGLFHFHHGEKHHDGSPKNHN-HEHEHHIR 59
           M+SW+  KFK G+SK++    +D+        LFHFHH     D S    N ++ E  + 
Sbjct: 1   MYSWK--KFKFGKSKDEKEQKKDK--------LFHFHHKHTGSDVSDNFGNGNDKEKSVD 50

Query: 60  KINTNETL---PSSLSSPKLRNDASFKNPSGI---------------------------- 88
            + ++  +   PS L S     + S +N + +                            
Sbjct: 51  SLPSSSEITPYPSDLPSQNTNGNNSSRNDTMVNSNSSNRISSASSAKGPGSSSSTIKDVP 110

Query: 89  -GNDNSKASE------RKASQSSTETQGPSSESGLMTVKVYSGKDFTLPFPITSNSTILQ 141
            G +N ++S       +K++ S+ +T  PS+  G+MT+KVY+G  F LPFPITSN  IL 
Sbjct: 111 LGGENERSSSHIDQVSQKSATSTKKTSTPST--GVMTIKVYNGDGFRLPFPITSNKKILS 168

Query: 142 KLLSSGILTSSSNDASEVAAIMRQLPRYKRVDQDSAGEGLIDRAFATKFIPSSILLPGST 201
           +LL SGI + + + + EV AI++++ R +  + +S  E L+    AT+ IPS+I LP S 
Sbjct: 169 RLLESGIASDNHDTSLEVEAILQRISRLELTNSNS-NENLLPGDIATQSIPSTIKLPNSV 227

Query: 202 NSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLLLP 261
             +PLLYFTIEFDN++ TI P+ GTM QP+FNKISTFDVTRKL  L IDVF RIPS+LLP
Sbjct: 228 PLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLP 287

Query: 262 SKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLERG 321
            K WQQE+G QDE L+ +L KINTNQD+HLDSF LP+NL IDSAA IRLYNHHW+ L  G
Sbjct: 288 PKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDG 347

Query: 322 YGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV 381
            GK+NI+VDYKPS+NKPLSIDDFDLLKVIGKGSFGKVMQVRKKDT+KIYALKA+RK+YIV
Sbjct: 348 LGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIV 407

Query: 382 SKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSL 441
           SK EVTHTLAERTVLAR+DCPFIVPLKFSFQS EKLYLVLA INGGELFYHLQ EGRF L
Sbjct: 408 SKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDL 467

Query: 442 ARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDT 501
           +RSRFY AELLCALD+LHK+DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD DKTDT
Sbjct: 468 SRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDT 527

Query: 502 FCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLF 561
           FCGTPEYLAPE+LLGQGY+K VDWWTLG+LLYEM+TGLPPYYDENVP MYKKILQ PL+F
Sbjct: 528 FCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVF 587

Query: 562 PDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVK 621
           PDGFD  AKDLLIGLLSRDP RRLG NG DEI+NHPFF  +SWK+LL+KGYIPPYKP V 
Sbjct: 588 PDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVT 647

Query: 622 SEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDEQ 665
           S  DT+NFDQEFT+EKPIDSVVDEYLS S+QKQFGGWTY+G EQ
Sbjct: 648 SATDTSNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYVGSEQ 691

>Scas_717.69
          Length = 674

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/669 (65%), Positives = 517/669 (77%), Gaps = 15/669 (2%)

Query: 6   ISKFKLGRSKEDDGSSEDENEKSWGNGLFHFHHGEKHHDGSPKNHNHEHEHHIRKINTNE 65
           + KF  GR K +    E E   +   GLFHFHH ++H  G   + N   +    +  T  
Sbjct: 4   LKKFGFGRWKTE---KEPEPNNNNSGGLFHFHHEKRHSRG---DLNESDDTFSDRKKTIV 57

Query: 66  TLPSSLSSPKLRNDASFKNPSGIGNDNSKASERKASQSSTETQGPSSES--------GLM 117
             PSS++  +L ++A+  + + +  D+  ++ R     +  T   +  S        G+M
Sbjct: 58  RSPSSVAPVRLSSEAASSSSTFLNGDDDVSTGRDVHSRTMSTTSATEMSNKDIDGTAGIM 117

Query: 118 TVKVYSGKDFTLPFPITSNSTILQKLLSSGILTSSSNDASEVAAIMRQLPRYK-RVDQDS 176
           T+KVY+G+ F LP  ITSN TIL +LLSSGI ++  N ++EV A++ +L R +    ++ 
Sbjct: 118 TIKVYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNI 177

Query: 177 AGEGLIDRAFATKFIPSSILLPGSTNSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKIS 236
             E LI+    TK+IP+++ LPGS   +PLLYFTIEFDN++ TI P+ G M  PVFNKIS
Sbjct: 178 QEEKLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKIS 237

Query: 237 TFDVTRKLRFLKIDVFARIPSLLLPSKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHL 296
           TFDVTRKL +LKIDVFARIPS+LLPSK WQQ   E D  +K IL KIN+NQD+HLDS  +
Sbjct: 238 TFDVTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQI 297

Query: 297 PLNLKIDSAAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFG 356
           P+NLK DSAA IRLYNHHW++LE   G++NI+VDYKPSKNK L+IDDFDLLKVIGKGSFG
Sbjct: 298 PINLKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFG 357

Query: 357 KVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEK 416
           KVMQVRK+DTQKIYALKA+RK+YIVSK EVTHTLAERTVLARV+CPFIVPLKFSFQSPEK
Sbjct: 358 KVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEK 417

Query: 417 LYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLD 476
           LYLVLA INGGELFYHLQ EGRF L+R+RFY AELLCAL++LH LDVIYRDLKPENILLD
Sbjct: 418 LYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLD 477

Query: 477 YQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMM 536
           YQGHIALCDFGLCKLNMKD DKTDTFCGTPEYLAPE+LL QGY+K VDWWTLGILLYEM+
Sbjct: 478 YQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEML 537

Query: 537 TGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNH 596
           TGLPPYYDE+VP MY+KILQ PL FP+GFD  AKDLLIGLLSRDP RRLG NG  EI+NH
Sbjct: 538 TGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNH 597

Query: 597 PFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFG 656
           PFF  +SWK+L  KGYIPPYKP V    DT NFDQEFTKEKPIDSVVDEYLS S+QKQFG
Sbjct: 598 PFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFG 657

Query: 657 GWTYIGDEQ 665
           GWTY+G EQ
Sbjct: 658 GWTYVGSEQ 666

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/712 (59%), Positives = 520/712 (73%), Gaps = 51/712 (7%)

Query: 1   MHSWRIS-KFKLGRSKED-DGSSEDENEKSWGNGLFH--FHHGEKHHD------------ 44
           M+ W+++ K K GRSKE+ D   E E +    +G  H  F H  K               
Sbjct: 3   MYGWKLTNKLKFGRSKEEKDKDREKERDSRHNSGSKHGVFGHLSKRLSSTEEQVRCRTEE 62

Query: 45  -----GSPKNHNHEHEHHIRKINT----------------NETLPSSLSSPKLRNDASFK 83
                G+P+      E  +   N+                NE + SS+ S   R+  S  
Sbjct: 63  ANTGAGTPRTSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPS-SFRDAGSET 121

Query: 84  NPSG----IGNDNSKASERKASQSS---TETQGPSS---ESGLMTVKVYSGKDFTLPFPI 133
              G     G  +      +A+ SS   +E +G +S    +G+MT+KVY+G  F LPF +
Sbjct: 122 TDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFAL 181

Query: 134 TSNSTILQKLLSSGILTSSSNDASEVAAIMRQLPRYKRVDQDSAGEGLIDRAFATKFIPS 193
           TSN  IL KLLSSG+   S    S V  ++  +   ++V      + L+    AT +IP+
Sbjct: 182 TSNPQILGKLLSSGVNAISRTGRSSVDELISSV---EQVTLSEDEDKLLPGDAATNYIPA 238

Query: 194 SILLPGSTNSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKISTFDVTRKLRFLKIDVFA 253
           +I LP S + +PL+Y TIEFDN++ TI P+ G ++ PVFNKISTFDVTRKL +LK++VF 
Sbjct: 239 TIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFV 298

Query: 254 RIPSLLLPSKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNH 313
           RIPS+LLPSK WQQ    QD  L+++LKK+N+N D+ LDSF LPLNL+ +SA  IRLYNH
Sbjct: 299 RIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNH 358

Query: 314 HWISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALK 373
            W+++E+G G++NIT+DYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQV+KKDT KIYALK
Sbjct: 359 QWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALK 418

Query: 374 ALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHL 433
           A+RK+YIVSK EVTHTLAERTVLARVD PFIVPLKFSFQSPEKLYLVLAFINGGELF+HL
Sbjct: 419 AIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHL 478

Query: 434 QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           Q EGRF L+R+RFY AELLCAL++LH L+VIYRDLKPENILLDYQGHIALCDFGLCKLNM
Sbjct: 479 QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538

Query: 494 KDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK 553
           KD DKT+TFCGTPEYLAPE+LLGQGY+K VDWWTLG+LLYEM+TGLPPYYDE+VP MYKK
Sbjct: 539 KDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 598

Query: 554 ILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYI 613
           ILQ+PL FPDGFD  AK+LLI LL RDP RRLG NG DEI+ HPFF  +SWK+L +KGYI
Sbjct: 599 ILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYI 658

Query: 614 PPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDEQ 665
           PPYKP V S +DT+NFDQEFT+EKP+DSVV+++LS S+Q+QFGGWTY+G EQ
Sbjct: 659 PPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGSEQ 710

>Kwal_26.7635
          Length = 691

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/686 (61%), Positives = 523/686 (76%), Gaps = 28/686 (4%)

Query: 1   MHSWRI-SKFKLGRSKEDDGSSEDENEKSWGNGLFHFHHGEKHHDGS---PKNHNHEHEH 56
           M+SW+I SKF+ GRSKE+    +++++         FHH     D S   P   + + + 
Sbjct: 1   MYSWKIASKFRFGRSKEEKEKEKEKDKTKEKEKHGLFHHKSHKSDSSYMEPPRESVDRKE 60

Query: 57  HIRKINTNETLPSSLSSPKLRNDASFKNPSGI---------------GNDNSKASERKAS 101
            I   +++   P  LSS   +  A+  + S +               GN +S   +    
Sbjct: 61  TIVA-SSSSIAPVRLSSEVNKFPATDSSVSTVRDSVSTSGEYDGMYDGNGSSSVMDEAFD 119

Query: 102 QSSTETQGPSSESGLMTVKVYSGKDFTLPFPITSNSTILQKLLSSGILTSSSNDAS--EV 159
            +++ T  P+  SG+MT+KVY G+   LPFPITSN  IL+KLL SG++   +++AS  E+
Sbjct: 120 SNNSTTDEPNF-SGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVINQDTDEASADEL 178

Query: 160 AAIMRQLPRYKRVDQDSAGEGLIDRAFATKFIPSSILLPGSTNSSPLLYFTIEFDNSITT 219
            + + QL      D+    E LID   AT++IP++I LP ST+ +PLLYFT+EFDN++ T
Sbjct: 179 VSSLSQLHLSDGGDE----ENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVAT 234

Query: 220 ISPDMGTMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLLLPSKNWQQEIGEQDEVLKEI 279
           I P+ GT+    FNKISTFDVTRKL FLKIDVFARIPS+LLPSK+WQQ +   D  LK+I
Sbjct: 235 IEPESGTISNLTFNKISTFDVTRKLNFLKIDVFARIPSILLPSKSWQQ-LNSSDPSLKDI 293

Query: 280 LKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPL 339
           L +IN NQDIH+DS++LPL L  D+A+  RLYNH WI L +G GKLN++VDYKP+ N+ L
Sbjct: 294 LDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRAL 353

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           S+DDF+LLKVIGKGSFGKVMQVRKKDT K+YALKA+RK+YIVSK EV HTLAERTVLARV
Sbjct: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
           + PFIVPLKF+FQSP+KLY+VLAFINGGELFYHLQ EGRFSL+R+R Y AELLCAL++LH
Sbjct: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
            LDVIYRDLKPENILLD+QGHIALCDFGLCKLNMK  DKT+TFCGTPEYLAPE+LLGQGY
Sbjct: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
           +K VDWWTLG+LLYEMMTGLPPYYDE+VP MYKKILQ+PL FPDGFD  AKDLLIGLLSR
Sbjct: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSR 593

Query: 580 DPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPI 639
           DP RRLG NG DEI++HPFF  +SWK+L +KGYIPPYKP V + +DT+NFDQEFTKE P+
Sbjct: 594 DPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPV 653

Query: 640 DSVVDEYLSASIQKQFGGWTYIGDEQ 665
           DSVV+++LS S+Q+QFGGWTY+G EQ
Sbjct: 654 DSVVNDFLSESVQQQFGGWTYVGSEQ 679

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/564 (71%), Positives = 469/564 (83%), Gaps = 9/564 (1%)

Query: 105 TETQGPSSESGLMTVKVYSGKDFTLPFPITSNSTILQKLLSSGI-LTSSSNDAS--EVAA 161
            E +   S +G++TVKVYSG  F LP PIT N  +L KLLSSG+ +TS++   S  E+  
Sbjct: 146 VENENTHSSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQ 205

Query: 162 IMRQLPRYKRVDQDSAGEGLIDRAFATKFIPSSILLPGSTNSSPLLYFTIEFDNSITTIS 221
            M  L   +  D+  +GE       A+ FIP+S++LPGS N + LLYFTIEFDN+I TI 
Sbjct: 206 SMHGLSLLREEDKLLSGED------ASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIE 259

Query: 222 PDMGTMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLLLPSKNWQQEIGEQDEVLKEILK 281
           P+ GT+ +P+FNKISTFDVTR+L FLKIDVFARIPS+LLPS+NWQ+     +++L + +K
Sbjct: 260 PESGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVK 319

Query: 282 KINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPLSI 341
           KI  N DIHLDSFHLPLNLKIDSA+ IRLYNHHWI LE   GKLN++VDYKPS +K LSI
Sbjct: 320 KIRNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSI 379

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           DDFDLLKVIGKGSFGKVMQVRK+DT KIYALKA+RK+YIVSK EVTHTLAERTVLARVD 
Sbjct: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           PFIVPLKFSFQS EKLYLVLAFINGGELFYHLQ EGRF L+RSRFY AELLCAL++LH  
Sbjct: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTK 521
           D+IYRDLKPENILLDYQGHIALCDFGLCKLNMKD +KT TFCGTPEYLAPE+LLGQGYTK
Sbjct: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTK 559

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDP 581
            VDWWTLG+LLYEM+TGLPPYYDE+VP MYKKILQ PL FPD FD  AKDLLIGLL RDP
Sbjct: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDP 619

Query: 582 SRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDS 641
            RRLG +G+DEI++HPFF  +SWK+L +KGYIPPYKP V   +DT+NFDQEFT+E+P+DS
Sbjct: 620 KRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDS 679

Query: 642 VVDEYLSASIQKQFGGWTYIGDEQ 665
           VV+++LS S+Q+QFGGWTY+G EQ
Sbjct: 680 VVNDFLSESVQQQFGGWTYVGSEQ 703

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/706 (55%), Positives = 500/706 (70%), Gaps = 49/706 (6%)

Query: 1   MHSWRISKFKLGRSKEDDGSSED-----------ENEKSWGNGLFHFHHGEKHHDGSPKN 49
           M+ W++ +FK GR K+DD   +              + + G+ +F     E+    +  N
Sbjct: 1   MYGWKLHRFKFGRGKDDDSRKKKMIISSSQSSLNSADTAAGDSIFSRPSVERRDTVTAAN 60

Query: 50  --------HNHEHEHHIRKINTNET---LPSSLSSPK-----------------LRNDAS 81
                       +  + ++ N N +   LPS L S K                    D+S
Sbjct: 61  GSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDSFSPFNSSSNSSSNLGSNRDSS 120

Query: 82  FKNPSGIGNDNSKASERKASQSSTETQGPSSESGLMTVKVYSGKDFTLPFPITSNSTILQ 141
             + + + ND +  S      +  +    +  SGL+TVKVYSG +FT+P PITS+  IL 
Sbjct: 121 MTDVTELLNDTAFKS------TPFDRIDENMHSGLLTVKVYSGSNFTMPVPITSDQGILH 174

Query: 142 KLLSSGI--LTSSSNDASEVAAIMRQLPRYKRVDQDSAGEGLIDRAFATKFIPSSILLPG 199
            LL+S I  L   +N  +E+  ++ QL +    +Q S  E LI  AF++ FIP+ I +PG
Sbjct: 175 NLLNSSISSLEGDNNTYAEMEQLITQLSQVHLANQTSE-EQLISNAFSSTFIPAVIKVPG 233

Query: 200 STNSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLL 259
             +  PL+Y T+E+DN++ TI P+ GT+ +PVFNKISTFDVTRKL FLK  VF +IPS L
Sbjct: 234 H-DDYPLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSAL 292

Query: 260 LPSKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLE 319
           LPS  WQQE    D  ++ IL+ I+  ++I LDSF LP+ L ++SA+  RL+NH WI+L+
Sbjct: 293 LPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLK 352

Query: 320 RGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAY 379
           +G G +N+TVD+KPS +KP+ IDDF+LL V+GKGS+GKVMQVRKKDTQKIYALKA+RK+Y
Sbjct: 353 QGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSY 412

Query: 380 IVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRF 439
           IV+K EV HTLAERT+LARV+CPFIVPLKF+FQ+PEKLYLVLA INGGELF+HLQ EG F
Sbjct: 413 IVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIF 472

Query: 440 SLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT 499
            ++R+RFY +ELL ALDSLHK+DV+YRDLKPENILLD QGHIALCDFGLCKLNMKDN+KT
Sbjct: 473 DISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKT 532

Query: 500 DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPL 559
            TFCGTPEYLAPE+LLG+GYTK VDWWTLG+LLYEM+TGLPPYYDENV  MYKKIL+ PL
Sbjct: 533 STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPL 592

Query: 560 LFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPI 619
           +FPDG DP AKDLL  LL+RDP+RRLG NG DEI+NH FF D+ W  +  K Y+PP++P 
Sbjct: 593 IFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPD 652

Query: 620 VKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDEQ 665
           V++  DT+NFD EFTK+KP+DSV+DEYLS S+Q QF GW+Y+G EQ
Sbjct: 653 VQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSYLGSEQ 698

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  356 bits (914), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/452 (44%), Positives = 277/452 (61%), Gaps = 53/452 (11%)

Query: 226 TMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLLLPSKNWQQEIGEQDEVLKEILKKINT 285
           T   PV++  +TFDV      L+I V+               +    D  L ++  + NT
Sbjct: 215 TSSNPVWHHETTFDVIGARSELEISVY---------------DAAHGDVFLGQVRLRPNT 259

Query: 286 N--QDIHLDSFHLPLNLKIDS-AAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPLSID 342
           +   D+H     L      +S + +I +   +W + +R YG                   
Sbjct: 260 HTKHDVHNQWSKLNGRTVGESVSGEILVRWEYWHTEKRHYGP-----------------Q 302

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV--- 399
           DF++L+++GKG+FG+V QVRKKDT++IYA+K L K  IV K E+ HT+ ER +L R    
Sbjct: 303 DFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASK 362

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
            CPFIV LKFSFQ+P  LYLV  F++GGELF+HLQ EGRF+  R++FYIAEL+ AL+ LH
Sbjct: 363 SCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLH 422

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ-G 518
             D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT EYLAPE+LL + G
Sbjct: 423 DNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETG 480

Query: 519 YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP-DGFDPAAKDLLIGLL 577
           YTK VD+W+LG+L++EM  G  P++ E+   MY+KI    + FP D   P  +  + GLL
Sbjct: 481 YTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLL 540

Query: 578 SRDPSRRLG-VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTK- 635
           +R+P  RLG VN   E+R HPF  DI W+ L  K   PP+KP + SE DT+NFD EFT+ 
Sbjct: 541 NRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFDPEFTQT 600

Query: 636 ------EKPIDSVVDEYLSASIQKQFGGWTYI 661
                 ++PI +     LS ++Q +F G+T++
Sbjct: 601 STSFMNKQPIAATP---LSPAMQAKFAGFTFV 629

>Kwal_47.16761
          Length = 744

 Score =  355 bits (912), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 242/349 (69%), Gaps = 12/349 (3%)

Query: 323 GKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVS 382
           G +++  D+K +  +     DF++L+++GKG+FG+V QVRKKDT++IYA+K L K  IV 
Sbjct: 313 GHISVKWDFKATMKQHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVK 372

Query: 383 KCEVTHTLAERTVLARV---DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRF 439
           K E+ HT+ ER +L R     CPFIV LKFSFQ+P  LYLV  F++GGELF+HLQ EGRF
Sbjct: 373 KNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRF 432

Query: 440 SLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT 499
           +  R+RFYIAEL+ AL+ LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T
Sbjct: 433 AEDRARFYIAELVLALEYLHENDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRT 490

Query: 500 DTFCGTPEYLAPEILLGQ-GYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQP 558
           +TFCGT EYLAPE+LL + GYTK VD+W+LG+L++EM  G  P++ E+   MY+KI    
Sbjct: 491 NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGK 550

Query: 559 LLFP-DGFDPAAKDLLIGLLSRDPSRRLG-VNGTDEIRNHPFFKDISWKKLLLKGYIPPY 616
           + FP D   P  +  + GLL+R+P  RLG ++   E+R HPFF +I W+ L  K   PP+
Sbjct: 551 VKFPRDVLSPEGRSFVKGLLNRNPRHRLGAIDDGRELRAHPFFAEIDWEALRQKKIPPPF 610

Query: 617 KPIVKSEIDTANFDQEFTKEKPI----DSVVDEYLSASIQKQFGGWTYI 661
           KP +  E DT+NFD EFT+          +    LS ++Q +F G+T++
Sbjct: 611 KPHLTGETDTSNFDPEFTQTSTSFMNKQGIAATPLSPAMQAKFVGFTFV 659

>Scas_703.5
          Length = 749

 Score =  351 bits (900), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 244/357 (68%), Gaps = 19/357 (5%)

Query: 319 ERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKA 378
           E   G + I  +Y  +K +    +DF++L+++GKG+FG+V QV+KKDT++IYA+K L K 
Sbjct: 319 ENVTGDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKK 378

Query: 379 YIVSKCEVTHTLAERTVL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQH 435
            IV K EV HT+ ER +L   A    PFIV LKFSFQ+P  LYLV  F++GGELF+HLQ 
Sbjct: 379 VIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQK 438

Query: 436 EGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 495
           EGRF+  R++FYIAEL+ AL+ LH  D++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 439 EGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 497

Query: 496 NDKTDTFCGTPEYLAPEILLGQ-GYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
            D+T+TFCGT EYLAPE+LL + GYTK VD+W+LG+L++EM  G  P++ E+   MY+KI
Sbjct: 498 -DRTNTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKI 556

Query: 555 LQQPLLFP-DGFDPAAKDLLIGLLSRDPSRRLG-VNGTDEIRNHPFFKDISWKKLLLKGY 612
               + FP D   P  +  + GLL+R+P  RLG ++   E+R HPFF DI W  L  K  
Sbjct: 557 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKI 616

Query: 613 IPPYKPIVKSEIDTANFDQEFT--------KEKPIDSVVDEYLSASIQKQFGGWTYI 661
            PP+KP + SE DT+NFD EFT        K +PI +     LS ++Q +F G+T++
Sbjct: 617 PPPFKPHLVSETDTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQAKFAGFTFV 670

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  346 bits (887), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 175/352 (49%), Positives = 242/352 (68%), Gaps = 18/352 (5%)

Query: 323 GKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVS 382
           G + I  +Y  +K +     DF++L+++GKG+FG+V QVRKKDT +IYA+K L K  IV 
Sbjct: 304 GDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVK 363

Query: 383 KCEVTHTLAERTVLARV---DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRF 439
           K E+ HT+ ER +L R      PFIV LKFSFQ+P  LYLV  F++GGELF+HLQ EGRF
Sbjct: 364 KNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRF 423

Query: 440 SLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT 499
           +  R++FYIAEL+ AL+ LH  D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T
Sbjct: 424 TEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRT 481

Query: 500 DTFCGTPEYLAPEILLGQ-GYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQP 558
           +TFCGT EYLAPE+L+ + GYTK VD+W+LG+L++EM  G  P++  +   MY+KI    
Sbjct: 482 NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGK 541

Query: 559 LLFP-DGFDPAAKDLLIGLLSRDPSRRLG-VNGTDEIRNHPFFKDISWKKLLLKGYIPPY 616
           + FP D   P  +  + GLL+R+P  RLG ++   E+R HPFF DI W+ +  K   PP+
Sbjct: 542 VKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPF 601

Query: 617 KPIVKSEIDTANFDQEFTK-------EKPIDSVVDEYLSASIQKQFGGWTYI 661
           KP + SE DT+NFD EFT+       ++PI +     LS ++Q +F G+T++
Sbjct: 602 KPHLISETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFVGFTFV 650

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  345 bits (885), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 255/391 (65%), Gaps = 23/391 (5%)

Query: 290 HLDSFHLPLNLKIDSAAQIRLYNHHWISL------ERGYGKLNITVDYKPSKNKPLSIDD 343
           H D F   + L+ +      + +  W  L      E+  G++ +   Y  +K +     D
Sbjct: 280 HEDMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQD 339

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC-- 401
           F++L+++GKG+FG+V QV+KKDT++IYA+K L K  IV K E+ HT+ ER +L       
Sbjct: 340 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKA 399

Query: 402 -PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            PFIV LKFSFQ+P  LYLV  +++GGELF+HLQ EGRF+  R++FYIAEL+ AL+ LH 
Sbjct: 400 SPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHD 459

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ-GY 519
            D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T+TFCGT EYLAPE+LL + GY
Sbjct: 460 NDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDESGY 517

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP-DGFDPAAKDLLIGLLS 578
           TK VD+W+LG+L++EM  G  P+Y E+   MY+KI    + FP D   P  +  + GLL+
Sbjct: 518 TKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLN 577

Query: 579 RDPSRRLG-VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEK 637
           R+P  RLG ++   E+R HPFF DI W+ L  K   PP+KP + SE DT+NFD EFT+  
Sbjct: 578 RNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQTS 637

Query: 638 PIDSVVDEY-------LSASIQKQFGGWTYI 661
              S ++++       LS  +Q +F G+T++
Sbjct: 638 --TSYMNKHHQMAATPLSPGMQAKFAGFTFV 666

>Scas_689.25*
          Length = 409

 Score =  270 bits (690), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           +IDDF++L+  G GSFG+V  VR     + YALK L+K  +V   +V HT  ER +L+  
Sbjct: 95  TIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVS 154

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
              FIV L  +FQ  E L++++ ++ GGELF  L+   RF    ++FY AE+  ALD LH
Sbjct: 155 VHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDYLH 214

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
            LD+IYRDLKPEN+LLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 215 SLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV---PDVTYTLCGTPDYIAPEVISAKPY 271

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
            K+VDWW+ GIL+YEM++G  P+YD +    Y+ IL  PL FP  F P A+DLL  L++R
Sbjct: 272 NKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLSRLITR 331

Query: 580 DPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYK-PIVKSEIDTANFDQ 631
           D + RLG   NGT++I+NH +F ++ W KLL +    PY+ PI + + DT+ FD+
Sbjct: 332 DLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDR 386

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  270 bits (691), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 195/304 (64%), Gaps = 6/304 (1%)

Query: 331 YKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTL 390
           Y  + +   ++ DF +L+ +G GSFG+V  +R     + YALKAL+K  +V   +V HT 
Sbjct: 139 YGANTSGKYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTN 198

Query: 391 AERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAE 450
            ER +L+ V  PFI+ +  +FQ  + +++V+ +I GGELF  L+   RF    ++FY AE
Sbjct: 199 DERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 258

Query: 451 LLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLA 510
           +  AL+ LH  ++IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+A
Sbjct: 259 VCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIA 315

Query: 511 PEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAK 570
           PE++  + Y K+VDWW+ GIL+YEM+ G  P+YD N    Y+ IL   L FP  F P  +
Sbjct: 316 PEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQ 375

Query: 571 DLLIGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYK-PIVKSEIDTA 627
           DLL  L++RD S+RLG   NG+++++NHP+F ++ W+KLL +    PY+ PI + + DT+
Sbjct: 376 DLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTS 435

Query: 628 NFDQ 631
            FD+
Sbjct: 436 QFDR 439

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  266 bits (681), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 191/292 (65%), Gaps = 6/292 (2%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF +L+ +G GSFG+V  VR     + YA+K L+K  +V   +V HT  ER +L+ V  P
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           FI+ +  +FQ  ++L++++ +I GGELF  L+   RF    ++FY AE+  AL+ LH   
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKT 522
           +IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y K+
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKY---VPDVTYTLCGTPDYIAPEVVSTKPYNKS 320

Query: 523 VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPS 582
           VDWW+ G+L+YEM+ G  P+YD N    Y+ IL  P+ FP  F   A+DL+  L++RD S
Sbjct: 321 VDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLISKLITRDLS 380

Query: 583 RRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKS-EIDTANFDQ 631
           +RLG   NG+++++NHP+F ++ W+KLL K    PY+P +++ + DT+ +D+
Sbjct: 381 QRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDR 432

>Kwal_33.13846
          Length = 375

 Score =  262 bits (670), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           +++DF +L+ +G GSFG+V  VR     + YA+K L+K  IV   +V HT  ER +L+ V
Sbjct: 61  TLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVV 120

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
             PFI+ +  +FQ  E +++++ +I GGELF  L+   RF    ++FY AE+  AL+ LH
Sbjct: 121 SHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 180

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
             D+IYRDLKPEN+LLD  GH+ + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 181 AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFV---PDVTYTLCGTPDYIAPEVVSTKPY 237

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
            K+VDWW+ GIL++EM+ G  P+YD N    Y+ IL   L FP  F    +DLL  L++R
Sbjct: 238 NKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQDLLSQLITR 297

Query: 580 DPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKS-EIDTANFDQ 631
           D S+RLG   NG+++++NH +F ++ W+KLL +    PY+P V++ + DT+ +D+
Sbjct: 298 DLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDR 352

>Scas_651.18
          Length = 371

 Score =  260 bits (664), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 129/295 (43%), Positives = 192/295 (65%), Gaps = 6/295 (2%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           +++DF +L+ +G GSFG+V  +R     + YALK L+K  IV   +V HT  ER +L+ V
Sbjct: 55  TLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVV 114

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
             PF+V +  +FQ  E++++++ +I GGELF  L+   RF    ++FY AE+  AL+ LH
Sbjct: 115 SHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 174

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
            +D+IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 175 SMDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDITYTLCGTPDYIAPEVVSTKPY 231

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
            K+VDWW+ GIL+YEM+ G  P+YD N    Y+ IL   L FP+ F    KDLL  L+++
Sbjct: 232 NKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLSKLITK 291

Query: 580 DPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYK-PIVKSEIDTANFDQ 631
           + + RLG   NG+++++ HP+F ++ W+KLL +    PY+ PI + + DT+ FD+
Sbjct: 292 NLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDR 346

>Scas_715.34
          Length = 1150

 Score =  277 bits (708), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 211/338 (62%), Gaps = 6/338 (1%)

Query: 332  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA 391
            + SK + +S+D+F LLKV+GKG+FGKV+  R K+T ++ A+K L+K  I+   ++    A
Sbjct: 811  RNSKRRKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARA 870

Query: 392  ERTVL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            E+ V     +   PF+  L  SFQ+  ++Y  + FI GG+L +H+Q++ R S+ R++FY 
Sbjct: 871  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 929

Query: 449  AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
            AE+L AL   H   VIYRDLK ENILL  QGHI + D+GLCK  M  N+KT TFCGTPE+
Sbjct: 930  AEVLLALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEF 989

Query: 509  LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA 568
            +APEIL  QGYT+ VDWW  G+LLY+M+    P+  ++   ++  IL    L+P      
Sbjct: 990  MAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1049

Query: 569  AKDLLIGLLSRDPSRRLGVNGTD--EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDT 626
               +  GLL++DP  RLG    D  E+   PFF++I+++ +L     PPY P +KS  DT
Sbjct: 1050 IVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDT 1109

Query: 627  ANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDE 664
            + F+ EFT   P  + +   L+ + Q++F G++++ D+
Sbjct: 1110 SYFEHEFTSAPPTLTPLPSILTTTQQEEFRGFSFMPDD 1147

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  276 bits (707), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 212/338 (62%), Gaps = 6/338 (1%)

Query: 332  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA 391
            K  K + +S+DDF LLKV+GKG+FGKV+  R K+T ++ A+K L+K +I+   ++    A
Sbjct: 810  KTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARA 869

Query: 392  ERTVL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            E+ V     +   PF+  L  SFQ+  ++Y  + FI GG+L +H+Q++ R S+ R++FY 
Sbjct: 870  EKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 928

Query: 449  AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
            AE+L AL   H   +IYRDLK ENILL  +GHI + D+GLCK  M   ++T TFCGTPE+
Sbjct: 929  AEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEF 988

Query: 509  LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA 568
            +APEIL  Q YTK VDWW  G+LLY+M+    P+  ++   ++  IL    L+P      
Sbjct: 989  MAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1048

Query: 569  AKDLLIGLLSRDPSRRLGVNGTD--EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDT 626
               +  GLL++DP +RLG    D  E+   PFF++I++  +L     PPY P +K+  DT
Sbjct: 1049 IVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDT 1108

Query: 627  ANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDE 664
            + F++EFT   P  + +   LS+++Q++F G++++ D+
Sbjct: 1109 SYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFMPDD 1146

>Kwal_56.24059
          Length = 353

 Score =  258 bits (658), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 131/301 (43%), Positives = 194/301 (64%), Gaps = 7/301 (2%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           SK K  S++DF +L+ +G GSFG+V  VR     + YA+K L+K  ++   ++ HT  ER
Sbjct: 34  SKGK-YSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDER 92

Query: 394 TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLC 453
            +L  VD PF++ +  +FQ    L++V+ +I GGELF  L+   RF    ++FY AE++ 
Sbjct: 93  RMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL 152

Query: 454 ALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEI 513
           AL+ LH  D+IYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE+
Sbjct: 153 ALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEV 209

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLL 573
           +  + Y K+VDWW+LGIL++EM+ G  P+YD      Y+KILQ  + +P  F P   DLL
Sbjct: 210 IATKPYNKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLL 269

Query: 574 IGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEI-DTANFD 630
             L++ D +RRLG   +G  ++++HP+F ++ W+KLL K    PY+P + + + DT+ FD
Sbjct: 270 CKLITSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFD 329

Query: 631 Q 631
           Q
Sbjct: 330 Q 330

>Kwal_27.10581
          Length = 1154

 Score =  272 bits (696), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 137/335 (40%), Positives = 209/335 (62%), Gaps = 6/335 (1%)

Query: 335  KNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT 394
            K + +S+DDF LLKV+GKG+FGKV+    K+ +++ A+K L+K +I+   ++    AE+ 
Sbjct: 818  KRRKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKK 877

Query: 395  VL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAEL 451
            V     +   PF+  L  SFQ+  ++Y  + FI GG+L +H+Q++ R S+ R++FY AE+
Sbjct: 878  VFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEV 936

Query: 452  LCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAP 511
            L AL   H   VIYRDLK ENILL  +GHI + D+GLCK  M   +KT TFCGTPE++AP
Sbjct: 937  LLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAP 996

Query: 512  EILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKD 571
            EIL  Q YTK VDWW  G+LLY+M+    P+  E+   ++  IL    L+P         
Sbjct: 997  EILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQ 1056

Query: 572  LLIGLLSRDPSRRLGVNGTD--EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANF 629
            +  GLL++DP RRLG    D  E+   PFF++I +  +L     PPY P +K+  DT+ F
Sbjct: 1057 IFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSYF 1116

Query: 630  DQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDE 664
            ++EFT   P  + +   LS+++Q++F G++++ ++
Sbjct: 1117 EKEFTSAPPTLTPLPSVLSSNLQEEFRGFSFMPED 1151

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  272 bits (696), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 210/338 (62%), Gaps = 6/338 (1%)

Query: 332  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA 391
            + +K + +S+D+F LLKV+GKG+FGKV+  + K+T ++ A+K L+K  I+   ++    A
Sbjct: 812  RAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARA 871

Query: 392  ERTVL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            E+ V     +   PF+  L  SFQ+  ++Y  + FI GG+L +H+Q++ R S+ R++FY 
Sbjct: 872  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 930

Query: 449  AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
            AE+L AL   H   VIYRDLK ENILL  +GHI + D+GLCK  M   ++T TFCGTPE+
Sbjct: 931  AEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEF 990

Query: 509  LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA 568
            +APEIL  Q YTK VDWW  G+LLY+M+    P+  ++   ++  IL    L+P      
Sbjct: 991  MAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGE 1050

Query: 569  AKDLLIGLLSRDPSRRLGV--NGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDT 626
               +  GLL++DP +RLG      DE+   PFF++I++  +L     PPY P +KS  DT
Sbjct: 1051 IVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDT 1110

Query: 627  ANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIGDE 664
            + F+QEFT   P  + +   L+ S Q++F G++++ D+
Sbjct: 1111 SYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFMPDD 1148

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  272 bits (695), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 207/335 (61%), Gaps = 6/335 (1%)

Query: 332  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA 391
            + SK   +S+D+F LLKV+GKG+FGKV+  R K+T ++ A+K L+K  I+   ++    A
Sbjct: 805  RGSKRPKVSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARA 864

Query: 392  ERTVL---ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            E+ V     +   PF+  L  SFQ+  ++Y  + FI GG+L +H+Q++ R S+ R++FY 
Sbjct: 865  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 923

Query: 449  AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
            AE+L AL   H   VIYRDLK ENILL  +GHI + D+GLCK  M   +KT TFCGTPE+
Sbjct: 924  AEVLLALKFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEF 983

Query: 509  LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA 568
            +APE+L  Q YTK VDWW  G+LLY+M+    P+  ++   ++  IL    L+P      
Sbjct: 984  MAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1043

Query: 569  AKDLLIGLLSRDPSRRLGVNGTD--EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDT 626
               +  GLL++DP +RLG    D  EI   PFF++I++  LL     PPY P +KS  DT
Sbjct: 1044 IVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDT 1103

Query: 627  ANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYI 661
            + F+QEFT   P  + +   LS + Q++F G++Y+
Sbjct: 1104 SYFEQEFTSAPPSLTPLPSVLSTTQQEEFRGFSYM 1138

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  271 bits (694), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 139/331 (41%), Positives = 206/331 (62%), Gaps = 6/331 (1%)

Query: 339  LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-- 396
            +S+DDF LLKV+GKG+FGKV+  R K+T  + A+K L+K  I+   ++    AE+ V   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 397  -ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCAL 455
                  PF+  L  SFQ+  ++Y  + FI GG+L +H+Q+  R S+ R++FY AE+L +L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNR-RLSVRRAKFYAAEVLLSL 947

Query: 456  DSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL 515
               H   VIYRDLK ENILL  +GHI + D+GLCK NM   +KT TFCGTPE++APEIL 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 516  GQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIG 575
            GQ YTK VDWWT G+LLY+M+    P+  E+   ++  IL    L+P         +  G
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 576  LLSRDPSRRLGVNGTD--EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEF 633
            LL++DP +RLG    D  EI   PFF +I++  +L     PP+ P +K+  DT+ F++EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 634  TKEKPIDSVVDEYLSASIQKQFGGWTYIGDE 664
            T   P  + +   LS+ +Q++F G++++ ++
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSFMPED 1158

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  252 bits (644), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 188/295 (63%), Gaps = 6/295 (2%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           S+ DF +++ +G GSFG+V  VR     + YA+K L+KA +V   ++ HT  ER +L  V
Sbjct: 47  SLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLKLV 106

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
           + PF++ +  +FQ    L++V+ +I GGELF  L+   RF    ++FY AE+  AL+ LH
Sbjct: 107 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLH 166

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
             ++IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  + Y
Sbjct: 167 FHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEVIATKPY 223

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
            K+VDWW+LG+L+YEM+ G  P+YD      Y+KIL   +++P  F+    DLL  LL+ 
Sbjct: 224 NKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTA 283

Query: 580 DPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEI-DTANFDQ 631
           D +RR+G    G  +I++HP+F ++ W+KLL K    PY+P + + + DT+ FDQ
Sbjct: 284 DLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  249 bits (637), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 194/301 (64%), Gaps = 7/301 (2%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           SK K  S+ DF +++ +G GSFG+V  VR     + YA+K L+K  ++   ++ HT  ER
Sbjct: 27  SKGK-YSLQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDER 85

Query: 394 TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLC 453
            +L  V+ PF++ +  +FQ    L++V+ +I GGELF  L+   RF    ++FY AE+  
Sbjct: 86  RMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTL 145

Query: 454 ALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEI 513
           AL+ LH  ++IYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE+
Sbjct: 146 ALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEV 202

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLL 573
           +  + Y K++DWW+LGIL++EM+ G  P+YD      Y+KIL   ++FP  F P A DLL
Sbjct: 203 ITTKPYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLL 262

Query: 574 IGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEI-DTANFD 630
             L++ D +RRLG   +G+ +I++HP+F ++ W+KLL K    PY+P + + + D++ FD
Sbjct: 263 GKLITDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFD 322

Query: 631 Q 631
           Q
Sbjct: 323 Q 323

>Scas_690.13
          Length = 354

 Score =  246 bits (628), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 191/301 (63%), Gaps = 7/301 (2%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           SK K  ++ DF +++ +G GSFG+V  VR     + YA+K L+K  +V   ++ HT  ER
Sbjct: 35  SKGK-YTLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDER 93

Query: 394 TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLC 453
            +L  V+ PF++ +  +FQ    L++V+ +I GGELF  L+   RF    ++FY AE+  
Sbjct: 94  RMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTL 153

Query: 454 ALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEI 513
            L+ LH  ++IYRDLKPENILLD  GHI + DFG  K   + +  T T CG P+Y+APE+
Sbjct: 154 GLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEV 210

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLL 573
           +  + Y K+VDWW+LG+L++EM+ G  P+YD      Y+KILQ  +++P  F P   DLL
Sbjct: 211 IATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLL 270

Query: 574 IGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEI-DTANFD 630
             L++ D +RR+G   +G+ +I+ HP+F ++ W+KLL K    PY+P + + I DT+ FD
Sbjct: 271 GKLITADLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFD 330

Query: 631 Q 631
           Q
Sbjct: 331 Q 331

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  246 bits (628), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 191/301 (63%), Gaps = 7/301 (2%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           SK K  ++ DF +++ +G GSFG+V  VR     + YA+K L+K  I+   ++ HT  ER
Sbjct: 53  SKGK-YTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDER 111

Query: 394 TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLC 453
            +L  V+ PF++ +  +FQ    L++V+ +I GGELF  L+   RF    ++FY AE+  
Sbjct: 112 RMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTL 171

Query: 454 ALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEI 513
           AL+ LH  ++IYRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APE+
Sbjct: 172 ALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEV 228

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLL 573
           +  + Y K+VDWW+LGIL++EM+ G  P+YD      Y+KIL   +++P  F P   DLL
Sbjct: 229 ITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLL 288

Query: 574 IGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEI-DTANFD 630
             L++ D +RRLG   +G D+I++HP+F ++ W+KL+ K    PY+P +   + D++ FD
Sbjct: 289 GKLITADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFD 348

Query: 631 Q 631
           Q
Sbjct: 349 Q 349

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  246 bits (628), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 188/295 (63%), Gaps = 6/295 (2%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           ++ DF +L+ +G GSFG+V  VR     + YA+K L+K  +V   +V HT  ER +L+ V
Sbjct: 72  TLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVV 131

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
             PFI+ +  +FQ   ++++++ +I GGELF  L+   RF    ++FY AE+  AL+ LH
Sbjct: 132 SHPFIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 191

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
             D+IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 192 SKDIIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPY 248

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
            K+VDWW+ GIL+YEM+ G  P+YD+N    Y+ IL   + FP  F+   +DLL  L++R
Sbjct: 249 NKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLLSQLITR 308

Query: 580 DPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYK-PIVKSEIDTANFDQ 631
           D S+RLG   NG+ +++ HP+F ++ W KLL +    PY+ PI   + DT+ +D+
Sbjct: 309 DLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDR 363

>Kwal_56.22788
          Length = 515

 Score =  226 bits (575), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 138/390 (35%), Positives = 207/390 (53%), Gaps = 62/390 (15%)

Query: 335 KNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV------------S 382
           K+   +++DF  ++V+G+G++GKV+ V+   T ++YA+K L+KA I+            S
Sbjct: 116 KHGTRTLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDS 175

Query: 383 KCE--VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFS 440
             E  +  T AERT+L++++ P IV L +SF    KLYL+L FI GGELFYHL+ +G   
Sbjct: 176 NLEKRLERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLD 235

Query: 441 LARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND--- 497
                FY AE+ CAL  LHK  V+YRDLKPEN LLD +GH+ L DFGL K++  D+    
Sbjct: 236 EDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADG 295

Query: 498 --------KTDTFC------GTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYY 543
                   + ++ C      GTPEY APEIL G+ YT+  DW++LG L+++M+ G PPY 
Sbjct: 296 GDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYT 355

Query: 544 DENVPVMYKKILQQPL-LFPDGFDPAAKDLLIGLLSRDPSRRLGVN-------------- 588
             N  V+  KIL+  +   P       KD L  LL +D ++R  V+              
Sbjct: 356 GVNHKVILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKK 415

Query: 589 ----GTDEIRNHPFFKDISWKKL----LLKGYIPPYKPIVKSEIDTANFDQEFT------ 634
                T   + H  F+ ISW K+    L +    P  PI+       NFD EFT      
Sbjct: 416 AGQAKTTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDS 475

Query: 635 --KEKPIDSVVDEYLSASIQKQFGGWTYIG 662
             +++P +  ++ +  +  +  F G++Y+ 
Sbjct: 476 EAQDQPANLQINGFSRSGDKDVFKGFSYVA 505

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/378 (37%), Positives = 202/378 (53%), Gaps = 60/378 (15%)

Query: 338 PLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV-------------SKC 384
           P  +DDF  ++ +G+G++GKV+ V+   + K+YA+K L+KA I+              + 
Sbjct: 164 PRVLDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEK 223

Query: 385 EVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS 444
            +  T AERT+L++++ P IV L +SF    KLYLVL +I GGELFYHL+ +G       
Sbjct: 224 RIERTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTV 283

Query: 445 RFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTD---- 500
            FY AEL CAL  LH   ++YRDLKPEN LL+ +GH+ L DFGL K ++ D+  T     
Sbjct: 284 AFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGE 343

Query: 501 ------TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
                 +  GTPEY APEIL G+ YT+  DW++LG L+Y+M+ G PP+   N  ++  KI
Sbjct: 344 NVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNHKIILNKI 403

Query: 555 LQQ------PLLFPDGFDPAAKDLLIGLLSRDPSRRLGVN---------------GTDEI 593
            Q+      P    DGF    KD L  LL +DP++R  V+               G  + 
Sbjct: 404 KQEKTGARIPSYLSDGF----KDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQAKT 459

Query: 594 RN---HPFFKDISWKKL----LLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
            N   H  F+ I WK+L    L K  + P  PI+       NFD EFT+++   S+ D  
Sbjct: 460 TNYIGHFIFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFTEKRLDTSIYDNG 519

Query: 647 LS-----ASIQKQFGGWT 659
           +      A+ +  F G T
Sbjct: 520 IEINNPRATKESAFAGST 537

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  226 bits (577), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/303 (39%), Positives = 179/303 (59%), Gaps = 28/303 (9%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ ++++G+G  GKV  V++K T ++YALK   K+ ++ + ++   LAE+ +LA  + PF
Sbjct: 497 FEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 556

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           +V L  SFQS + LYL + +  GGE F  LQ      ++   ++FY +E+  AL+ LH L
Sbjct: 557 VVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLL 616

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGL-----------CKLNMK----------DNDKTD 500
             IYRDLKPENILL   GHI L DF L            K N +          D  +T+
Sbjct: 617 GFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTN 676

Query: 501 TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLL 560
           +F GT EY+APE++ G G+T  VDWWTLGIL+YEM+ G  P+  EN    +  IL++ + 
Sbjct: 677 SFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVT 736

Query: 561 FPDGFDPA--AKDLLIGLLSRDPSRRLGVN-GTDEIRNHPFFKDISWKKLLLKGYIPPYK 617
           FP+  + +   KDL+  LL ++ S+RLG   G  +I+ HPFFK ++W   LL+   PP  
Sbjct: 737 FPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNW--TLLRNQEPPLI 794

Query: 618 PIV 620
           P++
Sbjct: 795 PVL 797

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  223 bits (568), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 178/300 (59%), Gaps = 25/300 (8%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ ++++G+G  GKV  +R++DT +I+ALK L K  ++ + ++   L E+ +LA  D PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           IV L  SFQ+ + LYL + +  GGE F  LQ      +A   ++FY +E++ AL+ LH L
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLC-------KLNMKDND-----------KTDTFC 503
             IYRDLKPENILL   GH+ L DF L        K  MKD+            +T++F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 504 GTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPD 563
           GT EYLAPE++ G G+T  VDWWTLGIL+YEM+ G  P+  +N    +  IL + + FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 564 GFDPA--AKDLLIGLLSRDPSRRLGV-NGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIV 620
             + +   KDL+  LL+++ ++RLG  +G  +I+ HPFFK + W    L+   PP  P +
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWS--FLRNQDPPLIPAL 621

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  223 bits (568), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 128/349 (36%), Positives = 185/349 (53%), Gaps = 63/349 (18%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +DF  ++VIGKG+FG+V  V+KKDT KIYA+K L K+ +  K ++ H  AER VLA  D 
Sbjct: 368 EDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDS 427

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           P+IV L +SFQ  + LYL++ F+ GG+L   L     F+   +RFY+AE + A++++HKL
Sbjct: 428 PWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 487

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLC-------------------------------- 489
             I+RD+KP+NIL+D +GHI L DFGL                                 
Sbjct: 488 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAG 547

Query: 490 --------------KLNMKDNDKTDTF-----------CGTPEYLAPEILLGQGYTKTVD 524
                          L M +  +  T+            GTP+Y+APEI L QGY +  D
Sbjct: 548 DGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCD 607

Query: 525 WWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLLFPDGFDPA--AKDLLIGLLSRD 580
           WW+LG ++YE + G PP+  E     Y+KI+  +Q L FP+    +  A+DL+  LL+  
Sbjct: 608 WWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHS 667

Query: 581 PSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANF 629
             R     G DEI++HPFF+ + W    ++    PY P + S  DT  F
Sbjct: 668 NQRLGRQGGADEIKSHPFFRGVDWNT--IRQVEAPYIPKLSSITDTRFF 714

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  217 bits (552), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 135/360 (37%), Positives = 185/360 (51%), Gaps = 65/360 (18%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV-------SKCE------- 385
           ++ DF  ++V+G+G++GKV+ V+  +T K+YA+K LRKA I+       SK E       
Sbjct: 124 NLHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDG 183

Query: 386 ------------VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHL 433
                       +  T AER++L+ ++ P IV L +SF    KLYL+L +I GGELFYHL
Sbjct: 184 NNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHL 243

Query: 434 QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           +  G        FY AE+ CAL  LH   V+YRDLKPEN LL+ +GH+ L DFGL K + 
Sbjct: 244 KEHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSA 303

Query: 494 KDN--DKTD--------TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYY 543
            D+  D+ D        +  GTPEY APEILLG+ Y++  DW++LG LLY+M+ G PPY 
Sbjct: 304 NDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYT 363

Query: 544 DENVPVMYKKILQ--QPLLFPDGFDPAAKDLLIGLLSRDPSRR----------------- 584
             N  V+  KI Q  Q    P       KD+L  LL ++ ++R                 
Sbjct: 364 GSNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDKYWAKTGANNKPT 423

Query: 585 ------LGVNGTDEIRNHPFFKDISWKKL----LLKGYIPPYKPIVKSEIDTANFDQEFT 634
                  G   T     H  F+ I WK L    L K  + P  P++       NFD EFT
Sbjct: 424 KSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDTEFT 483

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  223 bits (569), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/303 (39%), Positives = 175/303 (57%), Gaps = 28/303 (9%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ ++++G+G  GKV  VR+K + ++YALK   KA ++ + ++   LAE+ +LA  + PF
Sbjct: 461 FEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILATSNHPF 520

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           IV L  SFQ+ + LYL + +  GGE F  LQ      ++   +RFY +E+  AL+ LH +
Sbjct: 521 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLM 580

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGL-----------CKLNMK----------DNDKTD 500
             IYRDLKPENILL   GH+ L DF L            K N +          D  +T+
Sbjct: 581 GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTN 640

Query: 501 TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLL 560
           +F GT EY+APE++ G G+T +VDWWTLGIL YEM+ G  P+  +N    +  IL+  + 
Sbjct: 641 SFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVY 700

Query: 561 FPDGFD--PAAKDLLIGLLSRDPSRRLGVN-GTDEIRNHPFFKDISWKKLLLKGYIPPYK 617
           FP+  D     KDL+  LL +  S+RLG   G  EI+ HPFFK + W   LL+   PP  
Sbjct: 701 FPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQW--ALLRNQEPPLI 758

Query: 618 PIV 620
           P++
Sbjct: 759 PVL 761

>Kwal_23.6458
          Length = 868

 Score =  221 bits (562), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/304 (39%), Positives = 174/304 (57%), Gaps = 30/304 (9%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ +K++G+G  GKV  V++K T ++YALK   K  ++ + ++   LAE+ +LA  + PF
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNHPF 523

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           IV L  SFQS + LYL + +  GGE F  LQ      +    +RFY +E++ A++ LH +
Sbjct: 524 IVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLM 583

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND----------------------KT 499
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 584 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDTKNPVVKGSAQSSLLDTKICSDGFRT 642

Query: 500 DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPL 559
           ++F GT EY+APE++ G G+T  VDWWTLGIL+YEM+ G  PY  +N    +  +L+  +
Sbjct: 643 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEV 702

Query: 560 LFPDGFDPA--AKDLLIGLLSRDPSRRLGVN-GTDEIRNHPFFKDISWKKLLLKGYIPPY 616
            FP+  + +   KDL+  LL +  +RRLG   G  +I+ HPFFK + W   LL+   PP 
Sbjct: 703 SFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWS--LLRNQEPPL 760

Query: 617 KPIV 620
            P++
Sbjct: 761 IPVL 764

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  219 bits (558), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 174/304 (57%), Gaps = 30/304 (9%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ ++++G+G  G+V  VR+K T ++YALK   K  ++ + ++   L E+ +LA  + PF
Sbjct: 379 FEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPF 438

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           IV L  SFQ+ + LYL + +  GGE F  LQ      ++   +RFY +E+  AL+ LH +
Sbjct: 439 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND----------------------KT 499
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLS-VQAKDTKNPQVKGNASHSLVDTKICSDGFRT 557

Query: 500 DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPL 559
           ++F GT EY+APE++ G G+T  VDWWTLGIL+YEM+ G  P+  +N    +  IL+  +
Sbjct: 558 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEV 617

Query: 560 LFPDGFDP--AAKDLLIGLLSRDPSRRLGVN-GTDEIRNHPFFKDISWKKLLLKGYIPPY 616
           + P+  +   A KDL+  LL ++ ++RLG   G  +I+ HPFFK+  W   LL+   PP 
Sbjct: 618 VIPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWS--LLRNQEPPL 675

Query: 617 KPIV 620
            P++
Sbjct: 676 IPVL 679

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  214 bits (545), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 186/352 (52%), Gaps = 52/352 (14%)

Query: 335 KNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKC---------- 384
           +  P  ++DF  ++V+G+G++GKV+ V+ + T K++A+K L+KA IV             
Sbjct: 137 RQTPRKLEDFKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGED 196

Query: 385 ----------EVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQ 434
                      V  T AERT+L++++ P IV L +SF    KLYLVL +I GGELFYHL+
Sbjct: 197 AVLLPAVVEKRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLK 256

Query: 435 HEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK--LN 492
            +G        FY AE+ CAL  LH   ++YRDLKPEN LLD +GH+ L DFGL K  +N
Sbjct: 257 EQGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVN 316

Query: 493 MKDN-------DKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545
             D+       ++  +  GTPEY APEIL GQ YT+  DW++LG L Y+M+ G PP+   
Sbjct: 317 QADSPLGGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGA 376

Query: 546 NVPVMYKKILQ-QPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVN---------------- 588
           N  V+  KI Q + +  P       KD L  LL +D  +R  V+                
Sbjct: 377 NHKVILSKIKQDKGIKIPHYLSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAG 436

Query: 589 --GTDEIRNHPFFKDISWKKL----LLKGYIPPYKPIVKSEIDTANFDQEFT 634
              T   ++H  F+ I+WK +    L +    P  P++       NFD EFT
Sbjct: 437 QAKTSCYQSHFIFRKINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEFT 488

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  214 bits (545), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/368 (36%), Positives = 182/368 (49%), Gaps = 78/368 (21%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV------------------- 381
           I DF  ++V+G+G++GKV+ V+ K T K+YA+K L+KA I+                   
Sbjct: 142 ISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDK 201

Query: 382 ---SKCE-----VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHL 433
              S+ E     +  T AERT+L++++ P IV L +SF    KLYL+L +I GGELF+HL
Sbjct: 202 PVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHL 261

Query: 434 QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           +  G        FY AE+ CAL  LH   V+YRDLKPEN LL+  GH+ L DFGL K + 
Sbjct: 262 KEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSA 321

Query: 494 KDNDKTD--------------TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGL 539
            +  + D              +  GTPEY APEILLGQ YT   DW++LG LLY+M+TG 
Sbjct: 322 SNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGK 381

Query: 540 PPYYDENVPVMYKKILQQ------PLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNG---- 589
           PPY   N  V+  KI         P    DG     KD+L  LL  DP +R  V+     
Sbjct: 382 PPYTGANHKVIANKIKNDKQGPKIPYYLSDGM----KDVLGALLKSDPKKRWDVDKYWSE 437

Query: 590 -------------------TDEIRNHPFFKDISWKKL----LLKGYIPPYKPIVKSEIDT 626
                              T   ++H  F+ + WK L    L      P  P++      
Sbjct: 438 PKKDNSQKKGQKKKKSKERTSPFQSHFVFRKVDWKGLSSGELQNTTFGPIVPVITDWELA 497

Query: 627 ANFDQEFT 634
            NFD EFT
Sbjct: 498 ENFDSEFT 505

>Scas_629.16
          Length = 918

 Score =  219 bits (557), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 173/304 (56%), Gaps = 30/304 (9%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ +K++G+G  GKV  VR+K T ++YALK   K+ ++ + ++   LAE+ +LA  + PF
Sbjct: 519 FEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 578

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           +V L  SFQS + LY  + +  GGE F  LQ      ++   +RFY +E+  AL+ LH L
Sbjct: 579 VVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLL 638

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND----------------------KT 499
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 639 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDAKVPVMKGSAESTVVDTKICSDGFRT 697

Query: 500 DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPL 559
           ++F GT EY+APE++ G G+T  VDWWTLGIL+YEM+ G  P+   +    +  IL+  +
Sbjct: 698 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDV 757

Query: 560 LFPDGFDPA--AKDLLIGLLSRDPSRRLGVN-GTDEIRNHPFFKDISWKKLLLKGYIPPY 616
            FP+  D +   KDL+  LL ++ ++RLG   G  +++ HPFFK + W    L+   PP 
Sbjct: 758 SFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWS--FLRNQEPPL 815

Query: 617 KPIV 620
            PI+
Sbjct: 816 IPIL 819

>Scas_720.103
          Length = 804

 Score =  209 bits (533), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 175/313 (55%), Gaps = 36/313 (11%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F+ +K++G+G  GKV  V++K T  +YA+K   K  ++ + ++   + E+ +LA  + PF
Sbjct: 405 FEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPF 464

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR--SRFYIAELLCALDSLHKL 461
           IV L  SFQ+ + LYL + +  GGE F  LQ      +    +RFY +E+L AL+ LH L
Sbjct: 465 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLL 524

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND------------------------ 497
             IYRDLKPENILL   GHI L DF L  ++ KD+                         
Sbjct: 525 GFIYRDLKPENILLHKSGHIMLSDFDLS-VHAKDSKNPIFMKDGILPTTNSNLIVDTKIC 583

Query: 498 ----KTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK 553
               +T++F GT EY+APE++ G G+T  VDWWTLGIL++EM+ G  P+  +     +  
Sbjct: 584 SEGFRTNSFVGTEEYIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFAN 643

Query: 554 ILQQPLLFPDGFDPA--AKDLLIGLLSRDPSRRLGVN-GTDEIRNHPFFKDISWKKLLLK 610
           IL +   FP+  D     K+L+  LL+++ ++RLG   G  EI+ H FFK+++W   +L+
Sbjct: 644 ILSKDFEFPNSNDITRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWN--MLR 701

Query: 611 GYIPPYKPIVKSE 623
              PP  P + S+
Sbjct: 702 NEEPPLIPELSSD 714

>Scas_593.14d
          Length = 495

 Score =  197 bits (502), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 160/282 (56%), Gaps = 33/282 (11%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV------SKCE-------- 385
           ++ DF  ++V+G+G++GKV+ V+ K T K+YA+K L+KA I+      S  E        
Sbjct: 132 TVKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 386 VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSR 445
           +  T AE+++LA ++ P IV L +SF    KLYL+L +I GGELF+HL+ +G        
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVA 251

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT------ 499
           FY AE+ CAL  LH   ++YRDLKPEN LL+ +GH+ L DFGL K ++  N         
Sbjct: 252 FYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTS 311

Query: 500 -----------DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVP 548
                       +  GTPEY APEIL G  Y K  DW++LG L+Y+M++G PPY   N  
Sbjct: 312 LNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHK 371

Query: 549 VMYKKIL--QQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVN 588
           V+  KI   +Q    P       KD+L  LL +D S+R  V+
Sbjct: 372 VILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRWDVD 413

>Scas_705.23
          Length = 553

 Score =  184 bits (467), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 176/353 (49%), Gaps = 56/353 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF+++  +G+G +G+V   RK+DT+++ ALK L K  +    E  H L ER +L      
Sbjct: 157 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSD 216

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           ++V L ++FQ  E LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L 
Sbjct: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336

Query: 491 --------LNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542
                   L   + +  ++  G+P+Y+A E+L G+ Y  TVD+W+LG +L+E + G  P+
Sbjct: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396

Query: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593
              +    Y      KK L++P+L  D   PA  D    +++R   DP  RL     + I
Sbjct: 397 SGSSTNETYENLRHWKKTLRRPVL--DNGRPAFSDRTWDIITRLIADPINRL--RSFEHI 452

Query: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
           +  P+F ++++    L+   PP+ P + SE D   FD +FT E  +    D +
Sbjct: 453 KRMPYFAEVNFNT--LRQSAPPFTPQLDSETDAGYFD-DFTNEADMAKYADVF 502

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  178 bits (451), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 158/267 (59%), Gaps = 4/267 (1%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           SK + L + DF++ KV+GKG FG+V  VR  ++  + ALKA+ K  I+          E 
Sbjct: 99  SKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREV 158

Query: 394 TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLC 453
            + + +  P +  L   F   +++YL++ ++  GEL+ HL+    F+   + +Y+ ++  
Sbjct: 159 EIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMAD 218

Query: 454 ALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEI 513
           ALD +H+ ++++RD+KPENI++ +   I L DFG   +  K   K  T CGT +YL+PE+
Sbjct: 219 ALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPK-GSKRKTLCGTVDYLSPEL 277

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLL 573
           +  + Y + VD W LG+L YE++ G PP+ +E+  + YK+IL++ L+FPD  D  A+ L+
Sbjct: 278 IRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLI 337

Query: 574 IGLLSRDPSRRLGVNGTDEIRNHPFFK 600
             LL  DP  R+ +    E++ HP+ +
Sbjct: 338 SRLLEYDPGDRIPLK---EVKKHPWIE 361

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  182 bits (463), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 112/351 (31%), Positives = 177/351 (50%), Gaps = 56/351 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF+++  +G+G +G+V   RK+DT+++ ALK L K  +V   E  H L ER +L      
Sbjct: 170 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDILTTTRSE 229

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           ++V L ++FQ PE LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L 
Sbjct: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349

Query: 491 ------LNMKDND--KTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542
                  N++ ND    ++  G+P+Y+A E+L G+ Y  TVD+W+LG +L+E + G  P+
Sbjct: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409

Query: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593
              +    Y      K+ L++P L  DG   A  D    L++R   DP  RL     + +
Sbjct: 410 SGSSTNETYENLRHWKRTLRRPFL-NDG-RSAISDRAWELITRLIADPINRL--RSFEHV 465

Query: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVD 644
           +   +F +I++    L+   PP+ P + +E D   FD +FT E  +    D
Sbjct: 466 KRMNYFHEINFD--TLRQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513

>Kwal_23.3992
          Length = 571

 Score =  180 bits (457), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 177/352 (50%), Gaps = 54/352 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF+++  +G+G +G+V   RK+DT++I ALK L K  ++   E  H L ER +L      
Sbjct: 175 DFEMITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSE 234

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           ++V L ++FQ P  LYL + F+ GG+    L +        +RFYI+E+ CA+D+LH+L 
Sbjct: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 490
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354

Query: 491 ------LNMKDND--KTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542
                  N+++ND     +  G+P+Y+A E+L  + Y  TVD+W+LG +L+E + G  P+
Sbjct: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414

Query: 543 YDENVPVMY------KKILQQPLLFPD--GFDPAAKDLLIGLLSRDPSRRLGVNGTDEIR 594
              +    Y      K++L++P        F     DL+I L++ DP  RL     + ++
Sbjct: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHVK 471

Query: 595 NHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
              +F +IS++   L+   PP+ P + +E D   FD +FT E  +    D +
Sbjct: 472 KMKYFAEISFEN--LRNVSPPFIPQLDNETDAGYFD-DFTSEADMAKYADVF 520

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  175 bits (443), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 155/268 (57%), Gaps = 4/268 (1%)

Query: 332 KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA 391
           K + N  LS+ DF++ + +GKG FGKV  VR K +  I ALKA+ K  I+    +     
Sbjct: 88  KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKR 147

Query: 392 ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAEL 451
           E  +   +D P I+ L   F   +++YL++     GEL+  L++ G F+   +  YI ++
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 452 LCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAP 511
             AL  +HK  +I+RD+KPEN+L+ +   + L DFG   LN  +  K  T CGT +YL+P
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILN-PEGSKRKTLCGTIDYLSP 266

Query: 512 EILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKD 571
           E++  + Y + VD W LG+L YE++ G+PP+ + +  + YK+IL+  L FP+     AKD
Sbjct: 267 EMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPESISKDAKD 326

Query: 572 LLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
           L+  LL  D ++RL + G   ++ HP+ 
Sbjct: 327 LISKLLVTDTTQRLSLTG---VKTHPWI 351

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 199/402 (49%), Gaps = 65/402 (16%)

Query: 295 HLPLNLKIDSAAQIRLYNHHWIS-LERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKG 353
           +L    ++ ++ QI+L N  W S L+R +  L      +  + KP +  DF+++  +G+G
Sbjct: 135 YLQQQSQLPNSDQIKL-NEEWSSYLQREHQVL------RKRRLKPKN-RDFEMITQVGQG 186

Query: 354 SFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQS 413
            +G+V   RKKDT+++ ALK L K  +    E  H L ER +L      ++V L ++FQ 
Sbjct: 187 GYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKLLYAFQD 246

Query: 414 PEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENI 473
            + LYL + F+ GG+    L +        +RFYI+E+ CA+++LH L   +RDLKPEN 
Sbjct: 247 LQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLKPENF 306

Query: 474 LLDYQGHIALCDFGLC----------------------------------------KLNM 493
           L+D +GHI L DFGL                                         +L  
Sbjct: 307 LIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKMYNQLRE 366

Query: 494 KDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMY-- 551
           K+ +  ++  G+P+Y+A E+L G+ Y  TVD+W+LG +L+E + G  P+   +    Y  
Sbjct: 367 KEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYDN 426

Query: 552 ----KKILQQPLLFPDG---FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
               K+ L++P    DG   F     DL+  L++ DP  RL     + ++   +F DI++
Sbjct: 427 LRRWKQTLRRPRQ-SDGRAAFSDRTWDLITRLIA-DPINRL--RSFEHVKRMSYFADINF 482

Query: 605 KKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
               L+  IPP+ P + SE D   FD +FT E  +    D +
Sbjct: 483 ST--LRSMIPPFTPQLDSETDAGYFD-DFTSEADMAKYADVF 521

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  172 bits (437), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 157/271 (57%), Gaps = 6/271 (2%)

Query: 339 LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLAR 398
           +++ DF++ K++GKG FGKV  V+ ++T  I ALKA+ K  IV          E  +   
Sbjct: 95  MTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGS 154

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
                +  L   F   +++YL++ ++  GEL+  L++ G  +   + +++ ++  ALD +
Sbjct: 155 FKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYM 214

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQG 518
           H  ++++RD+KPENIL+ +   I L DFG    N +D  K  T CGT +YL+PE++  + 
Sbjct: 215 HSKNILHRDIKPENILIGFNNTIKLTDFGWSVYN-EDGQKRKTLCGTIDYLSPELIKSRE 273

Query: 519 YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLS 578
           Y   VD W LG+L YE++ G PP+ ++   + Y++IL+  L FP    P A+DL++ LL 
Sbjct: 274 YNNKVDVWALGVLTYELLVGSPPFEEDTKEMTYRRILRCDLKFPLNVSPQARDLIVRLLQ 333

Query: 579 RDPSRRLGVNGTDEIRNHPFFKDI--SWKKL 607
            +PS+R+ ++   E+++H +  +   SW  L
Sbjct: 334 FEPSKRIPLS---EVKSHAWIANNRGSWTDL 361

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 171/352 (48%), Gaps = 52/352 (14%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +DF++L  +G+G +G+V   RK+DT+++ ALK L K  +    E  H L ER +L     
Sbjct: 142 NDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRS 201

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
            ++V L ++FQ    LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L
Sbjct: 202 EWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHEL 261

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCK------------------------------- 490
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 262 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPI 321

Query: 491 ---------LNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPP 541
                    L   D +  ++  G+P+Y+A E+L G+ Y  TVD+W+LG +L+E +    P
Sbjct: 322 EDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTP 381

Query: 542 YYDENVPVMY------KKILQQPLLFPDGFDPAAKD-LLIGLLSRDPSRRLGVNGTDEIR 594
           +        Y      +K L++P L    +  + +    I  L  DP  RL     + ++
Sbjct: 382 FSGATTNETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRL--KSFEHVK 439

Query: 595 NHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
             P+F +I + K  L+   PP+ P + SE+D   FD +FT E  +    D +
Sbjct: 440 RMPYFSEIDFSK--LREMSPPFIPQLDSEVDAGYFD-DFTNEADMAKYADVF 488

>Kwal_56.24091
          Length = 381

 Score =  171 bits (433), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 163/278 (58%), Gaps = 9/278 (3%)

Query: 328 TVDYKPSKNKP-----LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVS 382
           T+  K S N P     +S+DDF++ K +GKG FGKV  V+ K T  I ALKA++K+ IV 
Sbjct: 102 TLSGKVSNNSPVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQ 161

Query: 383 KCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLA 442
                    E  + + +  P +  L   F   +++YL++ ++  GEL+ HL+  G F+  
Sbjct: 162 YNVQKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDI 221

Query: 443 RSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTF 502
            +  ++ ++  AL+ +H  ++++RD+KPENILL +Q  + L DFG    N+  N K  T 
Sbjct: 222 TASHFVHQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNV-GNSKRKTL 280

Query: 503 CGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP 562
           CGT +YL+PE++  + Y   VD W LG+L YE++ G PP+ ++   + YK+I+++ L FP
Sbjct: 281 CGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFP 340

Query: 563 DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           D   P A+DL+  LL  DP  R+ +    +++ HP+ K
Sbjct: 341 DQVSPHARDLISRLLEYDPQNRIPLK---DVKRHPWIK 375

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  174 bits (442), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 109/353 (30%), Positives = 172/353 (48%), Gaps = 56/353 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF+++  +G+G +G+V   RKKDT++I ALK L K  +       H L ER +L      
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           ++V L ++FQ P  LYL + F+ GG+    L +        +RFYI+E+ CA+D+LHKL 
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 489
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 490 -------KLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542
                  ++  K+ +   +  G+P+Y+A E+L  + Y  TVD+W+LG +L+E + G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593
              +    Y      K++L++P    +   PA  D    L++R   DP  RL     + +
Sbjct: 421 SGSSSNETYENLRRWKQVLRRPRC--ENGRPAFSDRTWELITRLIADPINRL--RSFEHV 476

Query: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
           +   +F +I +    L+   PP+ P + SE D   FD +FT E  +    D +
Sbjct: 477 KKMKYFAEIDFAN--LRSMSPPFIPQLDSETDAGYFD-DFTNEADMAKYADVF 526

>Scas_716.33
          Length = 573

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 175/353 (49%), Gaps = 56/353 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF+++  +G+G +G+V   RKKDT ++ ALK L K  +    E  H L ER +L      
Sbjct: 177 DFEMITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQ 236

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           ++V L ++FQ  + LYL + F+ GG+    L +        +RFYI+E+  A+++LH L 
Sbjct: 237 WLVKLLYAFQDTQNLYLAMEFVPGGDFRTLLINTRFLKSTHARFYISEMFLAVNALHDLG 296

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD---------NDKT-- 499
             +RDLKPEN L+D +GHI L DFGL             K+ +++         +DK+  
Sbjct: 297 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSIE 356

Query: 500 -----------------DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542
                            ++  G+P+Y+A E+L G+ Y  TVD+W+L  +L+E + G  P+
Sbjct: 357 DRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTPF 416

Query: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593
              +    Y      KK L++P+L  D   PA  D     ++R   DP  RL     + +
Sbjct: 417 SGSSTNETYENLRHWKKTLRRPML--DNGRPAFSDRTWDFITRLIADPINRL--RSFEHV 472

Query: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
           +   +F+ + +    L+   PP+ P + +E D   FD +FT E  +    D +
Sbjct: 473 KRMTYFESVDFNT--LRDLSPPFIPQLDNETDAGYFD-DFTNEADMAKYADVF 522

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  169 bits (427), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 109/353 (30%), Positives = 173/353 (49%), Gaps = 56/353 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           DF+++  +G+G +G+V   RKKDT++I ALK L K  ++      H L ER +L      
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           ++V L ++FQ P+ LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L 
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 489
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 490 -------KLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542
                  KL  ++     +  G+P+Y+A E+L  + Y  TVD+W+LG +L+E + G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593
              +    Y      K +LQ+P    D    A  D    L++R   DP  RL     + +
Sbjct: 411 SGNSTNETYENLRNWKHVLQRPKC--DNGRYAFSDRTWELITRLIADPINRL--KSFEHV 466

Query: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646
           +   +F +I +    L+   PP+ P + +E D   FD +FT E+ +   VD +
Sbjct: 467 KRMRYFSEIDFNT--LRTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  167 bits (423), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 153/276 (55%), Gaps = 10/276 (3%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT---VLARV 399
           DF   + +G GS+  V +   + T +++A+K   K +I+S+ +V +   E+    +LA  
Sbjct: 9   DFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHG 68

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
           + P I+ L ++F   E LY VL F  GGEL   LQ +GRF+ A ++ ++ +L+ AL+ +H
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIH 128

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDN-DKTDTFCGTPEYLAPEILLGQ 517
              V++RDLKPEN+LL  +G + + DFG+   L   DN   T +F GT EY++PE+LL  
Sbjct: 129 GCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQN 188

Query: 518 GYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLL 577
                 D W +G +LY+   G PP+  EN    ++KI+     +         DL+  +L
Sbjct: 189 KSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKIL 248

Query: 578 SRDPSRRLGVNGTDEIRNHPFFKDISW--KKLLLKG 611
             DP  R  +    +I+NH +F+ I W  K+L+ KG
Sbjct: 249 VLDPDSRYTL---PQIKNHAWFQGIDWTNKELIWKG 281

>Kwal_56.22693
          Length = 984

 Score =  168 bits (425), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 150/273 (54%), Gaps = 12/273 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV- 399
           I DF   +V+G GS+  VM  R  D+ K YA+K L K Y++ + +V +   E+  L R+ 
Sbjct: 155 IKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLN 214

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
           D   ++ L F+FQ    LY +L +   G+    ++  G  S   + +Y A++L A+D LH
Sbjct: 215 DGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDN--------DKTDTFCGTPEYLAP 511
              +++RD+KPENILLD    + L DFG  ++  KD         +++ +F GT EY++P
Sbjct: 275 HKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSP 334

Query: 512 EILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKD 571
           E+L         D W  G +L++M+ G PP+   N  + ++K+++    F  GF    +D
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRD 394

Query: 572 LLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           L+  +L + P +RL  +   +I+ H FFKD+++
Sbjct: 395 LIKKILVKSPEQRLDAS---QIKKHHFFKDVNF 424

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  165 bits (418), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 155/282 (54%), Gaps = 19/282 (6%)

Query: 339 LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLAR 398
           + I DF   + +G GS+  V+    +D+ K YA+K L K Y++ + +V +   E+  L +
Sbjct: 120 MGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQK 179

Query: 399 VD-CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDS 457
           ++    I  L F+FQ    LY +L +   G+    ++  G  +   +R+Y ++++ A+DS
Sbjct: 180 LNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDS 239

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKL------NMKDND-------KTDTFCG 504
           LH + +I+RD+KPENILLD    + L DFG  K+      N  D         K+ +F G
Sbjct: 240 LHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG 299

Query: 505 TPEYLAPEILLGQGYTKT-VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPD 563
           T EY++PE LL   YT +  D W  G +LY+M+ G PP+   N  + ++K+++    F  
Sbjct: 300 TAEYVSPE-LLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA 358

Query: 564 GFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
           GF    KDL+  LL RDP+ RL +    +I+ H FF +++++
Sbjct: 359 GFPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFE 397

>Scas_627.7
          Length = 349

 Score =  157 bits (398), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 153/267 (57%), Gaps = 5/267 (1%)

Query: 337 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL 396
           KPLS+DDF++ K +GKG FGKV  VR K+T  I ALK + KA IV          E  + 
Sbjct: 84  KPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQ 143

Query: 397 ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
             ++ P +  L   F   +++YL++ ++  GEL+  L+  G F+   +  ++ ++  AL+
Sbjct: 144 TSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALN 203

Query: 457 SLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG 516
            LH   +I+RDLKPENIL+ +   I L DFG   +N +   K  T CGT +YL+PE++  
Sbjct: 204 YLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPR-GVKRKTLCGTIDYLSPEMIRS 262

Query: 517 QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGL 576
           + Y   VD W LG+L YE++ G PP+ ++   + YK+IL+  + FP+      KDL+  L
Sbjct: 263 REYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDLISKL 322

Query: 577 LSRDPSRRLGVNGTDE----IRNHPFF 599
           L  +PS R+ +    +    IRN PF+
Sbjct: 323 LKYNPSERISMRDVMKHPWIIRNKPFW 349

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  165 bits (417), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/274 (31%), Positives = 153/274 (55%), Gaps = 13/274 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV- 399
           I+DF   + +G GS+  V+     ++ K YA+K L K Y++ + +V +   E+  L R+ 
Sbjct: 152 INDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLK 211

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
           +   I+ L F+FQ    LY +L +   G+L   ++  G  +   +++Y A+++ AL  +H
Sbjct: 212 NTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDND-------KTDTFCGTPEYLA 510
              VI+RDLKPENILLD    + L DFG  +L  +  ++D       ++++F GT EY++
Sbjct: 272 DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVS 331

Query: 511 PEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAK 570
           PE+L         D W  G +L++M+ G PP+   N  + ++K+++    F  GF    +
Sbjct: 332 PELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVR 391

Query: 571 DLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           DL+  +L ++P RRL +N   +I+ H FF D+++
Sbjct: 392 DLVKNILIKNPERRLLIN---QIKAHQFFADVNF 422

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  162 bits (410), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 147/277 (53%), Gaps = 15/277 (5%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I DF   +++G G++  VM    KD+ K YA+K L K Y++ + +V +   E+  L R++
Sbjct: 179 IKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLN 238

Query: 401 -CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
               IV L F+FQ    LY +L +   G+    ++  G  S   +R+Y A+++  +  LH
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLH 298

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTD-----------TFCGTPEY 508
              +I+RD+KPENILLD    + + DFG  K+    N+  D           +F GT EY
Sbjct: 299 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEY 358

Query: 509 LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA 568
           ++PE+L         D W  G ++++M+ G PP+   N  + ++K+++    F  GF   
Sbjct: 359 VSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV 418

Query: 569 AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
            +DL+  +L + P +RL +    +I  H F+KDIS++
Sbjct: 419 VRDLVKRILLKVPEQRLTI---PQIEKHHFYKDISFE 452

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  160 bits (405), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 94/297 (31%), Positives = 155/297 (52%), Gaps = 18/297 (6%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I DF   + +G GS+  V+     ++ K YA K L K Y++ + +V +   E+  L R++
Sbjct: 197 IKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLN 256

Query: 401 ---CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDS 457
               P ++ L F+FQ    LY +L +   G+    ++  G  S   +++Y A++L A+  
Sbjct: 257 SSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD--------NDKTDTFCGTPEYL 509
           LHK  +I+RD+KPENILLD    I L DFG  KL  ++        N ++ +F GT EY+
Sbjct: 317 LHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYV 376

Query: 510 APEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAA 569
           +PE+L         D W  G +L++M+ G PP+   N  + ++K+++    F  GF    
Sbjct: 377 SPELLNDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMIL 436

Query: 570 KDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLL----KGYIPPYKPIVKS 622
           +DL+  LL + P +RL +    +I  H FF DI+++   +       I PYK   K+
Sbjct: 437 RDLIKQLLVKKPEQRLTI---LQIEKHHFFNDINFRNGSVWSNPAPQIAPYKVTAKA 490

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  159 bits (401), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 149/271 (54%), Gaps = 12/271 (4%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT---VLARV 399
           DF   + +G GS+  V +V ++ +Q  YA+K   K +I+ + +V +   E+    +L + 
Sbjct: 9   DFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQA 68

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
           + P I+ L ++F   E LY V+    GGEL   L+ +  FS A +R Y+ +L+  ++ +H
Sbjct: 69  NHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIH 128

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMK-----DNDKTDT-FCGTPEYLAPEI 513
            + VI+RDLKPEN+LLD +G + + DFG      +     D DK  T F GT EY++PE+
Sbjct: 129 SMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPEL 188

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLL 573
           LL      + D W LG +LY+ + G PP+  +N    +++I+     +    +P A  L+
Sbjct: 189 LLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLV 248

Query: 574 IGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
             +L  DPS+R  +   ++I+ H +F  + W
Sbjct: 249 SKILVLDPSQRYTL---EQIKKHKWFSGVDW 276

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  159 bits (403), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 150/278 (53%), Gaps = 18/278 (6%)

Query: 341 IDDFDLLKVIGKGSFGKV-MQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           I DF    ++G GS+ +V +   K D+ K YA+K L K Y++ + +V +   E+T L  +
Sbjct: 115 IKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNL 174

Query: 400 -DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
                ++ L F+FQ    LY +L +   G+    ++  G  +   + +Y A+++ A+ S+
Sbjct: 175 KSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAIGSM 234

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDK-----------TDTFCGTPE 507
           H   +I+RD+KPENILLD    I L DFG  KL  K +DK           + +F GT E
Sbjct: 235 HSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAE 294

Query: 508 YLAPEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFD 566
           Y++PE LL   YT    D W  G L+Y+M+ G PP+   N  + ++K+++    F  GF 
Sbjct: 295 YVSPE-LLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFP 353

Query: 567 PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
              +DL+  +L + P +RL +    +I+ H  F++I++
Sbjct: 354 TIIRDLVKNILVKQPEKRLTI---PQIKEHCLFENINF 388

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  153 bits (386), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (68%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           DDF+ +KVIGKG+FG+V  V+KKDT KIYA+K L K+ + +K ++ H  AER VLA  D 
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           P++V L +SFQ  + LYL++ F+ GG+L   L     F+   +RFY+AE + A++ +HKL
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT 499
             I+RD+KP+NIL+D +GHI L DFGL     K +D +
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSS 458

 Score =  100 bits (250), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 74/131 (56%), Gaps = 6/131 (4%)

Query: 503 CGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLL 560
            GTP+Y+APEI L QGY +  DWW+LG ++YE + G PP+  E     Y+KI+  +Q L 
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 561 FPDGFDPA--AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKP 618
           FPD    +  A+DL+  LL+   +R     G DEI+ HPFF  + W    ++    PY P
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWN--TIRQVEAPYIP 648

Query: 619 IVKSEIDTANF 629
            + S  DT  F
Sbjct: 649 KLSSVTDTRFF 659

>Scas_660.20
          Length = 957

 Score =  153 bits (387), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 152/282 (53%), Gaps = 25/282 (8%)

Query: 343 DFDLLKVIGKGSFGKVMQ-VRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT---VLAR 398
           DF   + +G GS+  V + + K++T++I+A+K   KA+I+ + +V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAK 69

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
              P IV L ++F   E LY VL ++ GGEL   L     FS   S+ +  +L+  L+ +
Sbjct: 70  AHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFI 129

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKL----NMKDNDKTDTFCGTPEYLAPEIL 514
           H   VI+RDLKPEN+LLD  G + + DFG        N   N  + +F GT EY++PE+L
Sbjct: 130 HSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELL 189

Query: 515 LGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP------------ 562
           L    + + D W LG ++++ +TG PP+  EN    ++KI+   L +P            
Sbjct: 190 LHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVA--LDYPWSSTNIHNNKFL 247

Query: 563 DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           +  +P   +L+  +L  +P  RL +    +I+  P+F  ++W
Sbjct: 248 NNINPLIINLVRKILVLEPKDRLSL---KKIKQDPWFATVNW 286

>Kwal_33.14554
          Length = 714

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (68%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +DF  +KVIGKG+FG+V  V+KKDT KIYA+K L K+ +  K ++ H  AER VLA  D 
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           P++V L +SFQ  + LYL++ F+ GG+L   L     F+   +RFY+AE + A++++HKL
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND 497
             I+RD+KP+NIL+D +GHI L DFGL     K +D
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 456

 Score =  100 bits (250), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 6/131 (4%)

Query: 503 CGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLL 560
            GTP+Y+APEI L QGY +  DWW+LG ++YE + G PP+  E     Y+KI+  +Q L 
Sbjct: 529 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 588

Query: 561 FPDGFDPA--AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKP 618
           FPD    +  A+DL+  LL+    R     G DEI++HPFF+ + W    ++    PY P
Sbjct: 589 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNT--IRQVEAPYIP 646

Query: 619 IVKSEIDTANF 629
            + S  DT  F
Sbjct: 647 KLSSITDTRFF 657

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  151 bits (381), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (68%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +DF  +KVIGKG+FG+V  V+KKDT KIYA+K L K+ +  K ++ H  AER VLA  D 
Sbjct: 308 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 367

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           P++V L +SFQ  + LYL++ F+ GG+L   L     F+   +RFY+AE + A++++HKL
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 427

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND 497
             I+RD+KP+NIL+D +GHI L DFGL     K +D
Sbjct: 428 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 463

 Score =  110 bits (274), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 80/131 (61%), Gaps = 7/131 (5%)

Query: 503 CGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLL 560
            GTP+Y+APEI L QGY +  DWW+LG ++YE + G PP+  E     Y+KI+  +Q L+
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 561 FPDGFDPA--AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKP 618
           FPD    +  A+DL+  LLS     RLG +G +EI+NHPFF+ + W+ +   G   PY P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSH-ADERLGRHGANEIKNHPFFRGVDWETIRQVG--APYIP 648

Query: 619 IVKSEIDTANF 629
            + S  DT  F
Sbjct: 649 KLSSVTDTRFF 659

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 149/294 (50%), Gaps = 37/294 (12%)

Query: 343 DFDLLKVIGKGSFGKVMQ-VRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT---VLAR 398
           DF   + +G GS+  V + + KK   KIYA+K   K +I+ + +V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQ 69

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
                I+ L ++F   E LY VL F  GGEL   L   G F+   +R + A+L+ AL+ +
Sbjct: 70  KHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDALEFI 129

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGL------------CKLN-----MKDNDKTDT 501
           H   +I+RDLKPEN+LLD  G + + DFG              K N      KDN    +
Sbjct: 130 HSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCAS 189

Query: 502 FCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLF 561
           F GT EY++PE+LL        D W LG ++Y+ + G PP+  EN    ++KI+   L +
Sbjct: 190 FVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEKIVA--LDY 247

Query: 562 PDG-----------FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           P G            +P   +L+  +L  + + R+ +   ++I+ HP+F  + W
Sbjct: 248 PWGPNNRINNSTSPINPLVINLVQKILVIEVNERISL---EQIKRHPYFSKVDW 298

>Scas_654.12
          Length = 737

 Score =  149 bits (375), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 103/148 (69%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +DF  +KVIGKG+FG+V  V+K DT KIYA+K L K+ +  K ++ H  AER VLA  D 
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           P++V L +SFQ  + LYL++ F+ GG+L   L     F+   +RFY+AE + A++++HKL
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLC 489
             I+RD+KP+NIL+D +GHI L DFGL 
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLS 464

 Score =  101 bits (251), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 6/131 (4%)

Query: 503 CGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLL 560
            GTP+Y+APEI L QGY +  DWW+LG ++YE + G PP+  E     Y+KI+  +Q L 
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 561 FPDGFDPA--AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKP 618
           FPD    +  A+DL+  LL+    R     G DEI++HPFF+ + W    ++    PY P
Sbjct: 608 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWN--TIRQVEAPYIP 665

Query: 619 IVKSEIDTANF 629
            + S  DT  F
Sbjct: 666 KLSSITDTRFF 676

>Kwal_47.18233
          Length = 598

 Score =  147 bits (370), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 160/317 (50%), Gaps = 14/317 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I  + ++K +G+GSFGKV       T +  ALK + K  +           E + L  + 
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 87

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P I+ L    +S +++ +V+ +  G ELF ++    + S   +R +  +++ A++  H+
Sbjct: 88  HPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y 
Sbjct: 147 HKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLRTSCGSPNYAAPEVISGKLYA 205

Query: 521 -KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
              VD W+ G++LY M+    P+ DE++PV++K I       P    P A +L+      
Sbjct: 206 GPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLI------ 259

Query: 580 DPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPI 639
              R L VN  + I  H   +D  W K+ ++ Y+ P  P +K+E +    D E   +   
Sbjct: 260 --KRMLIVNPLNRITIHEIMQD-EWFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQNDA 314

Query: 640 DSVVDEYLSASIQKQFG 656
           +  VD+ L   + K  G
Sbjct: 315 EEEVDDSLVTMLSKTMG 331

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/317 (27%), Positives = 161/317 (50%), Gaps = 18/317 (5%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           + ++ ++K +G+GSFGKV       T +  ALK + K  +           E + L  + 
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 95

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P I+ L    +S +++ +V+ +  G ELF ++    + S   +R +  +++ A++  H+
Sbjct: 96  HPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYCHR 154

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y 
Sbjct: 155 HKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLYA 213

Query: 521 K-TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
              VD W+ G++LY M+    P+ DE++PV++K I       P    P A DL+  +L  
Sbjct: 214 GPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIV 273

Query: 580 DPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPI 639
           +P  R+ +        H   +D  W K+ L  Y+ P     + + +  + ++E  +E   
Sbjct: 274 NPLNRISI--------HEIMQD-EWFKVDLAEYLVPQDLKQQEQFNKKSGNEENVEE--- 321

Query: 640 DSVVDEYLSASIQKQFG 656
              +D+ +  ++ K  G
Sbjct: 322 ---IDDEMVVTLSKTMG 335

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  147 bits (370), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 148/265 (55%), Gaps = 9/265 (3%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKC--EVTHTLAERTVLA 397
           ++  + L K +GKGS G+V   +  +T K+ A+K + K ++ S    ++ + +    ++ 
Sbjct: 69  TVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIM 128

Query: 398 R-VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
           + +  P ++ L   +++  +LYLVL ++ GGELF +L  +G+   + +  Y  +++ A+ 
Sbjct: 129 KLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVA 188

Query: 457 SLHKLDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL 515
             H  ++ +RDLKPEN+LLD +   I + DFG+  L   D    +T CG+P Y +PEI+L
Sbjct: 189 YCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDK-LLETSCGSPHYASPEIVL 247

Query: 516 GQGYTKT-VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLI 574
           G+ Y  +  D W+ GI+L+ ++TG  P+ D+NV  +  K+       P      AKDL+ 
Sbjct: 248 GRKYHGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQWLSVEAKDLIS 307

Query: 575 GLLSRDPSRRLGVNGTDEIRNHPFF 599
            +L  DP+RR+ +   D+I  H   
Sbjct: 308 RILVVDPNRRITI---DQILQHELL 329

>Scas_502.2
          Length = 1116

 Score =  146 bits (368), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 147/277 (53%), Gaps = 18/277 (6%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I DF   +++G G++  VM     D+ K YA+K L K Y++ + +V +   E+  L R++
Sbjct: 171 IKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLN 230

Query: 401 -CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
               I+ L F+FQ    LY +L +   G+L   ++  G  +     +Y A+++ A+  +H
Sbjct: 231 NSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMH 290

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND----------KTDTFCGTPEYL 509
              +I+RD+KPENILLD    + + DFG  K+   DN           ++ +F GT EY+
Sbjct: 291 SKGIIHRDIKPENILLDKDMKVKITDFGTAKI--LDNKPPGTSYDLLTRSKSFVGTAEYV 348

Query: 510 APEILLGQGYTKT-VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA 568
           +PE LL   YT    D W  G ++++M+ G PP+   N  + ++K+++    F  GF   
Sbjct: 349 SPE-LLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTV 407

Query: 569 AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
            +DL+  +L + P +RL +   + I  H FF+  +++
Sbjct: 408 VRDLVKRILIKAPEQRLTI---EAIEKHHFFRSKNFQ 441

>Kwal_47.18307
          Length = 621

 Score =  144 bits (363), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 146/273 (53%), Gaps = 15/273 (5%)

Query: 342 DDFDLLKVIGKGSFGKVMQ-VRKKDTQKIYALKALRKAYIVSKCEVTHTLAER---TVLA 397
           D +  L  +G+GS+  V + V + ++ + YA+K   K +I+ + +V +   E+    +LA
Sbjct: 8   DSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLA 67

Query: 398 RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDS 457
           +     IV L  +F   E LY VL +++GGEL   +Q  GR +   SR   A+L+  +D 
Sbjct: 68  KGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDY 127

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFG-LCKL---NMKDNDKTDTFCGTPEYLAPEI 513
           +H   VI+RDLKPEN+LL  +G + + DFG  C       ++  +T +F GT EY++PE+
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPEL 187

Query: 514 LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI--LQQPLLFPDGFDPAAKD 571
           LL      + D W LG ++Y++  G PP+  EN    ++KI  L    LF +   P    
Sbjct: 188 LLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSN--SPQVVS 245

Query: 572 LLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           ++  +L  DP +R       +++ +P+F  I W
Sbjct: 246 IVQSILVTDPLKR---PSAAQLKQNPWFASIDW 275

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 145/301 (48%), Gaps = 34/301 (11%)

Query: 332 KPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTL 390
           K +K +P+S  D + L K +G G +  V + + K T +  A+K         + +     
Sbjct: 187 KLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFR 246

Query: 391 AERTVLARVDCPFIVPLKFSFQSPE-----KLYLVLAFINGGELFYHLQHEGRFSLARSR 445
            E  +L RV  P IV L  SF  P      + YLVL  I+ GELF  +  +       S+
Sbjct: 247 EETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESK 306

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQG-------------------HIALCDF 486
               +LL  L  LH+ ++I+RD+KPENILL+                       + + DF
Sbjct: 307 ALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADF 366

Query: 487 GLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE- 545
           GL K    +   T+T CGTP Y+APE+L  +GYT  VD W+ G++LY  + G PP+ D+ 
Sbjct: 367 GLAKF-TGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 546 NVPVMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKD 601
             P + ++ILQ    F     D  D +   L+  LL  +P  R  +   DE  NHP+F D
Sbjct: 426 GPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNI---DEALNHPWFND 482

Query: 602 I 602
           I
Sbjct: 483 I 483

>Scas_616.10
          Length = 1461

 Score =  145 bits (366), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 110/388 (28%), Positives = 184/388 (47%), Gaps = 54/388 (13%)

Query: 308 IRLYNHHWISLERGYGKLNITVDYKPSKNKPL-SIDDFDLLKVIGKGSFGKVMQVRKKDT 366
           I+  N     L +   + + + D K SK K   ++  + L K +GKGS G+V   +  +T
Sbjct: 64  IQSVNDATKRLSQQDSQFSTSTDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIET 123

Query: 367 QKIYALKALRKAYIV----SKCEVT------------HTLA------------------- 391
            ++ A+K + K + +    S   V+             TLA                   
Sbjct: 124 GQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGI 183

Query: 392 --ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIA 449
             E  ++  +  P ++ L   +++  +LYLVL +++GGELF +L  +G+ S   +  Y  
Sbjct: 184 EREIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFK 243

Query: 450 ELLCALDSLHKLDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDNDKTDTFCGTPEY 508
           +++  +   H  ++ +RDLKPEN+LLD +   I + DFG+  L +  N    T CG+P Y
Sbjct: 244 QIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAALELP-NKLLQTSCGSPHY 302

Query: 509 LAPEILLGQGY-TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDP 567
            +PEI++G+ Y     D W+ GI+L+ ++TG  P+ D+N+  +  K+       P    P
Sbjct: 303 ASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPSTLSP 362

Query: 568 AAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTA 627
            A+DL+  +L  DPS+R+    TD I NHP         L+LK Y P  K +V  + ++ 
Sbjct: 363 EAQDLISRILVIDPSKRI---TTDRILNHP---------LILK-YEPAGKNMVSGKSNSD 409

Query: 628 NFDQEFTKEKPIDSVVDEYLSASIQKQF 655
               E    +PI       + ASI K  
Sbjct: 410 LHVLEHISPQPISLTSRNDIDASILKNL 437

>Kwal_26.7788
          Length = 1267

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 151/295 (51%), Gaps = 13/295 (4%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLAR- 398
           +I  + L K +GKGS G+V   +  +T K+ A+K + K        + + +    ++ + 
Sbjct: 54  TIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKL 113

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
           +  P ++ L   +++  +L+LVL +++GGELF +L   GR     +  Y  +++      
Sbjct: 114 ISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 459 HKLDVIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ 517
           H  ++ +RDLKPEN+LLD +   I + DFG+  L    N   +T CG+P Y +PEI++G+
Sbjct: 174 HGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQT-SNKLLETSCGSPHYASPEIVMGK 232

Query: 518 GYT-KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGL 576
            Y     D W+ GI+L+ ++TG  P+ D+N+  +  K+       P      A+DL+  +
Sbjct: 233 NYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSSGAQDLISRI 292

Query: 577 LSRDPSRRLGVNGTDEIRNHPFFKDISWKK------LLLKGYIPPYKPIVKSEID 625
           L  DP +R+ +N   EI  HP       K+      L +  +  P    +KSE D
Sbjct: 293 LVVDPDKRISIN---EILAHPLLAKYGNKRSKSNSDLHILSHSKPQISTIKSESD 344

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 141/273 (51%), Gaps = 23/273 (8%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT----- 394
           ++  + L K +GKGS G+V   +   + K+ A+K      IV K  V H   + T     
Sbjct: 57  TVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIK------IVPKRNVRHNQKQVTALPYG 110

Query: 395 ------VLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
                 ++  +  P I+ L   +++  +LYLVL ++ GGELF +L   G+     +  Y 
Sbjct: 111 IEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYF 170

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDNDKTDTFCGTPE 507
            +++  +   H  ++ +RDLKPEN+LLD +   + + DFG+  L    N   +T CG+P 
Sbjct: 171 KQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETT-NRLLETSCGSPH 229

Query: 508 YLAPEILLGQGYTKT-VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFD 566
           Y +PEI++GQ Y  +  D W+ GI+L+ ++TG  P+ D+NV  +  K+       P    
Sbjct: 230 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVS 289

Query: 567 PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
             AKDL+  +L  DP +R+ V   D+I  HP  
Sbjct: 290 KEAKDLISKILVVDPEKRITV---DKILEHPLL 319

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  142 bits (358), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 156/317 (49%), Gaps = 12/317 (3%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I ++ ++K +G+GSFGKV       T +  ALK + K  +           E + L  + 
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 111

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P I+ L    +S +++ +V+ +  G ELF ++    + S   +R +  +++ A++  H+
Sbjct: 112 HPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHR 170

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y 
Sbjct: 171 HKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLYA 229

Query: 521 -KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
              VD W+ G++LY M+    P+ DE++PV++K I       P    P A  L+  +L  
Sbjct: 230 GPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIV 289

Query: 580 DPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPI 639
           +P  R+ +        H   +D  W K+ L  Y+ P       E +  N D +     P 
Sbjct: 290 NPLNRISI--------HEIMQD-DWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPD 340

Query: 640 DSVVDEYLSASIQKQFG 656
           +  +D+ L   +    G
Sbjct: 341 NDEIDDNLVNILSSTMG 357

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  138 bits (348), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 141/276 (51%), Gaps = 12/276 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I  + ++K +G+GSFGKV       T +  ALK + K  +           E + L  + 
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 91

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P I+ L    +S +++ +V+ +  G ELF ++    +     +R +  +++ A+D  H+
Sbjct: 92  HPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQIISAVDYCHR 150

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y 
Sbjct: 151 HKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLYA 209

Query: 521 K-TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
              VD W+ G++LY M+    P+ DE++PV++K I       P+     A  L+  +L  
Sbjct: 210 GPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLIV 269

Query: 580 DPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPP 615
           +P  R+ V        H   +D  W K+ L  Y+ P
Sbjct: 270 NPVNRITV--------HEIMQD-EWFKVDLPDYLVP 296

>Scas_660.28
          Length = 623

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 137/261 (52%), Gaps = 6/261 (2%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I ++ ++K +G+GSFGKV       T +  ALK + K  +           E + L  + 
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 102

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P I+ L    +S +++ +V+ +  G ELF ++    + S   +R +  +++ A++  H+
Sbjct: 103 HPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQIISAVEYCHR 161

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y 
Sbjct: 162 HKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLYA 220

Query: 521 K-TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
              VD W+ G++LY M+    P+ DE++PV++K I       P      A  L+  +L  
Sbjct: 221 GPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLIV 280

Query: 580 DPSRRLGVNGTDEIRNHPFFK 600
           +P  R+ +    EI    +FK
Sbjct: 281 NPLNRISIQ---EIMQDEWFK 298

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 140/263 (53%), Gaps = 15/263 (5%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I ++ + K IG+GSFGKV     + T +   LK   K          + + E     + D
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK-------RDPNVVREVFYHRQFD 86

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P+I  L     +  ++++VL + +G EL+ HL  E R SL  S+   +++  A+   H+
Sbjct: 87  FPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHE 146

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
           L  ++RDLK EN+LLD  GH  L DFG  +  M    + +T CGT  Y+APE++  + Y 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMATRSQLETICGTTVYMAPELIERKCYD 205

Query: 521 K-TVDWWTLGILLYEMMTGLPPYYDENVPVMYK-KILQQPLLF-PDGFDPAAKDLLIGLL 577
              VD W+LGI+LY M+ G  P +DE+  +  K KI+   L F  +     A DL+ G+L
Sbjct: 206 GFKVDIWSLGIILYTMINGYMP-FDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGML 264

Query: 578 SRDPSRRLGVNGTDEIRNHPFFK 600
            ++P+ R+ +    ++ +HPF +
Sbjct: 265 RKNPNERISLA---QVLSHPFLQ 284

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 120/211 (56%), Gaps = 6/211 (2%)

Query: 392 ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAEL 451
           E  ++  +  P ++ L   +++  +LYLVL +++GGELF +L  +G+ S   +  Y  ++
Sbjct: 176 EIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQI 235

Query: 452 LCALDSLHKLDVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDNDKTDTFCGTPEYLA 510
           +  +   H  ++ +RDLKPEN+LLD +   I + DFG+  L +  N   +T CG+P Y +
Sbjct: 236 IQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELP-NKLLETSCGSPHYAS 294

Query: 511 PEILLGQGY-TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAA 569
           PEI++G+ Y     D W+ GI+L+ ++TG  P+ D+N+  +  K+       P      A
Sbjct: 295 PEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDA 354

Query: 570 KDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           KDL+  +L  +P +RL +N   EI NHP  K
Sbjct: 355 KDLITRILVTNPEKRLTIN---EILNHPLIK 382

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 141/276 (51%), Gaps = 12/276 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           I  + ++K +G+GSFGKV       T +  ALK + K  +           E + L  + 
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 95

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P I+ L    +S +++ +V+ +  G ELF ++    + S   +R +  +++ A++  H+
Sbjct: 96  HPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y 
Sbjct: 155 HKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLYA 213

Query: 521 K-TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579
              VD W+ G++LY M+    P+ DE++PV++K I       P      A +L+      
Sbjct: 214 GPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLI------ 267

Query: 580 DPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPP 615
              R L VN  + I  H   +D  W K+ L  Y+ P
Sbjct: 268 --KRMLIVNPLNRITIHEIMED-EWFKVDLPDYLVP 300

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  134 bits (337), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 144/302 (47%), Gaps = 34/302 (11%)

Query: 332 KPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTL 390
           K +K KPLS  D + L K +G G +  V + + K T +  A+K         + +     
Sbjct: 180 KFAKLKPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFR 239

Query: 391 AERTVLARVDCPFIVPLKFSFQSPE-----KLYLVLAFINGGELFYHLQHEGRFSLARSR 445
            E T+L ++  P IV L  SF  P      + YLVL  I+ GELF  +  +       S+
Sbjct: 240 EETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESK 299

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQG-------------------HIALCDF 486
               ++L  L  LH  ++I+RD+KPENILL+ +                     + + DF
Sbjct: 300 AIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADF 359

Query: 487 GLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE- 545
           GL K    +   T+T CGTP Y+APE+L+ +GYT  VD W+ G++LY  + G PP+ D+ 
Sbjct: 360 GLAKFT-GEMQFTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 418

Query: 546 NVPVMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKD 601
             P + ++I+     F     D  D AA  L+  LL  DP  R  V   D    HP+   
Sbjct: 419 GPPSLKEQIMSAKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDV---DAAAAHPWLDS 475

Query: 602 IS 603
           +S
Sbjct: 476 VS 477

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  136 bits (342), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 157/310 (50%), Gaps = 48/310 (15%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKI-YALKALRKAYIVSKCEVTHTLAERT---VLAR 398
           +F   + +G GS+  V +   K   K  YA+K   K +I+ + +V +   E+    +LAR
Sbjct: 10  EFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLAR 69

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
            + P IV L ++F   E LY VL + +GGEL   L   G F+ + ++ + A+L+  L+ +
Sbjct: 70  GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFM 129

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLC--------KLNMKDN-------------- 496
           H   VI+RDLKPEN+LL  +G + + DFG          K N + N              
Sbjct: 130 HARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSSG 189

Query: 497 DKTD--TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
           DKT+  +F GT EY++PE+LL    +   D W LG ++Y+ + G PP+  EN    ++KI
Sbjct: 190 DKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGENELKTFEKI 249

Query: 555 LQQPLLFPDGFDPAAK-----------DLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDIS 603
           +         ++P  +           +L+  +L+ D ++R  +   D+I+  P+F ++ 
Sbjct: 250 VS----LDYSWNPERQTNFGTINIQVVNLVRRMLTIDTTQRATI---DQIKRDPWFANVD 302

Query: 604 W--KKLLLKG 611
           W  KK L +G
Sbjct: 303 WGDKKKLWRG 312

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  131 bits (329), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 94/308 (30%), Positives = 138/308 (44%), Gaps = 34/308 (11%)

Query: 322 YGKLNITVDYKPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYI 380
           +   N T     ++ +P S  D +   K +G G +  V + R K+T +  A+K       
Sbjct: 78  FSSQNTTKKLSRTREQPRSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQN 137

Query: 381 VSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPE-----KLYLVLAFINGGELFYHLQH 435
                      E  +L  +  P IV L   F  P      + YLVL  IN GELF  +  
Sbjct: 138 DDDKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVR 197

Query: 436 EGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQG---------------- 479
           +       ++    +LL  L  LH  ++I+RD+KPENILL                    
Sbjct: 198 KNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDE 257

Query: 480 ---HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMM 536
               + + DFGL K    +   T+T CGTP Y+APE+L+  GYT  VD W+ G+LLY  +
Sbjct: 258 LDIQVKIADFGLAKFT-GEMKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCL 316

Query: 537 TGLPPYYDENV-PVMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRLGVNGTD 591
            G PP+ ++   P M ++ILQ    F     D  D +   L+  LL  +P+ R  VN   
Sbjct: 317 CGFPPFSEQLAPPSMKEQILQGKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVN--- 373

Query: 592 EIRNHPFF 599
           +   HP+F
Sbjct: 374 DALTHPWF 381

>Scas_693.17
          Length = 1049

 Score =  135 bits (340), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 151/319 (47%), Gaps = 40/319 (12%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKA--------YIVSKCEVTHTLA 391
           S+ D+D ++ +G GS GKV   + + T ++ A+K + +A        Y       T  L+
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 392 ERTVLARVDC-----------------------PFIVPLKFSFQSPEKLYLVLAFINGGE 428
           E+ V+ R                          P I  L          Y++  +++GG+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 429 LFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGL 488
           L  ++   G    +R+R +  ++  AL  LH  ++++RDLK ENI++   G+I L DFGL
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 489 CKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENV 547
             L  K N K  T+CG+  + APE+L    Y    +D W+ G++LY ++ G  P+ DEN 
Sbjct: 247 SNLYDKCN-KLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 548 PVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF-KDISWKK 606
            V+++KI Q  + +P         LL  +L  DP +R  +   D++ NH +  +D     
Sbjct: 306 NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATL---DQVMNHHWMVRDCDGPP 362

Query: 607 LLLKGYIPPYKPIVKSEID 625
              K YIP   P+   ++D
Sbjct: 363 ---KSYIPDRPPLTIEQLD 378

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 138/262 (52%), Gaps = 13/262 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           + ++ ++K +G+GSFGKV     K T +   LK   K+         + + E     + +
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS-------DPNVVREVFYHRQFE 86

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            PFI  L     +  ++++ L +  G EL+ +L  + R  L  +R   A+++ A+   H 
Sbjct: 87  YPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHS 146

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
           L  ++RDLK ENILLD  G+  L DFG  +       + +T CGT  Y+APE++  + Y 
Sbjct: 147 LQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECATKTQLETVCGTTVYMAPELIKREAYD 205

Query: 521 K-TVDWWTLGILLYEMMTGLPPY-YDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLS 578
              VD W+LGI+LY M+ G  P+  D+ V    K + ++P +  +   P AKDL++ LL 
Sbjct: 206 GYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 579 RDPSRRLGVNGTDEIRNHPFFK 600
           ++ ++R  +N   E+  HPF +
Sbjct: 266 KNAAQRPNLN---EVLQHPFLQ 284

>Kwal_26.8709
          Length = 829

 Score =  134 bits (336), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 145/285 (50%), Gaps = 16/285 (5%)

Query: 322 YGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKK------DTQKIYALKAL 375
           Y K   +  Y   K K ++   + +   +G+G FGKV     K      D  K  A+K +
Sbjct: 18  YTKSRQSTSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLI 77

Query: 376 RKAYIVSKCEVTHTL-AERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQ 434
           R+  I    E    +  E   L  ++ P IV L+   Q+ + + +VL + +GGE + ++Q
Sbjct: 78  RRDTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQ 137

Query: 435 HEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 494
            + R     +    A+L+  +  +H   +++RDLK EN+LLD   ++ + DFG     + 
Sbjct: 138 KKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLP 197

Query: 495 DNDKTDTFCGTPEYLAPEILL-GQGY-TKTVDWWTLGILLYEMMTGLPPYYD-------E 545
           +N+   T CG+P Y APE+++  + Y  +  D W+ G++LY M+ G  P+ D       +
Sbjct: 198 ENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGD 257

Query: 546 NVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGT 590
           ++  +Y+ I + PL FPD   P  +DLL  +L  DP RR+ ++ T
Sbjct: 258 DIGKLYRYITRTPLKFPDYIAPVPRDLLREILIPDPKRRITISKT 302

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  133 bits (335), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 94/316 (29%), Positives = 159/316 (50%), Gaps = 35/316 (11%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKC---------EVTHTLA 391
           I  + L + +G GS GKV+  +  +T +I A+K + K+   ++          +V     
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 392 ER--TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIA 449
           ER   ++  ++ P ++ L   +++ + LY+VL ++  GELF  L   G      +  +  
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 450 ELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYL 509
           +++  +   H L +++RDLKPEN+LLD++ +I L DFG+  L  KD    +T CG+P Y 
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK-LLETSCGSPHYA 194

Query: 510 APEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYDE--NVPVMYKKILQQPLLFP--DG 564
           APEI+ G  Y     D W+ G++LY ++TG  P+ +E  N+  +  K+       P  D 
Sbjct: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254

Query: 565 FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEI 624
             P A+DL++ +L+ +P +R+    T EI  HP          LL+ Y     P +K   
Sbjct: 255 ISPEARDLIVQILTVEPEQRI---KTREILKHP----------LLQKY-----PSIKDSK 296

Query: 625 DTANFDQEFTKEKPID 640
              N  +E T   P+D
Sbjct: 297 SIRNLPREDTYLNPLD 312

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  132 bits (333), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 141/278 (50%), Gaps = 18/278 (6%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           D+   + +G+G F +  Q+ K D+ KI+A K + K  I S+      L+E  +   +   
Sbjct: 80  DYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            IV     F+    +Y++L     G L   ++     +    RF++ ++   +  +H   
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNR 198

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ--GYT 520
           VI+RDLK  NI  D   ++ + DFGL  +   D ++  T CGTP Y+APE+L+G+  G++
Sbjct: 199 VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHS 258

Query: 521 KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG--FDPAAKDLLIGLLS 578
             VD W++G++LY ++ G PP+  ++V  +Y++I Q+   +P        AK L+  +LS
Sbjct: 259 YEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILS 318

Query: 579 RDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPY 616
            +P  R  +    EI ++ +F          +G  PPY
Sbjct: 319 LNPMERPSIQ---EIMDYVWF----------RGTFPPY 343

>Kwal_0.96
          Length = 427

 Score =  128 bits (321), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 137/259 (52%), Gaps = 10/259 (3%)

Query: 336 NKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSK-CEVTHTLAERT 394
           N  ++  D+   K +G GSFG V Q R+  + +  A+K L K  +  K  E+     E +
Sbjct: 38  NSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELS 97

Query: 395 VLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCA 454
           +L ++D P IV  K  F+S +K Y+V     GGELF  +  +G+F+   +   + ++L A
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 455 LDSLHKLDVIYRDLKPENILLDYQG---HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAP 511
           ++ LH  ++++RDLKPEN+L   +     + L DFG+ K    D++      G+  Y+AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 512 EILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK--ILQQPLLFPDGF---- 565
           E++   G+ K  D W+LG++ Y ++ G  P+  E+V    ++  I + P+ F   +    
Sbjct: 218 EVVTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNI 277

Query: 566 DPAAKDLLIGLLSRDPSRR 584
              AKD ++  L+ +P  R
Sbjct: 278 SNEAKDFILRALTVNPHDR 296

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 130/251 (51%), Gaps = 10/251 (3%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           D+   K +G G+FG V Q R     +  A+K L K  +    E+     E ++L ++D P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGN-ELQMLYDELSILQKLDHP 113

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            IV  K  F+S EK Y+V     GGELF  +  +G+F+   +   + ++L A++ +H  +
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 463 VIYRDLKPENIL-LD--YQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
           V++RDLKPEN+L LD   +  + + DFG+ K    ++       G+  Y+APE+L   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLLFP----DGFDPAAKDLL 573
            K  D W+LG++ Y ++ G  P+  E+     +++     P+ F     +     AK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 574 IGLLSRDPSRR 584
           +  L+  P+RR
Sbjct: 294 LRALTLTPARR 304

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  128 bits (321), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 131/252 (51%), Gaps = 10/252 (3%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL-RKAYIVSKCEVTHTLAERTVLARVDC 401
           D+   K +G G+FG V Q R   + +  A+K L +KA      ++     E ++L +++ 
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH 104

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
           P IV  K  F+S EK Y+V     GGELF  +  +G+F    + F + ++L  +  LH+ 
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQYLHQR 164

Query: 462 DVIYRDLKPENILLDYQGH---IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQG 518
           ++++RDLKPENIL   +     + + DFG+ K    DN+      G+  Y+APE+L   G
Sbjct: 165 NIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSG 224

Query: 519 YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLLFP----DGFDPAAKDL 572
           + K  D W++G++ Y ++ G  P+  E+     ++    Q P++F     +     AK+ 
Sbjct: 225 HGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNNVSKTAKEF 284

Query: 573 LIGLLSRDPSRR 584
           ++  L+  P RR
Sbjct: 285 ILWALTVSPKRR 296

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 127/239 (53%), Gaps = 5/239 (2%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKF 409
           +G+G F +  Q+ K D  K++A K + K  I S+      L+E  +   +  P IV    
Sbjct: 96  LGEGGFARCFQM-KDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHPNIVQFTD 154

Query: 410 SFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLK 469
            F+    +Y++L     G +   L+     +    RF + +++ A+  +H   VI+RDLK
Sbjct: 155 CFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRRVIHRDLK 214

Query: 470 PENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ--GYTKTVDWWT 527
             NI  D + ++ + DFGL  +   D ++  T CGTP Y+APE+L G+  G++  VD W+
Sbjct: 215 LGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHSYEVDIWS 274

Query: 528 LGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG--FDPAAKDLLIGLLSRDPSRR 584
           +G++LY ++ G PP+  + V  +Y++I  +  +FP        AK+L+  LL  +P+ R
Sbjct: 275 IGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAAR 333

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 134/257 (52%), Gaps = 8/257 (3%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKF 409
           +G+G F +  Q+ K D+ K++A K + K  I S+      L+E  +   +  P IV    
Sbjct: 79  LGEGGFARCFQM-KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTD 137

Query: 410 SFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLK 469
            F+    +Y++L     G L   L+   + +    RF+  +++ A+  +H   +I+RDLK
Sbjct: 138 CFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLK 197

Query: 470 PENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ--GYTKTVDWWT 527
             NI  D   ++ + DFGL  +   D ++  T CGTP Y+APE+L G+  G++  VD W+
Sbjct: 198 LGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHSFEVDIWS 257

Query: 528 LGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG--FDPAAKDLLIGLLSRDPSRRL 585
           +G+++Y ++ G PP+  + V  +Y++I      FP        AK L+  +LS DP  R 
Sbjct: 258 IGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERP 317

Query: 586 GVNGTDEIRNHPFFKDI 602
            +    EI  + +F+++
Sbjct: 318 SL---AEIMEYVWFRNV 331

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 146/286 (51%), Gaps = 26/286 (9%)

Query: 349 VIGKGSFGKVM----------QVRKKDTQKIYALKALRKAYIVSKCEVTHTL-AERTVLA 397
            +G+G FGKV             ++    K  A+K +R+  IV   E    +  E   L 
Sbjct: 49  TLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALK 108

Query: 398 RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDS 457
            +  P +V L+   Q+ + + +VL + +GGE + ++Q + R   + +    A+L+  +  
Sbjct: 109 HLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTY 168

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ 517
           +H  ++++RDLK EN+LLD   ++ + DFG     + DN+   T CG+P Y APE+++  
Sbjct: 169 MHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIST 228

Query: 518 G--YTKTVDWWTLGILLYEMMTGLPPYYD-------ENVPVMYKKILQQPLLFPDGFDPA 568
                +  D W+ GI+LY M+ G  P+ D       +++  +Y+ I + PL FP+   P 
Sbjct: 229 RPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITPI 288

Query: 569 AKDLLIGLLSRDPSRRLG---VNGTDEIRNHPFFKDIS---WKKLL 608
            +DLL  +L  DP++R+    ++  + ++ H  F  +S   W KL+
Sbjct: 289 PRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKLI 334

>Kwal_56.22476
          Length = 697

 Score =  129 bits (325), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 135/257 (52%), Gaps = 8/257 (3%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKF 409
           +G+G F +  Q+ K D  KI+A K + K  I S+      L+E  +   +    IV    
Sbjct: 85  LGEGGFARCFQI-KDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHTNIVQFVD 143

Query: 410 SFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLK 469
            F+    +Y++L     G L   L+     +    RF+  +++ A+  +H   VI+RDLK
Sbjct: 144 CFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRRVIHRDLK 203

Query: 470 PENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ--GYTKTVDWWT 527
             NI  D   ++ + DFGL  +   D ++  T CGTP Y+APE+L G+  G++  VD W+
Sbjct: 204 LGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHSYEVDIWS 263

Query: 528 LGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP-DGF-DPAAKDLLIGLLSRDPSRRL 585
            G+++Y ++ G PP+  + V ++Y++I     +FP D F  P A  L+  +LS DP  R 
Sbjct: 264 CGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERP 323

Query: 586 GVNGTDEIRNHPFFKDI 602
            +   DEI ++ +F+ +
Sbjct: 324 SL---DEIIDYVWFRGL 337

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  130 bits (327), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 142/276 (51%), Gaps = 20/276 (7%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIV------SKCEVTHTL---- 390
           I  + L + +G GS GKV+    + T++  A+K + KA         S  + T+ L    
Sbjct: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76

Query: 391 -AERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIA 449
             E  ++  ++ P ++ L   +++   LYLVL +   GELF  L   G      +     
Sbjct: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136

Query: 450 ELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYL 509
           +++  +   H L V++RDLKPEN+LLD + +I + DFG+  L  +D    +T CG+P Y 
Sbjct: 137 QIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDK-LLETSCGSPHYA 195

Query: 510 APEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYDE--NVPVMYKKILQQPLLFPDG-- 564
           APEI+ G  Y   + D W+ G++L+ ++TG  P+ +E  N+  +  K+ +     PD   
Sbjct: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255

Query: 565 FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
               A+DLL  LL+ DPS+R+ +    EI  HP  +
Sbjct: 256 ITKEAQDLLARLLTVDPSKRITIR---EILKHPLLQ 288

>Kwal_33.13112
          Length = 505

 Score =  127 bits (319), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 155/324 (47%), Gaps = 24/324 (7%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           +D+ + +GKGSFG V +   K+T ++ A+K +         +V     E   L+ +  PF
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDVL--AQEIYFLSELRAPF 93

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQH--EGRFSLARSRFYIAELLCALDSLHKL 461
           +     ++     +++V+ F  GG     L+H  E R    +  + I E+L  L+ LH  
Sbjct: 94  VTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQ 153

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYT 520
             I+RD+K  NILL  +G + L DFG+    M    K +TF GTP ++APEI+    GY 
Sbjct: 154 RKIHRDVKAANILLTDEGEVKLGDFGVSGQIMA-TLKRNTFVGTPYWMAPEIIARDNGYD 212

Query: 521 KTVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLS 578
           +  D W+LGI   E++TG PPY  YD  + V+    L++P      F  +A+D +   L+
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDP-MKVLMNIPLRKPPRLQGRFTSSARDFIALCLT 271

Query: 579 RDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTK--E 636
           +DP+ R   +   ++ +H F    +W+              +K E+D     ++ T    
Sbjct: 272 KDPALRPTAS---DLLSHKFLNRPTWRG----------TGTLKKEVDLVQMLKKRTNYSR 318

Query: 637 KPIDSVVDEYLSASIQKQFGGWTY 660
           +P   V D+  +  I +    W +
Sbjct: 319 EPRFQVTDKVYATGISRHLQDWNF 342

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  124 bits (311), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 136/262 (51%), Gaps = 12/262 (4%)

Query: 348 KVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPL 407
           + +G GSFG V + ++  + +  A+K L K  +     +     E  ++  +D P IV  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 408 KFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRD 467
           K  F++  K Y+V    +GGELF  + H+G+++   +   + ++L A++ LH  ++I+RD
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRD 188

Query: 468 LKPENIL-LDYQ--GHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVD 524
           LKPEN+L LD      I L DFG+ +    D+D      G+  Y+APE+    G+ K  D
Sbjct: 189 LKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSD 248

Query: 525 WWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLLFP----DGFDPAAKDLLIGLLS 578
            W++G++ Y ++ G  P+  E+V     ++   + P+ F     DG    AK+ ++ +L 
Sbjct: 249 IWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILD 308

Query: 579 RDPSRRLGVNGTDEIRNHPFFK 600
            DP+ R       E+ N P+ +
Sbjct: 309 LDPACRPSAT---ELLNDPWIQ 327

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  127 bits (320), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/306 (30%), Positives = 142/306 (46%), Gaps = 15/306 (4%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV-DCP 402
           F   +VIG+G FG V +     T+++YA+K L      S+ EV     E   LA +   P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLN--LDSSEDEVEDVQREIQFLASLKQIP 73

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            I     S+     L++++ +  GG L   L   G+         + ELL AL  +HK +
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYTK 521
           VI+RD+K  N+L+  +G + LCDFG+     + + +  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ--PLLFPDGFDPAAKDLLIGLLSR 579
            VD W+LGI  YE+ TG PPY D       + I++   P L    + P  K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 580 DPSRRLGVN---GTDEIRNH-----PFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQ 631
           DP  RL       T  I+ H        K++  + LL +     YK       D  N   
Sbjct: 253 DPQERLSAEELLKTKFIKTHKATPTTILKELISRYLLFRDKNKSYKDSAYLADDIPNAKA 312

Query: 632 EFTKEK 637
           E T E+
Sbjct: 313 ELTNEE 318

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  123 bits (309), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 129/247 (52%), Gaps = 10/247 (4%)

Query: 348 KVIGKGSFGKVMQVRKKDTQKIYALKAL-RKAYIVSKCEVTHTLAERTVLARVDCPFIVP 406
           K +G G+FG V Q R   T +  A+K L +KA   +  ++     E ++L  +  P IV 
Sbjct: 49  KTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKHPNIVE 108

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYR 466
            K  F+S +K Y+V     GGELF  +  +G+F+   +     ++L A+D +H  +V++R
Sbjct: 109 FKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYMHSKNVVHR 168

Query: 467 DLKPENIL-LDYQ--GHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTV 523
           DLKPEN+L +D      + + DFG+ K    ++D      G+  Y+APE+L   G+ K  
Sbjct: 169 DLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGHGKPC 228

Query: 524 DWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ--PLLFP----DGFDPAAKDLLIGLL 577
           D W++G+++Y ++ G   +  E V    ++  Q   P+ F     D     AK+ ++  L
Sbjct: 229 DIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAKNFILRAL 288

Query: 578 SRDPSRR 584
           + DP+ R
Sbjct: 289 TLDPAER 295

>Scas_564.7
          Length = 1210

 Score =  126 bits (317), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 162/352 (46%), Gaps = 40/352 (11%)

Query: 283 INTNQDIHLDSFHLPLNLK--IDSAAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPL- 339
           ++TNQ I+      P+  K   D   Q   +N +  +  R     N   +   ++N+P  
Sbjct: 94  LDTNQAINAPPQLSPVETKKAPDFPEQQSQFNSNATTPSRHPTTGNANNNATSNQNEPKQ 153

Query: 340 ----SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALR---KAYIVSKCEVTHTLAE 392
               S+ D+D L+ +G GS GKV   R   T++I A+K +    KA++  +  +     E
Sbjct: 154 FHRKSLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTE 213

Query: 393 RTVLARVD-----------------------CPFIVPLKFSFQSPEKLYLVLAFINGGEL 429
           + VL R                          P I  L          Y++  +++GG+L
Sbjct: 214 QEVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 273

Query: 430 FYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLC 489
             ++   G      +R +   +  AL+ +H  ++++RDLK ENI++   G I + DFGL 
Sbjct: 274 LDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS 333

Query: 490 KLNMKDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENV 547
             N+ D  K   TFCG+  + APE+L    YT   VD W+ G++LY ++ G  P+ DEN 
Sbjct: 334 --NVFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENS 391

Query: 548 PVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
            V+++KI Q  + +P+        LL  +L  DP RR  +    ++  HP+ 
Sbjct: 392 SVLHEKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRRASL---KQVVEHPWM 440

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  125 bits (315), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 144/289 (49%), Gaps = 34/289 (11%)

Query: 337 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL 396
           K  SI+D    +V+G G+F  V +  +++T K +A+K + K  +V   +      E  VL
Sbjct: 185 KDFSIND----EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSR--ELEVL 238

Query: 397 ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
            +++ P IV LK  ++     Y+V+ FI+GG+L   +   G       R    ++L A+ 
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 457 SLHKLDVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL 514
            +H   + +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQ-GNGSIMKTFCGTLAYVAPEVI 357

Query: 515 LG--------------QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLL 560
            G                Y+  VD W++G L++ ++TG  P+       +Y++I +    
Sbjct: 358 GGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIRKGS-- 415

Query: 561 FPDG------FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDIS 603
           + +G          A+D + GLL  D S+R+ V   D+  NHP+ K  S
Sbjct: 416 YHEGPLKDFRISDEARDFIDGLLQVDQSKRMTV---DDALNHPWIKQCS 461

>Scas_644.15
          Length = 726

 Score =  125 bits (315), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 133/257 (51%), Gaps = 8/257 (3%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKF 409
           +G+G F +  Q+ K ++ KI+A K + K  I ++      L+E  +   +  P IV    
Sbjct: 98  LGEGGFARCFQI-KDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHPNIVHFVD 156

Query: 410 SFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLK 469
            F+    +Y++L   + G L   ++     +    RF+  ++  A+  +H   VI+RDLK
Sbjct: 157 CFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRRVIHRDLK 216

Query: 470 PENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ--GYTKTVDWWT 527
             NI  D   ++ + DFGL  +   + ++  T CGTP Y+APE+L+G+  G++  VD W+
Sbjct: 217 LGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHSFEVDIWS 276

Query: 528 LGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG--FDPAAKDLLIGLLSRDPSRRL 585
           +G+++Y ++ G PP+  ++V V+Y +I      +P        AK L+  +L  DP  R 
Sbjct: 277 IGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERP 336

Query: 586 GVNGTDEIRNHPFFKDI 602
            +    EI +  +F+ I
Sbjct: 337 SIR---EIIDDVWFRGI 350

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 143/301 (47%), Gaps = 33/301 (10%)

Query: 333 PSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDT--------------------QKIYAL 372
           P   K ++   + +   +G+G FGKV     K                       K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 373 KALRKAYIVSK-CEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFY 431
           K +++ +I     + T    E   L  +  P IV L+   Q+ + + +VL +  GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 432 HLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKL 491
            +Q + R     +    ++L+ A+  +H   +++RDLK EN+LLD + ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 492 NMKDNDKTDTFCGTPEYLAPEILL-GQGY-TKTVDWWTLGILLYEMMTGLPPYYDE---- 545
            ++ N    T CG+P Y APE+++  + Y  +  D W+ GI+L+ M+ G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 546 ---NVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDI 602
              ++  +Y  IL  PL FP+  +P  +DLL  +L  DP +R+ +     I  HP+ +  
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRS---IEKHPWLESH 333

Query: 603 S 603
           S
Sbjct: 334 S 334

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  122 bits (305), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 135/266 (50%), Gaps = 15/266 (5%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTV-LARVDCP 402
           +++L+ IG+G+FG V + R   + +I A+K +    +    E    LA+    L+ +  P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQH--EGRFSLARSRFYIAELLCALDSLHK 460
           +I   K +F     +++V+ +  GG     L++  E + +  +  F ++E+L  LD LH 
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL--LGQG 518
              I+RD+K  NILL   GH+ L DFG+    M    K DTF GTP ++APE++    QG
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSG-QMMVTRKRDTFVGTPFWMAPEVIDRNKQG 195

Query: 519 YTKTVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGL 576
           Y +  D W+LGI + E++ G PP   YD    +M       P L    F   A+D +   
Sbjct: 196 YNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKL-DKRFSSHARDFVAQC 254

Query: 577 LSRDPSRRLGVNGTDEIRNHPFFKDI 602
           L +DPS+R       E+  H F K +
Sbjct: 255 LIKDPSQR---PTAAELLKHRFVKRV 277

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 121/245 (49%), Gaps = 7/245 (2%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV-DCP 402
           F   +VIG+G FG V +     T+++YA+K L       + EV     E   LA +   P
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLN--LDCPEDEVEDVQKEIQFLASLKQVP 82

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            I     S+    KL++++ +  GG L   L+  G+         + +LL AL  +HK +
Sbjct: 83  NITRYYGSYLYDTKLWVIMEYCAGGSLRTLLR-PGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYTK 521
           VI+RD+K  N+L+  +GH+ LCDFG+       N K  T  GTP ++APE+++ G  Y  
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ--PLLFPDGFDPAAKDLLIGLLSR 579
             D W+LGI  YE+ TG PPY D       + I +   P L    + P  K+ +   L  
Sbjct: 202 KADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDE 261

Query: 580 DPSRR 584
           DP  R
Sbjct: 262 DPEER 266

>Scas_618.8
          Length = 427

 Score =  121 bits (303), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 134/262 (51%), Gaps = 13/262 (4%)

Query: 333 PSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL-RKAYIVSKCEVTHTLA 391
           PSK   ++  D++  K +G GSFG V +  KK   +  A+K L +KA   ++ ++     
Sbjct: 19  PSK---VTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYD 75

Query: 392 ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAEL 451
           E T+L ++  P IV  K  F++ +K+Y+V     GGELF  +  +GRFS   +   + ++
Sbjct: 76  ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQI 135

Query: 452 LCALDSLHKLDVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
           L A++ +H  D+++RDLKPEN+L         + + DFG+ K   K         G+  Y
Sbjct: 136 LSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGY 195

Query: 509 LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ--QPLLFP---- 562
           +APE+L   G+ K  D W++G++ Y +++G   +  E V     +      P+ F     
Sbjct: 196 VAPEVLTVDGHGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYW 255

Query: 563 DGFDPAAKDLLIGLLSRDPSRR 584
           D     AK+ ++  L  +P +R
Sbjct: 256 DNISDDAKNFILKALDLNPQKR 277

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 141/282 (50%), Gaps = 27/282 (9%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYI----VSKCEVTHTLA---- 391
           +I  + L + +G GS GKV   R   T +  A+K + KA      VS   +  +      
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74

Query: 392 ------ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSR 445
                 E  ++  ++ P ++ L   +++   LYLVL +   GELF  L   G      + 
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAI 134

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGT 505
            +  +++  +   H L +++RDLKPEN+LLD++ +I + DFG+  L   +    +T CG+
Sbjct: 135 RFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET-EGKLLETSCGS 193

Query: 506 PEYLAPEILLG---QGYTKTVDWWTLGILLYEMMTGLPPYYDE--NVPVMYKKILQQPLL 560
           P Y APEI+ G   QG+    D W+ G++L+ ++TG  P+ +E  N+  +  K+ +    
Sbjct: 194 PHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251

Query: 561 FP--DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
            P  D     A+DL+  +L+ DP RR+    T +I  HP  +
Sbjct: 252 MPSDDEISREAQDLIRKILTVDPERRI---KTRDILKHPLLQ 290

>Scas_613.5
          Length = 517

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 137/300 (45%), Gaps = 34/300 (11%)

Query: 332 KPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTL 390
           K  + K LS  D + L K +G G +  V +   K T +  A+K         + +     
Sbjct: 191 KIVRTKQLSFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFR 250

Query: 391 AERTVLARVDCPFIVPLKFSFQSPE-----KLYLVLAFINGGELFYHLQHEGRFSLARSR 445
            E  +L R+  P IV L   F  P      + YLVL  I+ GELF  +  +       ++
Sbjct: 251 EETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETK 310

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQG-------------------HIALCDF 486
               ++L  L  LH+ ++I+RD+KPENILL+                       + + DF
Sbjct: 311 AIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADF 370

Query: 487 GLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE- 545
           GL K    +   T+T CGTP Y+APE+L  +GYT  VD W+ G++LY  + G PP+ ++ 
Sbjct: 371 GLAKFT-GEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQL 429

Query: 546 NVPVMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKD 601
             P + ++ILQ    F     D  D     L+  LL  D   R  V  T    NHP+F D
Sbjct: 430 GPPSLKEQILQAKFAFYTPYWDNIDDNVLHLISHLLVLDADARYSVEDT---INHPWFND 486

>Kwal_23.3590
          Length = 499

 Score =  122 bits (305), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 135/297 (45%), Gaps = 33/297 (11%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           +  +P   D +   K +G G +  V +   KD+  + A+K     +   + +      E 
Sbjct: 176 ANRRPSFFDRYIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREET 235

Query: 394 TVLARVDCPFIVPLKFSFQSPE-----KLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            +L  +    IV L   F  P      + +LVL  ++ GELF  +  + R     +    
Sbjct: 236 KILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETNAIF 295

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLDYQGH-------------------IALCDFGLC 489
            ++L  L  LH  ++I+RD+KPENILL  +                     I + DFGL 
Sbjct: 296 KQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLA 355

Query: 490 KLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENV-P 548
           K  + +   T+T CGTP Y+APE+L   GYT  VD W+ G+LLY  + G PP+ ++   P
Sbjct: 356 KF-IGEMQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPP 414

Query: 549 VMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKD 601
            M ++IL     F     D  D +   L+  LL  +P+ R  V  T    NHP+F +
Sbjct: 415 SMKEQILNGKFAFYSPYWDDIDDSCLHLISNLLVVNPAYRFDVQKT---INHPWFSN 468

>Scas_700.34
          Length = 864

 Score =  124 bits (310), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 147/305 (48%), Gaps = 28/305 (9%)

Query: 335 KNKPLSIDDFDLLKVIGKGSFGKVMQVRKK----------DTQKIYALKALRKAYIV--S 382
           K K ++   + +   +G+G FGKV     K          D  K  A+K +R+  I   S
Sbjct: 39  KRKHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDS 98

Query: 383 KCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLA 442
             E+     E   L  +  P IV L+   Q+ + + +VL + +GGE + ++Q + R    
Sbjct: 99  SKEIK-IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEG 157

Query: 443 RSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTF 502
            +    A+L+  +  +H   +++RDLK EN+LLD   ++ + DFG         +   T 
Sbjct: 158 PACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTS 217

Query: 503 CGTPEYLAPEILLGQG--YTKTVDWWTLGILLYEMMTGLPPYYD-------ENVPVMYKK 553
           CG+P Y APE+++       K  D W+ G++LY M+ G  P+ D       +++  +Y  
Sbjct: 218 CGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHY 277

Query: 554 ILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDE---IRNHPFFKDIS---WKKL 607
           I Q PL FPD  +P  +DLL  +L  DP RR+ +   ++   ++ H  F  I+   W  +
Sbjct: 278 ITQTPLKFPDYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPHSAFLSITPEEWDTI 337

Query: 608 LLKGY 612
           + K +
Sbjct: 338 MHKKF 342

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  124 bits (310), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 135/262 (51%), Gaps = 13/262 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           + ++ + K IG+GSFGKV     + T++   LK   K+         + + E     + D
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS-------DPNVVREVFYHRQFD 91

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P+I  L     +  K+++ L +  G EL+ HL  + R          A++  A+   H 
Sbjct: 92  YPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHT 151

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
           L+ ++RDLK EN+LLD  G+  L DFG  + +M      +T CGT  Y+APE++  + Y 
Sbjct: 152 LNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPYD 210

Query: 521 K-TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ-PLLFPDGFDPAAKDLLIGLLS 578
              VD W+LG++LY ++ G  P+ +++  +  +KI+   P++      P A++L+  LLS
Sbjct: 211 GFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLS 270

Query: 579 RDPSRRLGVNGTDEIRNHPFFK 600
           +DP+ R     T  I  HPF +
Sbjct: 271 KDPTERP---NTSAILLHPFLQ 289

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  120 bits (300), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 129/247 (52%), Gaps = 10/247 (4%)

Query: 348 KVIGKGSFGKVMQVRKKDTQKIYALKAL-RKAYIVSKCEVTHTLAERTVLARVDCPFIVP 406
           K +G G+FG V Q +  +T +  A+K L +KA   +K ++     E  +L R+  P IV 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYR 466
            K  F+S +K Y++     GGELF  +  +G+F+   +   + E+L A+  +H  ++++R
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHR 160

Query: 467 DLKPENIL-LDY--QGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTV 523
           DLKPEN+L +D   +  + + DFG+ K    D +      G+  Y+APE+L   G+ K  
Sbjct: 161 DLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPC 220

Query: 524 DWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLLFP----DGFDPAAKDLLIGLL 577
           D W++G++ Y ++ G   +  E V     +    + P+ F     D     AK  ++  L
Sbjct: 221 DIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKAL 280

Query: 578 SRDPSRR 584
           + DPS+R
Sbjct: 281 NLDPSKR 287

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 141/277 (50%), Gaps = 20/277 (7%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKC---------EVTHTL 390
           +I  + L   +G GS GKV+    +   +  A+K + K+   ++          +V    
Sbjct: 13  TIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYG 72

Query: 391 AER--TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            ER   ++  ++ P ++ L   +++ + LY+VL ++  GELF  L   G      +  + 
Sbjct: 73  IEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFF 132

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
            +++  +   H L +++RDLKPEN+LLD++ ++ L DFG+  L  KD    +T CG+P Y
Sbjct: 133 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDK-LLETSCGSPHY 191

Query: 509 LAPEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYDE--NVPVMYKKILQQPLLFP--D 563
            APEI+ G  Y     D W+ G++LY ++TG  P+ +E  N+  +  K+       P  D
Sbjct: 192 AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDD 251

Query: 564 GFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
                A+DL+  +L+ DP +R+    T EI  HP  +
Sbjct: 252 EISSEAQDLIARILTVDPEQRI---KTREILKHPLLR 285

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  121 bits (304), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 103/155 (66%), Gaps = 1/155 (0%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-AR 398
           SI D+D++K I KG++G V   +K+ T + +A+K L+K+ +++K +VT+  +ER ++  +
Sbjct: 698 SIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 757

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
            D P++  L  +FQ+ E L+LV+ +++GG++   ++  G      ++ YI E++  +D +
Sbjct: 758 SDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVISGVDDM 817

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           H+  +I+ DLKP+N+L+D  GHI L DFGL ++ +
Sbjct: 818 HQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGL 852

>Kwal_26.8796
          Length = 796

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 136/268 (50%), Gaps = 22/268 (8%)

Query: 348 KVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA-ERTVLARVDCPFIVP 406
           +V+G+G+F  V +  ++ T K +A+K + K  +V    V   +A E  VL R+D P IV 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVS 248

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYR 466
           LK  ++  +  YLV+ F++GG+L   +   G       R    ++L A+  +H + + +R
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHR 308

Query: 467 DLKPENILLDYQGH--IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQG------ 518
           DLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++ G+       
Sbjct: 309 DLKPDNILIERDDPVLVKITDFGLAKIQ-GNGTFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 519 --YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL----QQPLLFPDGFDPAAKDL 572
             Y+  VD W++G L+Y ++TG  P+       +YK+I      +  L        A+D 
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSYHEGPLKDYRISDDARDF 427

Query: 573 LIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           +   L  DP  R+     ++   HP+ K
Sbjct: 428 IESFLQVDPRNRMTA---EQALRHPWIK 452

>Scas_700.28
          Length = 896

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 130/262 (49%), Gaps = 13/262 (4%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD 400
           + ++ +L  IG+GSFGKV   + + T     LK+       S     + + E     + D
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKS-------SDKNDPNIVREVFYHRQFD 87

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
            P+I  L     +  K+++ L +  G EL+  +    R          A+++  +   H 
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
           L+ ++RDLK ENILLD  G   L DFG  +  M      +T CGT  Y+APE++  + Y 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKT-TLETICGTTVYMAPELIERKSYD 206

Query: 521 K-TVDWWTLGILLYEMMTGLPPY-YDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLS 578
              +D W+LG++LY M+ G  P+  D+     +K + Q P L  +     AKDL++ LL+
Sbjct: 207 GFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLA 266

Query: 579 RDPSRRLGVNGTDEIRNHPFFK 600
           ++P+ R  V   ++I  HPF +
Sbjct: 267 KNPNDRPTV---EQILKHPFLQ 285

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 138/268 (51%), Gaps = 29/268 (10%)

Query: 337 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL 396
           K  SI+D    +V+G+G+F  V +  +++T K +A+K + K  ++    V     E  VL
Sbjct: 214 KDFSIND----EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGN--VDGVTRELEVL 267

Query: 397 ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
            R++ P IV LK  ++  E  YL++ F++GG+L   +   G       R    ++L A+ 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 457 SLHKLDVIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDNDK-TDTFCGTPEYLAPEI 513
            +H+  + +RDLKP+NIL++      + + DFGL K+  +DN     TFCGT  Y+APE+
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKI--QDNTTFMKTFCGTLAYVAPEV 385

Query: 514 LLGQG----------YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPD 563
           + G+           Y+  VD W++G L+Y ++TG  P+       +YK+I      + +
Sbjct: 386 IGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGS--YHE 443

Query: 564 G------FDPAAKDLLIGLLSRDPSRRL 585
           G          A+D +  LL  +P  RL
Sbjct: 444 GPLKDYWISDEARDFIDSLLQINPVDRL 471

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  121 bits (304), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 115/195 (58%), Gaps = 12/195 (6%)

Query: 311 YNHHWISLERGYGKLNITVD---------YKPSKNKPL--SIDDFDLLKVIGKGSFGKVM 359
           +NH  +S+   +  L+ +V             S+ KPL  SI D+D++K I KG++G V 
Sbjct: 738 FNHSNLSVSNSHVNLSNSVSSNQPLSPLLLATSQMKPLTPSIKDYDIIKPISKGAYGSVY 797

Query: 360 QVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-ARVDCPFIVPLKFSFQSPEKLY 418
             RKK T   +A+K LRK+ +++K +VT+  +ER ++  + D P++  L  +FQ+ + L+
Sbjct: 798 LARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKPYVARLYATFQNKDNLF 857

Query: 419 LVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQ 478
           LV+ ++ GG+L   L+  G       + Y++E++  ++ +H   +I+ DLKPEN+L+D  
Sbjct: 858 LVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIIIGVEDMHNNGIIHHDLKPENLLIDVS 917

Query: 479 GHIALCDFGLCKLNM 493
           GH+ L DFGL +  +
Sbjct: 918 GHLKLTDFGLSRAGL 932

 Score =  117 bits (293), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 95/172 (55%), Gaps = 17/172 (9%)

Query: 488  LCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENV 547
            L   N +D+ +   F GTP+YLAPE + G G     DWW++G +L+EM+ G PP++ E  
Sbjct: 1089 LILFNPEDSKQDKRFFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETP 1148

Query: 548  PVMYKKILQQPLLFP---------DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPF 598
              +++ IL+  + +P         +   P AKDL++  L  DP +RLG NGT+EI+NHP+
Sbjct: 1149 DQVFRNILEGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPY 1208

Query: 599  FKDISWKKLLLKGYIPPYKPIVKSEIDTANFD------QEFTKEKPIDSVVD 644
            FKD+ W  +        Y P ++   DT  FD      Q+F  +   D+V++
Sbjct: 1209 FKDVKWDHVY--DETASYVPNIEDPEDTDYFDLRGATLQDFGDDNDEDAVLE 1258

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/313 (27%), Positives = 143/313 (45%), Gaps = 42/313 (13%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALR---KAYIVSKCEVTHTLAERTVL 396
           S+ D+D L+ +G GS GKV   + + T ++ A+K +    KA++  +      +  + ++
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 397 ARVD-----------------------CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHL 433
            R                          P I  L          Y++  ++ GG+L  ++
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 434 QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
              G      +R +   +  AL  LH  ++++RDLK ENI++   G I + DFGL   N+
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS--NV 281

Query: 494 KDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENVPVMY 551
            D  K   TFCG+  + APE+L    YT   VD W+ G++LY ++ G  P+ DEN  V++
Sbjct: 282 YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 341

Query: 552 KKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKG 611
           +KI +  + +P         LL  +L  DPSRR  +    ++  HP      W   + KG
Sbjct: 342 EKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLK---QVVEHP------W---MTKG 389

Query: 612 YIPPYKPIVKSEI 624
           Y  P    V + I
Sbjct: 390 YDTPAPSYVPNRI 402

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 142/296 (47%), Gaps = 36/296 (12%)

Query: 336 NKPL---SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKA---YIVSKCEVTHT 389
           NKP    S+ D+D L+ +G GS GKV   + + T ++ A+K + +A   Y+  + ++   
Sbjct: 87  NKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPP 146

Query: 390 LAERTVLAR-----------------------VDCPFIVPLKFSFQSPEKLYLVLAFING 426
             E  ++ R                       +  P I  L          Y++  +++G
Sbjct: 147 KTEEELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSG 206

Query: 427 GELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDF 486
           G+L  ++   G      +R ++  +  AL  LH  ++++RDLK ENI++   G I + DF
Sbjct: 207 GQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDF 266

Query: 487 GLCKLNMKDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYD 544
           GL   N+ DN K   TFCG+  + APE+L    Y    VD W+ G+++Y ++ G  P+ D
Sbjct: 267 GLS--NLYDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDD 324

Query: 545 ENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           EN  V+++KI +  + +P         LL  +L  DP +R  +    ++ NH + +
Sbjct: 325 ENASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVDPLKRASLK---QVCNHQWMQ 377

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  118 bits (295), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 153/347 (44%), Gaps = 44/347 (12%)

Query: 339 LSIDDFDLLKVIGKGSFGKVMQVRK-KDTQKIYALKALRKAYIVSKC-EVTHT------- 389
           LS+  F LL+ +GKG+FG V         Q+    K  +   +  KC  + H+       
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEHSNEPIDLL 61

Query: 390 LAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIA 449
           L E   L+ + CP+I     +F     LY+V+ + + G L   L++  R +   + F I 
Sbjct: 62  LKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFIIL 121

Query: 450 ELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLC---KLNMKDN--DKTDTFCG 504
           ++  AL+ LH+  +I+RDLK  NILL+  G + L D G+    K N   +     +TF G
Sbjct: 122 QVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTFVG 181

Query: 505 TPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG 564
           TP ++APEI+  Q Y    D W+LGI   E++ G PP    +     K +++ P L  D 
Sbjct: 182 TPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPMSHLDS---MKALMRIPKLNADS 238

Query: 565 ------FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKP 618
                   P  KD +   L +DP++R       ++  H + K  S   ++          
Sbjct: 239 ILRNMDISPLGKDFIRSCLQQDPNQR---PTCKQLLQHKWLKKCSITNIM---------- 285

Query: 619 IVKSEIDTANFDQEFTKEKPIDS-----VVDEYLSASIQKQFGGWTY 660
               EI     +Q  +KEKP        + D+    ++  Q   W +
Sbjct: 286 ---EEITVMKTNQILSKEKPRSCKPRFPLSDKVYKTNLPNQLESWRF 329

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  120 bits (302), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-AR 398
           SI D+D+LK I KG++G V   RKK T   +A+K LRK+ +++K +VT+  +ER ++  +
Sbjct: 790 SIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 849

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
            D P++  L  SFQ+ + L+LV+ ++ GG+L   ++  G      ++ Y+ E++  ++ +
Sbjct: 850 SDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDM 909

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           H+  +I+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 910 HQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGL 944

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 83/146 (56%), Gaps = 12/146 (8%)

Query: 495  DNDKTDTFCGTPEYLAPEILLGQGY-TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK 553
            D+ +   F GTP+YLAPE + G+G   K  DWW++G + +E++ G PP++ E    ++KK
Sbjct: 1140 DSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKK 1199

Query: 554  ILQQPLLFPDG---------FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
            IL   + +P+            P AKDL+  LL  DP++RLG  G  EI++HP+FK++ W
Sbjct: 1200 ILSGVIQWPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDW 1259

Query: 605  KKLLLKGYIPPYKPIVKSEIDTANFD 630
              +  +     + P + +  DT  FD
Sbjct: 1260 DHVYDEEA--SFVPTIDNPEDTDYFD 1283

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score =  120 bits (300), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 139/302 (46%), Gaps = 25/302 (8%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV-DCP 402
           F   +VIG+G FG V +     T ++YA+K L         EV     E   LA +    
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLN--LDSDSDEVEDVQREIQFLASLKQIS 80

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            I     S+     L++++    GG L   L   G+         + ELL AL  +HK +
Sbjct: 81  NITRYYGSYLKDTSLWIIMEHCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYTK 521
           VI+RD+K  N+L+  +G++ LCDFG+     + + +  T  GTP ++APE+++ G  Y  
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 199

Query: 522 TVDWWTLGILLYEMMTGLPPYYD-ENVPVMYKKILQQPLLFPD-GFDPAAKDLLIGLLSR 579
            VD W+LGI  YE+ TG PPY D E +  M   I  +P    D  +  + K+ +   L  
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 580 DPSRRLGVNG---TDEIRNHP---------------FFKDISWKKLLLKGYIPPYKPIVK 621
           DP  RL  +    +  IR H                 F+D +  K  ++G IP  +P   
Sbjct: 260 DPKERLSADDLLKSKFIRAHKATPTSILKELISRYLLFRDKNKNKYKIEGSIPENEPSKP 319

Query: 622 SE 623
           SE
Sbjct: 320 SE 321

>Scas_580.6
          Length = 1015

 Score =  119 bits (299), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 125/261 (47%), Gaps = 10/261 (3%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV-DCP 402
           F   +VIG+G FG V +     T++IYA+K L       + EV     E   L+ +   P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLN--LDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            I     S+     L++++ +  GG L   L   G+         + ELL AL  +HK +
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYTK 521
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ--PLLFPDGFDPAAKDLLIGLLSR 579
            VD W+LGI  YE+ TG PPY +       + I +   P L    + P  K+ +   L  
Sbjct: 214 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDE 273

Query: 580 DPSRRLGVNGTDEIRNHPFFK 600
           DP  RL     +E+    F K
Sbjct: 274 DPKERLSA---EELSKTKFIK 291

>Scas_573.10
          Length = 569

 Score =  118 bits (296), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 90/318 (28%), Positives = 140/318 (44%), Gaps = 70/318 (22%)

Query: 339 LSIDDFDLLKVIGKGSFGKVMQVRKK---------DTQKIYALKALRKAYIVS---KCEV 386
           + +  + L++ +G+G+F KV +   +         +  K  A+K ++K  +V    K ++
Sbjct: 114 VELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDPKADI 173

Query: 387 ----------THTLAERTVLARVD--------CPFIVPLKFSFQSPEKLYLVLAFINGGE 428
                     + T ++  VL  V         CP IV      +S    Y+V   I+GGE
Sbjct: 174 HVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQFIDFQESKTYYYIVQELIHGGE 233

Query: 429 LFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHI------- 481
           +F  +     FS   SR  I +L  A+  LH L V++RD+KPEN+L +    I       
Sbjct: 234 IFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSKEPKL 293

Query: 482 ---------------------------ALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL 514
                                       L DFGL K     N KT   CGT  Y APE++
Sbjct: 294 RKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATNTKTP--CGTVGYTAPEVV 351

Query: 515 LGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP----DGFDPAAK 570
             + Y+  VD W +G +LY M+ G PP+YDE + V+ +KI +    F     D     AK
Sbjct: 352 KDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEISAGAK 411

Query: 571 DLLIGLLSRDPSRRLGVN 588
           + +I LL  DP++R  ++
Sbjct: 412 NAVIRLLEVDPNKRYDID 429

>Scas_700.54
          Length = 698

 Score =  119 bits (297), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 139/280 (49%), Gaps = 28/280 (10%)

Query: 337 KPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL 396
           K  SI D    +V+G+G+F  V +  ++ T K +A+K + K  ++   E      E  VL
Sbjct: 220 KDFSIQD----EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVS--RELEVL 273

Query: 397 ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
            ++D P IV LK  ++  +  Y+V+ F++GG+L   +   G       +    ++L A+ 
Sbjct: 274 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 333

Query: 457 SLHKLDVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL 514
            +H   + +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 334 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQ-GNGSFMKTFCGTLAYVAPEVI 392

Query: 515 LGQG--------YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG-- 564
            G+G        Y+  VD W++G L+Y ++TG  P+       +YK+I +    + +G  
Sbjct: 393 GGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGS--YHEGPL 450

Query: 565 ----FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
                   A+  +  LL  +P  RL      E   HP+ K
Sbjct: 451 KDFRISDEARSFIDSLLQVNPGNRLTAARALE---HPWIK 487

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 87/323 (26%), Positives = 145/323 (44%), Gaps = 51/323 (15%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAY--IVSKCEVT---------- 387
           S+ D+D L+ +G GS GKV   + + T ++ A+K + +A    + K ++           
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEE 109

Query: 388 ----------------HTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFY 431
                            T+ E ++   +  P I  L          Y++  +++GG+L  
Sbjct: 110 LLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 169

Query: 432 HLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKL 491
           ++   G      +R +   +  AL  LH  ++++RDLK ENI++   G I + DFGL   
Sbjct: 170 YIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS-- 227

Query: 492 NMKDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENVPV 549
           NM D  K   TFCG+  + APE+L    YT   VD W+ G++LY ++ G  P+ DEN  V
Sbjct: 228 NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 287

Query: 550 MYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLL 609
           +++KI Q  + +P         LL  +L  DP +R               K +   + + 
Sbjct: 288 LHEKIKQGKVEYPQHLSIDVISLLSKMLVVDPYKRA------------TLKQVVHHQWMQ 335

Query: 610 KG-------YIPPYKPIVKSEID 625
           KG       Y+PP  P+    I+
Sbjct: 336 KGYDFPPPSYLPPCVPLTPDRIN 358

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 140/269 (52%), Gaps = 25/269 (9%)

Query: 349 VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLK 408
           ++G+G+F  V +  ++ T K +A+K + K  ++ K +      E  VL +++ P IV LK
Sbjct: 197 IVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKR--ELDVLQKLNHPRIVKLK 254

Query: 409 FSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDL 468
             F+  +  Y+++ F++GG+L   +   G       R    ++L A+  +H   + +RDL
Sbjct: 255 DFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDL 314

Query: 469 KPENILLDYQG--HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQG-------- 518
           KP+NI+++      I + DFGL K+  + N   +TFCGT  Y+APE++ G+         
Sbjct: 315 KPDNIMIEQDDPVLIKITDFGLAKVQNQ-NTFLNTFCGTLAYVAPEVIDGKNAEDKTNRD 373

Query: 519 -YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDG------FDPAAKD 571
            Y+  VD W++G L+Y ++TG  P+  ++   ++K+I +    + +G          A++
Sbjct: 374 LYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGS--YHEGPLKDYRISEEARN 431

Query: 572 LLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
            +  LL+ DP  R+      +   HP+ K
Sbjct: 432 FIDCLLNVDPKERMNAG---KALQHPWMK 457

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 145/306 (47%), Gaps = 45/306 (14%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALR---KAYIVSKCEV---------- 386
           S+  +D ++ +G GS GKV   + K++ ++ A+K +    KAY+    ++          
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 387 -------------THTLAERTVLARVDCPFIVPLKFSFQS-PEKLYLVLAFINGGELFYH 432
                          T+ E ++   +  P +  L +  Q+     Y+   FI+GG+L  +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKL-YEMQTLSNHYYMFFEFISGGQLLDY 181

Query: 433 LQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLN 492
           +   G      +R     +L AL  LH  ++++RDLK ENI+L   G I L DFGL   N
Sbjct: 182 IIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLS--N 239

Query: 493 MKDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENVPVM 550
           M D  K+  TFCG+  + APE+L    Y    VD W+ G++LY ++ G  P+ DEN   +
Sbjct: 240 MYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSAL 299

Query: 551 YKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLK 610
           ++KI +  + +P         LL  +L  DP +R  +    ++ NH       W   +LK
Sbjct: 300 HEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKRATLQ---QVVNH------QW---MLK 347

Query: 611 GY-IPP 615
           GY  PP
Sbjct: 348 GYDFPP 353

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 101/155 (65%), Gaps = 1/155 (0%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-AR 398
           SI D+D++K I KG++G V    K+ T + +A+K LRK+ +++K +VT+  +ER ++  +
Sbjct: 678 SIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQ 737

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
            + P++  L  +FQ+ E L+LV+ +++GG+L   ++  G      ++ YI E++  +D +
Sbjct: 738 SEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDM 797

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           H   +I+ DLKP+N+L+D  GH+ L DFGL ++ +
Sbjct: 798 HMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGL 832

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 82/145 (56%), Gaps = 11/145 (7%)

Query: 495  DNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
            D D +  F GTP+YL+PE +LG G +   DWW++G +L+E + G PP++   V  ++K I
Sbjct: 994  DEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI 1053

Query: 555  LQQPLLFP---------DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
            L   + +P         +   P AKDL++ LL  +P  RLG NG  EI+ HP+FK I+W 
Sbjct: 1054 LSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWS 1113

Query: 606  KLLLKGYIPPYKPIVKSEIDTANFD 630
            K+  +     + P V +  DT  FD
Sbjct: 1114 KVYDEEA--SFVPTVDNPEDTDYFD 1136

>Kwal_47.17252
          Length = 872

 Score =  118 bits (295), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/307 (28%), Positives = 146/307 (47%), Gaps = 54/307 (17%)

Query: 335 KNKPLSIDDFDLLKV-IGKGSFGKVMQVR---KKDTQKIYALKALRKAYIVSKCEVTHTL 390
           +  P+ I D  L++  IGKGSF  V + R    +D     A+KA+ ++ + +K  + +  
Sbjct: 10  RAAPIMISDKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLE 69

Query: 391 AERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEG----RFSLARSRF 446
            E  +L ++  P IV L    ++    +L++ +   G+L + ++  G    +  L R+ F
Sbjct: 70  IEIAILKKIKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMF 129

Query: 447 --------------------YIAELLCALDSLHKLDVIYRDLKPENILL-----DYQGH- 480
                               Y+ +L  AL  L   ++++RD+KP+N+LL     +Y    
Sbjct: 130 EKYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRE 189

Query: 481 ---------------IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDW 525
                          + + DFG  +  + +    +T CG+P Y+APEIL  Q Y    D 
Sbjct: 190 TFHKMGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADL 248

Query: 526 WTLGILLYEMMTGLPPYYDENVPVMYKKI--LQQPLLFPD--GFDPAAKDLLIGLLSRDP 581
           W++G +LYEM  G PP+   N   ++KKI      + FP     DP  ++L+ GLL+ DP
Sbjct: 249 WSVGTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDP 308

Query: 582 SRRLGVN 588
           S+R+G N
Sbjct: 309 SQRMGFN 315

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 125/247 (50%), Gaps = 10/247 (4%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           + +   IG+G+FG V +   + TQ+I A+K +   +  S  ++     E   LA +  P 
Sbjct: 18  YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH--SDEDIELLAQEIFFLAELKSPL 75

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSR--FYIAELLCALDSLHKL 461
           I     +      +++V+ +  GG     L+      L   +  F I E+   L  LH+ 
Sbjct: 76  ITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQ 135

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQ--GY 519
             I+RD+K  NILL+ +G + L DFG+   +++   K DTF GTP ++APE++  +  GY
Sbjct: 136 RKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAPEVVCCEVDGY 194

Query: 520 TKTVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLL 577
            +  D W+LGI  YE++ GLPP   YD  + VM     ++P      F  AAKD + G L
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDP-MKVMTNLPKRKPPKLQGPFSDAAKDFVAGCL 253

Query: 578 SRDPSRR 584
            + P+ R
Sbjct: 254 VKTPADR 260

>Kwal_26.8751
          Length = 848

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/297 (28%), Positives = 139/297 (46%), Gaps = 18/297 (6%)

Query: 318 LERGYGKLNITVDYKP-----SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYAL 372
            E+   K NI+  Y       S N+   + ++ +LK++G+GSFGKV       T +   L
Sbjct: 6   FEQNQLKANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVL 65

Query: 373 KALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYH 432
           K   K          + + E     + D   I  L     +   +++ L +  G EL+ +
Sbjct: 66  KMGSK-------NDPNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEY 118

Query: 433 LQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLN 492
           L  +    L       ++++ A+   H +  ++RDLK ENILLD +GH  L DFG  +  
Sbjct: 119 LLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTR-E 177

Query: 493 MKDNDKTDTFCGTPEYLAPEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYD-ENVPVM 550
                  +T CGT  Y+APE++  + Y    +D W+LGI+LY M+ G  P+ + + V   
Sbjct: 178 CATKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTK 237

Query: 551 YKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKL 607
           YK +   P    D  D   K+L+  LL +DP++R  +    ++  HPF +    K L
Sbjct: 238 YKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLT---QVLQHPFLQPYGLKIL 291

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  117 bits (294), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 124/252 (49%), Gaps = 13/252 (5%)

Query: 349 VIGKGSFGKVM---QVRKKDTQKIYALKALRKAYIVSKCEV-THTLAERTVLARVDCPFI 404
            +G+G FGKV         D  K  A+K +R+  I    E       E   L  +  P I
Sbjct: 61  TLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNI 120

Query: 405 VPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVI 464
           V L+   Q+ + + +VL + +GGE + ++Q + R     +    A+L+  +  +H   + 
Sbjct: 121 VTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLISGVHYMHHKGLA 180

Query: 465 YRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGY-TKT 522
           +RDLK EN+LLD   ++ + DFG        ND   T CG+P Y APE+++  + Y  + 
Sbjct: 181 HRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARK 240

Query: 523 VDWWTLGILLYEMMTGL-------PPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIG 575
            D W+ G++LY M+ G             +++  +Y  I +  L FP+  +P  +D+L  
Sbjct: 241 ADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKFPEYINPIPRDILRR 300

Query: 576 LLSRDPSRRLGV 587
           +L  DPS+R+ V
Sbjct: 301 ILVSDPSKRITV 312

>Scas_493.2
          Length = 1117

 Score =  117 bits (294), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 140/280 (50%), Gaps = 23/280 (8%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA-------- 391
           +I  + L + +G GS GKV     + T +  A+K + K+   +K     T          
Sbjct: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77

Query: 392 ------ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSR 445
                 E  ++  +    ++ L   +++   LY++L +   GELF  L  +G      + 
Sbjct: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGT 505
            +  +++  +   H L +++RDLKPEN+LLD++ +I + DFG+  L  +D    +T CG+
Sbjct: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED-KLLETSCGS 196

Query: 506 PEYLAPEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYDE--NVPVMYKKILQQPLLFP 562
           P Y APEI+ G  Y     D W+ G++L+ ++TG  P+ +E  N+  +  K+       P
Sbjct: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 563 DGFDPA--AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           D  + +  A+DL+  +L+ DP++R+    T EI  HP  +
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRI---KTREILKHPLLQ 293

>Scas_201.1*
          Length = 274

 Score =  110 bits (275), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 113/198 (57%), Gaps = 4/198 (2%)

Query: 354 SFGKVMQVRKKDTQKIYALKALRK-AYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQ 412
           +FG V Q R+  +Q+  A+K L K A   +  ++     E ++L R+  P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 413 SPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPEN 472
           S +K Y+V     GGELF  +  +G+F+   +   + +LL A+  +H  ++++RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 473 IL-LD--YQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLG 529
           +L LD   +  + + DFG+ K    ++D      G+  Y+APE+L  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 530 ILLYEMMTGLPPYYDENV 547
           ++ Y +++G  P+  E+V
Sbjct: 225 VITYTLLSGYSPFIAESV 242

>Scas_707.3
          Length = 1598

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 101/161 (62%), Gaps = 1/161 (0%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           +KN   +I D+ +LK I KG++G V   RKK T   +A+K L+K+ +++K +VT+  +ER
Sbjct: 689 TKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSER 748

Query: 394 TV-LARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELL 452
            + + + D P++  L  +FQ+ E L+LV+ ++ GG+L   ++  G       + Y+ E++
Sbjct: 749 AIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEII 808

Query: 453 CALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
             +D +H+  +I+ DLKP+N+L+D  GH+ L DFGL +  +
Sbjct: 809 VGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGL 849

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 97/170 (57%), Gaps = 17/170 (10%)

Query: 495  DNDKTDT-FCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK 553
            D+ K D  F GTP+YLAPE + G G     DWW++G +++E++ G PP++      +++K
Sbjct: 997  DDSKQDKKFFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRK 1056

Query: 554  ILQQPLLFPDGFD----------PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDIS 603
            IL   + +P  FD          P AKDL++ LL  DPS+RLG NG DEI+ HP+FKD++
Sbjct: 1057 ILSGKIEWPQ-FDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVN 1115

Query: 604  WKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQK 653
            W  +  +     + P V++  DT  FD   T+   +++  D+Y    I K
Sbjct: 1116 WDHVYDEEA--SFVPTVENPEDTDYFD---TRGAVLENFGDDYEDKEIPK 1160

>Scas_673.20*
          Length = 758

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 128/265 (48%), Gaps = 28/265 (10%)

Query: 347 LKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVP 406
           LK IG+G+ G V    +  T    A+K +    I  + ++  T  E  VL     P I+ 
Sbjct: 484 LKRIGEGASGIVYTAYEIGTDISVAIKQI-DLKIQPRLQMIWT--EMLVLKEYQHPNIIN 540

Query: 407 LKFSFQSPEKLYLVLAFINGGEL-----FYHLQHEGRFSLARSRFYIAELLCALDSLHKL 461
              S+   + L++V+ +++GG L     F+    E   ++ R      E L  L+ LH  
Sbjct: 541 FINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR------ETLFGLNFLHSR 594

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTK 521
            +++RD+K +NILL   G I + DFG C    + N K  T  GTP ++APE++  + Y  
Sbjct: 595 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEYGP 654

Query: 522 TVDWWTLGILLYEMMTGLPPYYDEN-VPVMY------KKILQQPLLFPDGFDPAAKDLLI 574
            VD W+LGI++ EM+ G PPY  E  V  +Y      K IL++    P+   P  K+ + 
Sbjct: 655 KVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKE----PEKVGPVLKNFMD 710

Query: 575 GLLSRDPSRRLGVNGTDEIRNHPFF 599
             L  DP  RL    T ++  H F 
Sbjct: 711 ECLRVDPEARL---STPQLLKHEFI 732

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  113 bits (282), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 102/209 (48%), Gaps = 28/209 (13%)

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
           F+ PL    +S  + YLVL  I  GELF  +  + +     +R    ++L  L  LH  +
Sbjct: 222 FVEPLS---KSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDRN 278

Query: 463 VIYRDLKPENILLDYQGH-------------------IALCDFGLCKLNMKDNDKTDTFC 503
           +I+RD+KPENILL  +                     + + DFGL K    +   T T C
Sbjct: 279 IIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFT-GEMQFTTTLC 337

Query: 504 GTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENV-PVMYKKILQQPLLFP 562
           GTP Y+A E+L   GYT  VD W+ G+LLY  + G PP+ D+   P M ++ILQ    F 
Sbjct: 338 GTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAFY 397

Query: 563 ----DGFDPAAKDLLIGLLSRDPSRRLGV 587
               D  D +   L+  LL  DP++R  V
Sbjct: 398 SPYWDEIDDSVLHLISNLLVVDPAKRYSV 426

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 148/320 (46%), Gaps = 51/320 (15%)

Query: 326 NITVDYKPSKNK---PLSIDDFDLLKVIGKGSFGKVMQVR--KKDTQKIYALKALRKAYI 380
           N + DY  S ++    L + ++ LL  IG+G+F +V +      D Q   A+KA+ K  I
Sbjct: 100 NKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGI 159

Query: 381 VSKC-----EVTHTLAERTVLARVDCPFIVP------LKF-SFQ-SPEKLYLVLAFINGG 427
            S       +     + + VL  V    +V        KF +FQ S    YLV   + GG
Sbjct: 160 SSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG 219

Query: 428 ELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILL----------DY 477
           E+F  +     FS   +R  I ++  A+  +H + +++RD+KPEN+L           D 
Sbjct: 220 EIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDM 279

Query: 478 QGH--------------IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTV 523
           Q                + L DFGL K     N+   T CGT EY+A E+   + Y+  V
Sbjct: 280 QKEDEFTLGVGGGGIGLVKLMDFGLAK--KLRNNTAKTPCGTIEYVASEVFTSKRYSMKV 337

Query: 524 DWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ--QPLLFP--DGFDPAAKDLLIGLLSR 579
           D W++G +L+ ++ G PP+Y++N   + KKI +     L P  D     AK+ +  LL  
Sbjct: 338 DMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEV 397

Query: 580 DPSRRLGVNGTDEIRNHPFF 599
           DP++R  +   D+  N P+ 
Sbjct: 398 DPNKRYDI---DDFLNDPWL 414

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 131/268 (48%), Gaps = 15/268 (5%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVM----QVRKKDTQKIYALKALRKAYIVSKCEVTHT 389
           SK K ++   + +   +G+G FGKV     + R     +  A+K +R+  +    E    
Sbjct: 35  SKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK 94

Query: 390 L-AERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
           +  E   L  +  P IV L+   Q+ + + +VL + +GGE + ++Q + R     +    
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
           A+L+  +  +H   + +RDLK EN+LLD   ++ + DFG        ND   T CG+P Y
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVN-EFHKNDLMRTSCGSPCY 213

Query: 509 LAPEILLGQG--YTKTVDWWTLGILLYEMMTGLPPYYD-------ENVPVMYKKILQQPL 559
            APE+++       +  D W+ G++LY M+ G  P+ D       E++  +Y+ I    L
Sbjct: 214 AAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSL 273

Query: 560 LFPDGFDPAAKDLLIGLLSRDPSRRLGV 587
            FP+   P  +DLL  +L  +P  RL V
Sbjct: 274 KFPEYIKPIPRDLLKRILVSNPEVRLTV 301

>Kwal_0.155
          Length = 587

 Score =  113 bits (283), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 142/306 (46%), Gaps = 58/306 (18%)

Query: 339 LSIDDFDLLKVIGKGSFGKVMQ-VRKKDTQKIYALKALRKAYI--VSKCEV--THTLAER 393
           L + D+ L+  IG+G+F KV + V ++ + K +  +A ++  +  +SK  +  TH  A+ 
Sbjct: 152 LELQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKS 211

Query: 394 TVLARVDCPFIVPLKFSFQSPEKL-------------YLVLAFINGGELFYHLQHEGRFS 440
              +R      V +  +  + E +             ++V   + GGE+F  +     FS
Sbjct: 212 KATSREQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFS 271

Query: 441 LARSRFYIAELLCALDSLHKLDVIYRDLKPENIL---LDYQ------------------- 478
              SR  I +L  A+  +H + +++RD+KPEN+L   +DY+                   
Sbjct: 272 EDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDE 331

Query: 479 ------------GHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWW 526
                       G + L DFGL K     N KT   CGT  Y APE++  + Y+  VD W
Sbjct: 332 GIFRPGIGGGGIGTVKLADFGLSKQIYSTNTKTP--CGTVGYTAPEVVKDERYSMQVDMW 389

Query: 527 TLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPS 582
            +G +LY ++ G PP+YDE + V+ +KI +    F     D     AK+ +  LL  DPS
Sbjct: 390 GIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRLLEVDPS 449

Query: 583 RRLGVN 588
           +R  ++
Sbjct: 450 KRYTID 455

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  112 bits (280), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 142/281 (50%), Gaps = 35/281 (12%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKK-DTQKIYALKALRKAYI---------VSKCEVTHTL 390
           I D +L   IG+GSFG V   R K D+  + A+K +              VS+  V H+ 
Sbjct: 11  IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSK 70

Query: 391 AER--TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
             +   VL  +DC             E L+++L   +GG+LF  ++ +       ++FY 
Sbjct: 71  CSKHANVLRVIDCNV---------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYF 121

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDND---KTDTFCG 504
            +L+ AL+ LH + V +RD+KPENILLD +G++ L DFGL  +   KD      TD   G
Sbjct: 122 QQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQR-G 180

Query: 505 TPEYLAPEILLGQGYTKTV-DWWTLGILLYEMMTG-----LPPYYDENVPVMYKKILQQP 558
           +P Y+APEIL  QGY   + D W+ G+LL+ ++TG     +P   D+N         +  
Sbjct: 181 SPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVS 240

Query: 559 LLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
           L   +  +    +LL  +L  DP +R+ +   +++R+HP+ 
Sbjct: 241 LGPWERVELRQMNLLRKILQPDPRKRVSL---EKLRHHPWL 278

>Kwal_14.1159
          Length = 1521

 Score =  114 bits (284), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 103/155 (66%), Gaps = 1/155 (0%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL-AR 398
           SI D+D++K I KG++G V   +++ T + +A+K L+K+ +++K +VT+  +ER ++  +
Sbjct: 673 SIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 732

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
            + P++  L  +FQ+   L+LV+ +++GG+L   ++  G       + YI+E++  ++ +
Sbjct: 733 SNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVEDM 792

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
           H+  +I+ DLKP+N+L+D +GH+ L DFGL ++ +
Sbjct: 793 HQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGL 827

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 9/122 (7%)

Query: 495  DNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
            ++ K   F GTP+YLAPE + G G T + DWW++G +L+E + G PP++   V  ++  I
Sbjct: 951  EDSKNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNI 1010

Query: 555  LQQPL---LFPDG------FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
            L   +    FPD         P A+DL+  LL  DP +RLG NG +EI  HP+F+D+ W+
Sbjct: 1011 LAGNIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWE 1070

Query: 606  KL 607
             L
Sbjct: 1071 NL 1072

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  113 bits (283), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 132/273 (48%), Gaps = 30/273 (10%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALR---KAYIVSKCEVTHTLAERTVL 396
           S+ D++ ++ +G GS GKV   + + T ++ A+K +    KA++  +  +     E+ VL
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 397 AR-----------------------VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHL 433
            R                       +  P I  L          Y++  +++GG+L  ++
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 434 QHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNM 493
              G     ++R +   +  AL  LH  ++++RDLK ENI++     I + DFGL   N+
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS--NI 293

Query: 494 KDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENVPVMY 551
            D+ K   TFCG+  + APE+L    YT   VD W+ G++L+ ++ G  P+ DEN  V++
Sbjct: 294 YDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLH 353

Query: 552 KKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRR 584
           +KI Q  + +P         LL  +L  DP RR
Sbjct: 354 EKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRR 386

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  113 bits (283), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 141/281 (50%), Gaps = 18/281 (6%)

Query: 334 SKNKPLS-IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA- 391
           S  KP S I  + L + +G GS GKV   + + T    A+K + K+   +    ++  + 
Sbjct: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69

Query: 392 -------ERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS 444
                  E  ++  +  P ++ L   +++   LYL+L +   GELF  L   G      +
Sbjct: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129

Query: 445 RFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCG 504
                +++  +   H L +++RDLKPEN+LLD   +I + DFG+  L   D D  +T CG
Sbjct: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT-DADLLETSCG 188

Query: 505 TPEYLAPEILLGQGYTK-TVDWWTLGILLYEMMTGLPPYYDENVPV--MYKKILQQPLLF 561
           +P Y APEI+ G  Y     D W+ G++L+ ++TG  P+ +EN  V  +  K+ +     
Sbjct: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248

Query: 562 PDGFDPA--AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           P+  + +  A+DL+  +L  DP +R+ +    +I +HP  K
Sbjct: 249 PNDTEISRDAQDLIGKILVVDPRQRIKIR---DILSHPLLK 286

>Scas_640.14*
          Length = 728

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 127/258 (49%), Gaps = 20/258 (7%)

Query: 349 VIGKGSFGKV---------MQVRKKDTQKIYALKALRKAYIVSKCEVTHTL-AERTVLAR 398
            +G+G FGKV            +  +  K  A+K +R+ +I    E    +  E   L  
Sbjct: 43  TLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKH 102

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSL 458
           +  P IV L+   Q+ + + +VL + +GGE + ++Q + R   A +    A+L+  +  +
Sbjct: 103 LTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYM 162

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQ 517
           H   +++RDLK EN+LLD   ++ + DFG       DN+   T CG+P Y APE+++  +
Sbjct: 163 HSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTE 222

Query: 518 GY-TKTVDWWTLGILLYEMMTGLPPYYD-------ENVPVMYKKILQQPLLFPD-GFDPA 568
            Y  +  D W+ GI+LY M+ G  P+ D       E++  +Y  I + PL FP   +   
Sbjct: 223 PYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTF 282

Query: 569 AKDLLIGLLSRDPSRRLG 586
               L  +L  +P RR+ 
Sbjct: 283 LGICLRHILVSNPVRRMS 300

>Kwal_55.21545
          Length = 865

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 120/245 (48%), Gaps = 7/245 (2%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV-DCP 402
           F   +VIG+G FG V +     T+++ A+K L      +  EV     E   L+ +   P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLN--LDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            I     S+ +  KL++++ +  GG L   L+  G+         + ELL AL  +HK  
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSLRTLLR-PGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYTK 521
           VI+RD+K  N+L+   GHI LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ--PLLFPDGFDPAAKDLLIGLLSR 579
            VD W+LGI  YE+ TG PPY +       + I +   P L       A K+++   L  
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDE 255

Query: 580 DPSRR 584
           DP  R
Sbjct: 256 DPKER 260

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 119/245 (48%), Gaps = 7/245 (2%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV-DCP 402
           F   ++IG+G FG V +     TQ++YA+K L      ++ EV     E   L+ +   P
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLN--LDNTEDEVEDIRKEIQFLSSLKQTP 73

Query: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462
            I     S+    KL++++ +  GG L   L+  G          + E+L AL S+H+ +
Sbjct: 74  NITHYYGSYLIDTKLWVIMEYCAGGSLRTLLR-PGIIEEKYIGVIMREILVALISIHRDN 132

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL-GQGYTK 521
           VI+RD+K  NIL+   G + LCDFG+     +   K  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ--PLLFPDGFDPAAKDLLIGLLSR 579
            VD W+LGI  YE+ TG PPY         + I +   P L    +    K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDE 252

Query: 580 DPSRR 584
           DP  R
Sbjct: 253 DPKER 257

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  111 bits (277), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 88/149 (59%), Gaps = 11/149 (7%)

Query: 491 LNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVM 550
           L++ + +++  F GTP+YLAPE + G G + T DWW++G + +E + G PP++   V  +
Sbjct: 52  LSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEV 111

Query: 551 YKKILQQPLL---FPDG------FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKD 601
           ++ I+   +    FPD         P AKDL+I LL  DP++RLG +G+ EI+ HP+FKD
Sbjct: 112 FENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKD 171

Query: 602 ISWKKLLLKGYIPPYKPIVKSEIDTANFD 630
           + W  +  +   P + P V+   DT  FD
Sbjct: 172 VDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score =  110 bits (275), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 106/226 (46%), Gaps = 40/226 (17%)

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
           CP+IV      ++    YL+   ++GGE+F  +      S   SR  I ++  A+  +H 
Sbjct: 240 CPYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHS 299

Query: 461 LDVIYRDLKPENIL---LDY-------------------------------QGHIALCDF 486
           L +++RD+KPEN+L   ++Y                                G + L DF
Sbjct: 300 LGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADF 359

Query: 487 GLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDEN 546
           GL K   + N KT   CGT  Y APE++  + Y+  VD W +G +LY M+ G PP+YDE 
Sbjct: 360 GLSKQIFQKNTKTP--CGTIGYTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDEK 417

Query: 547 VPVMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRLGVN 588
           + V+ +KI +    F     D   P AK  +  LL  DP +R  ++
Sbjct: 418 IDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKRYTID 463

>Kwal_56.23717
          Length = 858

 Score =  111 bits (277), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 118/230 (51%), Gaps = 10/230 (4%)

Query: 417 LYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLD 476
            Y++  +++GG+L  ++   G      +R +   +  AL  LH  ++++RDLK ENI++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 477 YQGHIALCDFGLCKLNMKDNDKT-DTFCGTPEYLAPEILLGQGYT-KTVDWWTLGILLYE 534
             G I + DFGL   NM +  K   TFCG+  + APE+L    YT   VD W+ G++L+ 
Sbjct: 68  TSGEIKIIDFGLS--NMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFV 125

Query: 535 MMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIR 594
           ++ G  P+ DEN  V+++KI Q  + +P         LL  +L  DP++R  +    ++ 
Sbjct: 126 LVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASLK---QVV 182

Query: 595 NHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVD 644
           NH + +           YIP   P+    +D A   +E  + + ID VV+
Sbjct: 183 NHQWMQ--RGYDFPAPSYIPHRVPLTADALD-ATVIKEMYRLEFIDDVVE 229

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  107 bits (268), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 115/216 (53%), Gaps = 7/216 (3%)

Query: 329 VDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTH 388
           V+  P++        + L +VIGKG++G V +   + T ++ A+KA+         E   
Sbjct: 4   VNVTPAQRHTGQRKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEEELHEHML 63

Query: 389 TLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYI 448
            +    +L  +    IV      QS  +LY++L +   G L   ++ E   S A+++ Y+
Sbjct: 64  EI---DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEA-LSEAKAKTYV 119

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEY 508
            + L  L  LH   VI+RD+K  N+LL   G + L DFG+   + + N+   T+ G+P +
Sbjct: 120 RQTLRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMTYAGSPNW 176

Query: 509 LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYD 544
           +APE++LG+G +   D W+LG  + E++TG PP+Y+
Sbjct: 177 MAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYN 212

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 127/259 (49%), Gaps = 10/259 (3%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           + L +VIG+G++G V +  K+ T K  A+K +       + E+   + E  +L  +    
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDV 463
           IV  +   Q   +LY++L +   G L   L+H G      +  Y+ + L  L  LH+  V
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLRDILKH-GPLLEDDTVNYVTQTLYGLQYLHEQGV 125

Query: 464 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTV 523
           I+RD+K  N+LL  +G + L DFG+   + + N    T+ G+P ++APE++ GQG +   
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 524 DWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSR 583
           D W+LG  + E++TG PP+++         I+ +  + P       KD L     ++  +
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAECKDFLSRCFQKNMFK 242

Query: 584 RLGVNGTDEIRNHPFFKDI 602
           R       E+  H + K I
Sbjct: 243 R---ATAQELLAHIWLKKI 258

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score =  107 bits (267), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 146/305 (47%), Gaps = 53/305 (17%)

Query: 334 SKNKPLSI--DDFDLLKVIGKGSFGKVMQVRKKDTQK-IYALKALRKAYIVSKCEVTHTL 390
           S  +P++I  + + + K IG+GSF  V +    D+     A+KA+ ++ + +K  + +  
Sbjct: 6   SGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLE 65

Query: 391 AERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHE----GRFSLARSRF 446
            E  +L ++  P IV L    ++    YL++ +   G+L + ++       +  L R+ F
Sbjct: 66  IEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLF 125

Query: 447 --------------------YIAELLCALDSLHKLDVIYRDLKPENILL-----DY---- 477
                               Y+ +L  AL  L   ++++RD+KP+N+LL     DY    
Sbjct: 126 EKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPA 185

Query: 478 ----QGHIAL--------CDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDW 525
               +G + +         DFG  +  + +    +T CG+P Y+APEIL  Q Y    D 
Sbjct: 186 EFHARGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADL 244

Query: 526 WTLGILLYEMMTGLPPYYDENVPVMYKKI--LQQPLLFPD--GFDPAAKDLLIGLLSRDP 581
           W++G +LYEM  G PP+   N   +++KI      + FP     + A  DL+ GLL+ +P
Sbjct: 245 WSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEP 304

Query: 582 SRRLG 586
           ++R+G
Sbjct: 305 AKRMG 309

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 127/267 (47%), Gaps = 21/267 (7%)

Query: 345 DLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFI 404
           DL+K IG+G+ G V      +++   A+K +    +  + +    L E  V+       I
Sbjct: 622 DLIK-IGQGASGGVYIAHDTESEDSVAIKQMN---LEKQPKKELILNEILVMRESKHSNI 677

Query: 405 VPLKFSFQSPEKLYLVLAFINGGELFYHLQH----EGRFSLARSRFYIAELLCALDSLHK 460
           V    S+ +   L++V+ ++ GG L   + H    EG+           E L  L  LH 
Sbjct: 678 VNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGAV-----CRETLKGLQFLHS 732

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             V++RD+K +NILL  +G+I L DFG C    ++N K  T  GTP ++APE++  + Y 
Sbjct: 733 KGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYG 792

Query: 521 KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ----PLLFPDGFDPAAKDLLIGL 576
             VD W+LGI++ EM+ G PPY +E  P+    ++       L  P+         L   
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPYLNE-TPLRALYLIATNGTPKLKEPEALSDTLTKFLDWC 851

Query: 577 LSRDPSRRLGVNGTDEIRNHPFFKDIS 603
           L  DPS R       E+ + PF  +I+
Sbjct: 852 LKVDPSERATAT---ELLDDPFITEIA 875

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 140/309 (45%), Gaps = 53/309 (17%)

Query: 330 DYKPSKNKPL--SIDDFDLLKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEV 386
           D+  S N  L  S  ++   K IGKGSF  V +     D  +  A+K + +A + +K  +
Sbjct: 8   DHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL 67

Query: 387 THTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFS----LA 442
            +   E  +L ++  P IV L    ++    YL++ +   G+L + L+          L 
Sbjct: 68  ENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 443 RSRF--------------------YIAELLCALDSLHKLDVIYRDLKPENILLD-----Y 477
           R+ F                    Y+ +L  AL  L   ++++RD+KP+N+LL      Y
Sbjct: 128 RTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 478 QGH----------------IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTK 521
                              + + DFG  +  + +    +T CG+P Y+APEIL  Q Y  
Sbjct: 188 HDSKSFHELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNA 246

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI--LQQPLLFPD--GFDPAAKDLLIGLL 577
             D W++G +++EM  G PP+   N   ++KKI      + FP     +P  K+L+  LL
Sbjct: 247 KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLL 306

Query: 578 SRDPSRRLG 586
           + DP++R+G
Sbjct: 307 TFDPAQRIG 315

>Scas_713.7
          Length = 983

 Score =  107 bits (267), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 126/253 (49%), Gaps = 10/253 (3%)

Query: 333 PSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAE 392
           P+KNK +    + L +VIGKGS+G V +   K T +I A+K +      +  E+   + E
Sbjct: 18  PNKNKSVQ---YQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTE 71

Query: 393 RTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQ-HEGRFSLARSRFYIAEL 451
             +L  ++   IV      Q    LY++L F + G L   L  ++       ++ YI + 
Sbjct: 72  IDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVYIRQT 131

Query: 452 LCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAP 511
           L  L  LH+  VI+RD+K  N+LLD    + L DFG+   + K ++   T  G+  +++P
Sbjct: 132 LNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMSP 188

Query: 512 EILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKD 571
           EI+  +G +   D W+LG  + E++TG PP+Y      +Y  I   P + P+     AKD
Sbjct: 189 EIIGNRGASTLSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAKD 248

Query: 572 LLIGLLSRDPSRR 584
            L     ++  +R
Sbjct: 249 FLKKCFQKNMYKR 261

>Kwal_23.6325
          Length = 1542

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 130/274 (47%), Gaps = 22/274 (8%)

Query: 348  KVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER-TVLARVDCPFIVP 406
            + +G G+FG V      DT +I A+K ++     S  +V   + E  +VL  ++ P +V 
Sbjct: 1253 QFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQ 1312

Query: 407  LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYR 466
                    +K+ L + +  GG L   L+H        ++ Y  ++L  L  LH+  V++R
Sbjct: 1313 YYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHR 1372

Query: 467  DLKPENILLDYQGHIALCDFGLCKLNMKDN------------DKTDTFCGTPEYLAPEIL 514
            D+KPENILLD+ G I   DFG  +    +             D  ++  GTP Y++PE +
Sbjct: 1373 DIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESI 1432

Query: 515  LG--QGYTKTVDWWTLGILLYEMMTGLPPYY--DENVPVMYKKILQQPLLFP--DGFDPA 568
             G  +G   + D W+LG ++ EM+TG  P++  D    +MY          P  +   P 
Sbjct: 1433 TGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSPQ 1492

Query: 569  AKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDI 602
              D L+  L +DP++R   +   E+  HP+  +I
Sbjct: 1493 GIDFLLRCLKQDPNKR---STAMELLLHPWMIEI 1523

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 118/254 (46%), Gaps = 19/254 (7%)

Query: 350  IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT-VLARVDCPFIVPLK 408
            IG GSFG V      DT  I A+K ++     S  ++  +L E   V+  ++ P IV   
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYY 1324

Query: 409  FSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDL 468
                  +K+ + + F  G  L   L+H        ++ Y  +LL  L  LH+  V++RD+
Sbjct: 1325 GVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDI 1384

Query: 469  KPENILLDYQGHIALCDFGLCKLNMKDNDKTDTF------------CGTPEYLAPEILLG 516
            KPENILLD  G I   DFG  KL  K+  K  +              GTP Y+APE + G
Sbjct: 1385 KPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVTG 1444

Query: 517  QGYTK--TVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQPLLFP--DGFDPAAK 570
            QG+ K  + D W+LG ++ EM+TG  P+   D    +MY         FP       A +
Sbjct: 1445 QGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFPTKSEISSAGR 1504

Query: 571  DLLIGLLSRDPSRR 584
              +   L +D ++R
Sbjct: 1505 KFISRCLIQDANKR 1518

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 118/241 (48%), Gaps = 6/241 (2%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           + L ++IG+GS+G V +   K T +  A+K +         E+   ++E  +L  ++   
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLLKNLNHIN 78

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDV 463
           IV      Q    LY++L +   G L   +      S   ++ Y+ + L  L+ LH+  V
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 464 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTV 523
           I+RD+K  NILLD +  + L DFG   ++ K N+   T  G+  ++APEI+  +G +   
Sbjct: 139 IHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLS 195

Query: 524 DWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSR 583
           D W+LG  + E++TG PP+++     +Y  I       P      AKD L    +++  +
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 584 R 584
           R
Sbjct: 256 R 256

>Scas_685.24
          Length = 515

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 133/266 (50%), Gaps = 13/266 (4%)

Query: 325 LNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKC 384
           L+I  +Y P  +K     ++ + + +G+G+FG V +   + T K+ A+K +       + 
Sbjct: 6   LSIRREYTPRISKA---HNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNERL 62

Query: 385 EVTHTLAERTV-LARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR 443
           EV   LA+    LA +  P+I+    +      +++V+ +  GG     L++     L  
Sbjct: 63  EV---LAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPE 119

Query: 444 SRF-YIA-ELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDT 501
            +  YI  E+L  L  LH+   I+RD+K  NILL  +GH+ L DFG+    +K   +  T
Sbjct: 120 KKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRGT 178

Query: 502 FCGTPEYLAPEILLG--QGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYKKILQQP 558
             GTP ++APE+     +GY + +D W+LGI ++E++ G+PP    + + V+     +  
Sbjct: 179 IVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSA 238

Query: 559 LLFPDGFDPAAKDLLIGLLSRDPSRR 584
                 +  AAK  +   L ++P+ R
Sbjct: 239 PRLQGAYSDAAKSFVALCLIKNPNER 264

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/315 (26%), Positives = 148/315 (46%), Gaps = 54/315 (17%)

Query: 339 LSIDDFDLLKVIGKGSFGKVMQ-VRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLA 397
           L  +++ + K IGKGSF  V + +  +D + I A+KA+ ++ + +K  + +   E  +L 
Sbjct: 16  LPTENYSVEKEIGKGSFAVVYKGLSLRDGRNI-AIKAVSRSKLKNKKLLENLEVEIAILK 74

Query: 398 RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEG----RFSLARSRF------- 446
           ++  P IV L    ++    YL++ +   G+L + ++       +  L ++ F       
Sbjct: 75  KIKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPS 134

Query: 447 -------------YIAELLCALDSLHKLDVIYRDLKPENI-----LLDYQ--------GH 480
                        Y+ +L  AL  L   ++++RD+KP+N+     LLDY         G 
Sbjct: 135 TEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGF 194

Query: 481 IA--------LCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILL 532
           +         + DFG  +  + +    +T CG+P Y+APEIL  Q Y    D W++G +L
Sbjct: 195 VGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVL 253

Query: 533 YEMMTGLPPYYDENVPVMYKKI--LQQPLLFPDG--FDPAAKDLLIGLLSRDPSRRLGVN 588
           YEM  G PP+   N   +++KI      +  P     +P   +L+ GLL+ DP  R+G  
Sbjct: 254 YEMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGF- 312

Query: 589 GTDEIRNHPFFKDIS 603
            TD   N    +D++
Sbjct: 313 -TDFFNNEVVTEDLT 326

>Scas_707.36
          Length = 915

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 152/333 (45%), Gaps = 63/333 (18%)

Query: 327 ITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL----RKAYIVS 382
           I++ Y P  +K   ++ ++++K +G G  GKV   +     ++ A+K +    +K Y   
Sbjct: 77  ISLSYDPV-SKTQILNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 383 --KCEVTHTLAERTVLARVDCPFIVPLKFSFQ--SPEKLYLVLAFINGGELFY----HLQ 434
             + +      E  ++ + +   +V L       S  K+YLVL +   G + +     L+
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 435 HEGR----FSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGL-- 488
            + R     S  R+R    +++  L+ LH   +I+RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSL 255

Query: 489 -CKLNMKDND---KTDTFCGTPEYLAPEILLGQGYTK-----------------TVDWWT 527
               N+  ND   +     GTP + APEI LG    +                  +D W 
Sbjct: 256 AANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWA 315

Query: 528 LGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA----------------AKD 571
           LGI LY ++ G+ P+  E    +++KI+ + L FP  F+                  AKD
Sbjct: 316 LGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP-TFETLQDNHISEISHIREFVHAKD 374

Query: 572 LLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           LL  LL ++P++R+ +    +I+ HPF   + W
Sbjct: 375 LLNKLLEKNPAKRISI---PDIKVHPF---VCW 401

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 101/213 (47%), Gaps = 41/213 (19%)

Query: 411 FQSPEKLYLVLA-FINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLK 469
           FQ  EK Y ++   + GGE+F  +     FS   SR  I +L  A+  +H+L +++RD+K
Sbjct: 211 FQESEKYYYIIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIK 270

Query: 470 PENILLD----------------------------------YQGHIALCDFGLCKLNMKD 495
           PEN+L +                                    G + L DFGL K   + 
Sbjct: 271 PENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIYQT 330

Query: 496 NDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL 555
           N KT   CGT  Y APE++  + Y+  VD W +G +LY ++ G PP++DE + V+ +KI 
Sbjct: 331 NTKTP--CGTVGYTAPEVVKDERYSMQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKIS 388

Query: 556 QQPLLFP----DGFDPAAKDLLIGLLSRDPSRR 584
           +    F     D     AK+ +  LL  DP++R
Sbjct: 389 RGEYTFLRPWWDQISDGAKNCVRKLLEVDPAKR 421

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 138/289 (47%), Gaps = 51/289 (17%)

Query: 348 KVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVP 406
           K IGKGSF  V +     D +   A+KA+ ++ + +K  + +   E  +L ++  P IV 
Sbjct: 15  KEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVG 74

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQH----EGRFSLARSRF---------------- 446
           L    ++    YLV+ +   G+L + ++     E    L ++ F                
Sbjct: 75  LIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRA 134

Query: 447 ----YIAELLCALDSLHKLDVIYRDLKPENILL-----DYQ--------GHIAL------ 483
               Y+ +L  AL  L   ++++RD+KP+N+LL     +Y+        G++ +      
Sbjct: 135 FVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPIL 194

Query: 484 --CDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPP 541
              DFG  +  +      +T CG+P Y+APEIL  Q Y    D W++G +L+EM  G+PP
Sbjct: 195 KIADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPP 253

Query: 542 YYDENVPVMYKKI--LQQPLLFPD--GFDPAAKDLLIGLLSRDPSRRLG 586
           +   N   ++KKI      + FP+    +   K+L+  LL+ DP++R+G
Sbjct: 254 FTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIG 302

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 16/251 (6%)

Query: 350  IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA-ERTVLARVDCPFIVPLK 408
            IG GSFG V      DT  I A+K ++     +  +V  ++  E TVL  ++ P +V   
Sbjct: 1197 IGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQYY 1256

Query: 409  FSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDL 468
                  +++ + + +  GG L   L H        ++ Y  ++L  L  LH+  V +RD+
Sbjct: 1257 GVEVHRDRVNIFMEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDI 1316

Query: 469  KPENILLDYQGHIALCDFGLC---------KLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
            KPENILLD+ G I   DFG           KLN++ + + +   GTP Y++PE + G GY
Sbjct: 1317 KPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTGY 1376

Query: 520  TK--TVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQPLLFP--DGFDPAAKDLL 573
             K  + D W+LG ++ EM+TG  P+   D    ++Y+    Q  +FP  +    A    L
Sbjct: 1377 GKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKFL 1436

Query: 574  IGLLSRDPSRR 584
               L +DP++R
Sbjct: 1437 SRCLIQDPNQR 1447

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score =  103 bits (256), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 89/312 (28%), Positives = 132/312 (42%), Gaps = 69/312 (22%)

Query: 344 FDLLKVIGKGSFGKVMQ-VRKKDTQKIY--------ALKALRKAYIVSKCEVT------- 387
           + LL  IG+G+F +V + V  KD    Y        A+K + K  + +    T       
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKR 150

Query: 388 ------------HTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLA-FINGGELFYHLQ 434
                         L E T+   V     +     FQ  E  Y ++   + GGE+F  + 
Sbjct: 151 EEAGENKATSREQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIV 210

Query: 435 HEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENIL---LDY-------------- 477
               FS   SR  I +L  A+  +H L +++RD+KPEN+L   +D+              
Sbjct: 211 RLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDP 270

Query: 478 -----------------QGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
                             G I L DFGL K     N  T T CGT  Y APE++  + Y+
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATN--TTTPCGTVGYTAPEVVKDERYS 328

Query: 521 KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--QQPLLFP--DGFDPAAKDLLIGL 576
             VD W +G +LY ++ G PP+YDE + V+ + I   Q   L P  D   P AK+ +  L
Sbjct: 329 MKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRL 388

Query: 577 LSRDPSRRLGVN 588
           L  DP +R  ++
Sbjct: 389 LEVDPDKRYDID 400

>Scas_675.2
          Length = 527

 Score =  102 bits (255), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 91/279 (32%), Positives = 140/279 (50%), Gaps = 30/279 (10%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           I D  L   IG+GSFG VM      D   I A+K +       K  +T     R VL   
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 400 DC---PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
            C   P ++ L     + + +++++   +GG+LF  ++ +       ++FY  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 457 SLHK-LDVIYRDLKPENILLDYQGHIALCDFGL-CKLNMKDND---KTDTFCGTPEYLAP 511
            LH+   V +RD+KPENILLD  G++ L DFGL  +   KD      TD   G+P Y+AP
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSSQYRRKDGTLRISTDQR-GSPPYMAP 189

Query: 512 EILLGQG-YTKTVDWWTLGILLYEMMTGLPPYYDENVPVM----YKKILQQPLLFPDGFD 566
           EIL  +G Y  + D W++GILL+ ++TG  P+    +PV+    +   LQ       G  
Sbjct: 190 EILHSRGYYAHSTDIWSIGILLFVLLTGETPW---ELPVIEELNFASFLQNNGNLNLG-- 244

Query: 567 PAAK------DLLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
           P AK      +LL  +L  DP +R  +     +R+HP+F
Sbjct: 245 PWAKIEFFHLNLLRKILQPDPKKRATLK---ILRSHPWF 280

>Kwal_26.8703
          Length = 444

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 115/230 (50%), Gaps = 11/230 (4%)

Query: 349 VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPL- 407
           V+G+G+ G V + + K    ++ALK +  A    + +    L E          +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQ-KQVLRELQFNRSCSSEYIVRYY 220

Query: 408 -KFSFQSPEKLYLVLAFINGGEL---FYHLQHEGRFSLARSRFYIAE-LLCALDSLHKLD 462
             F+ +S   +Y+ + ++ G  L   + HL   G     +    IAE +L  L  L +  
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKT 522
           +I+RD+KP+NILL+  G + LCDFG+  + +  N    TF GT  Y+APE + GQ Y+ T
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAV--NSLATTFTGTSFYMAPERIQGQPYSVT 338

Query: 523 VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDL 572
            D W+LG+ L E+  G  P+  +N+      I  + L+    F PA KD+
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNMAANMPPI--ELLMLILTFTPALKDI 386

>Kwal_26.7355
          Length = 1446

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 143/299 (47%), Gaps = 23/299 (7%)

Query: 334  SKNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTL- 390
            SKN      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E T ++ 
Sbjct: 1134 SKNSNGEYKEFAWIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVL 1193

Query: 391  ----AERTVLARVDCPFIVPLKFSFQSPEKLY-LVLAFINGGELFYHLQHEGRFSLARSR 445
                +E   L  +D   IV     F++   +Y L L ++ GG +   ++  G+F     R
Sbjct: 1194 EALRSEVATLKDLDHTNIVQY-LGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIR 1252

Query: 446  FYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTD-TFCG 504
            F   ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ K +      +D T  G
Sbjct: 1253 FLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRG 1312

Query: 505  TPEYLAPEIL-LGQGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYK--KILQQPLL 560
            T  ++APE++   QGY+  VD W+LG ++ EM  G  P+ + E V  M+K  K    P +
Sbjct: 1313 TVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPI 1372

Query: 561  FPDG---FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF---KDISWKKLLLKGYI 613
              D         K+ L      +P +R      DE+ +HPF    K+  +K+  L  +I
Sbjct: 1373 PEDTQKIISAEGKEFLDACFEINPEKRPTA---DELLSHPFCIVDKEFVFKETSLAKFI 1428

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 107/215 (49%), Gaps = 25/215 (11%)

Query: 342 DDFDLLKVIGKGSFGKV-MQVRKKDTQKIYALKAL------RKAYIVSKCEVTHTLAERT 394
           D F+    IG+G+ G V +   + D  +  A+K +      +K  IV++  V  +   + 
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQN 623

Query: 395 VLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELF----YHLQHEGRFSLARSRFYIAE 450
           ++  +D         S+ S   L++V+ ++ GG L     Y +  EG+           E
Sbjct: 624 IVNYID---------SYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGAV-----CRE 669

Query: 451 LLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLA 510
           +L  L+ LH   V++RD+K +N+LL   G I L DFG C        K  T  GTP ++A
Sbjct: 670 VLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMA 729

Query: 511 PEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545
           PEI+  + Y   VD W+LGI++ EM+ G PPY +E
Sbjct: 730 PEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 764

>Kwal_27.9763
          Length = 868

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 125/259 (48%), Gaps = 10/259 (3%)

Query: 329 VDYKPSKNKPLSIDD---FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCE 385
           V+  P++  P +  +   + L +V+GKG++G V +   + T K  A+K +          
Sbjct: 5   VNLTPAQKVPSTGSNTHHYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYDEEEEL-- 62

Query: 386 VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSR 445
             H L E  +L  +    IV      Q   +L+++L + + G L   L   G     + +
Sbjct: 63  NEHML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSL-RDLIKRGPVEEQQCK 120

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGT 505
            YI + L  L  LH   VI+RD+K  N+LLD Q  + L DFG+   + + N+   T+ G+
Sbjct: 121 TYIRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAMTYAGS 177

Query: 506 PEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGF 565
           P ++APE+++GQG +   D W+LG  + E++TG PP+++         I+    + P   
Sbjct: 178 PNWMAPEVMMGQGASTVSDIWSLGATVVEILTGNPPFHNLVNEAACYAIVHDVYIPPSTL 237

Query: 566 DPAAKDLLIGLLSRDPSRR 584
             + +  L     ++  +R
Sbjct: 238 SSSCRKFLRSCFQKNMFKR 256

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/342 (27%), Positives = 155/342 (45%), Gaps = 72/342 (21%)

Query: 327 ITVDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL-------RKA 378
           I++ Y P SK K L+   ++++K +G G  GKV   R   T+++ A+K +       RK 
Sbjct: 125 ISLTYDPVSKRKVLNT--YEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKF 182

Query: 379 YIV---SKCEVTHTLAERTVLARVDCPFIVPLKFSFQ--SPEKLYLVLAFINGGELFYH- 432
           +      K E      E  ++ +     +V L          K+YLVL + + GE+ +  
Sbjct: 183 FSFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCP 242

Query: 433 ---LQHEGR----FSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCD 485
              L+ E +     S   +R  +  ++  L+ LH   +I+RD+KP N+LL   G + + D
Sbjct: 243 PDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISD 302

Query: 486 FGL----CKLNMKDNDKT------DTFCGTPEYLAPEILLGQ-GYTK------------- 521
           FG+       N+  +D+T          GTP + APEI LG+  + K             
Sbjct: 303 FGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSC 362

Query: 522 ---TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFD------------ 566
               +D W LG+ LY ++ G+ P+       +++KI+  P+ FP   D            
Sbjct: 363 ISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQMTE 422

Query: 567 ----PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
                AAKDLL  LL ++P +R+ +   +EI+ HPF   + W
Sbjct: 423 EAEYEAAKDLLTRLLEKNPIKRINI---EEIKRHPF---VCW 458

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 107/211 (50%), Gaps = 25/211 (11%)

Query: 345 DLLKVIGKGSFGKVMQVRKKDTQKIYALKAL------RKAYIVSKCEVTHTLAERTVLAR 398
           +L+K IG+G+ G V    +  T    A+K +      +K  IV++  V        ++  
Sbjct: 700 NLIK-IGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNEILVMKGSKHNNIVNF 758

Query: 399 VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQH----EGRFSLARSRFYIAELLCA 454
           +D        + F+    L++V+ ++ GG L   + H    EG+   A SR    E L  
Sbjct: 759 IDS-------YLFRG--DLWVVMEYMEGGSLTDVVTHCILTEGQIG-AVSR----ETLKG 804

Query: 455 LDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL 514
           L  LH   VI+RD+K +NILL   G I L DFG C    + N K  T  GTP ++APE++
Sbjct: 805 LQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV 864

Query: 515 LGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545
             + Y   VD W+LGI++ EM+ G PPY +E
Sbjct: 865 SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 895

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 115/236 (48%), Gaps = 12/236 (5%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +  D L ++G+G+ G V + + ++  KI+ALK +  A I +         E         
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 402 PFIVPL--KFSFQSPEKLYLVLAFINGGEL---FYHLQHEGRFSLARSRFYIAE-LLCAL 455
            FIV     F+ +    +++ + ++ G  L   + HL  +G     +    IAE +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 456 DSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL 515
             LH+  +I+RD+KP+NIL +  G I LCDFG+    +  N    TF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAV--NSLATTFTGTSYYMAPERIQ 352

Query: 516 GQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKD 571
           GQ Y+ T D W+LG+ L E+  G  P+  + +      I  + L+    F P  KD
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPFDTDKLAANMPPI--ELLMLILTFTPELKD 406

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 111/235 (47%), Gaps = 32/235 (13%)

Query: 322 YGKLN-ITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL----- 375
           Y KLN I  D  PS         +  L  IG+G+ G V    +  T    A+K +     
Sbjct: 604 YAKLNEICSDGDPSTK-------YANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQ 656

Query: 376 -RKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQ 434
            +K  I++         E  V+     P IV    S+     L++++ ++ GG L   + 
Sbjct: 657 PKKELIIN---------EILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVT 707

Query: 435 H----EGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK 490
           H    EG+           E L  L+ LH   V++RD+K +NILL  +G I L DFG C 
Sbjct: 708 HCILTEGQIGAV-----CRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCA 762

Query: 491 LNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545
              + N K  T  GTP ++APE++  + Y   VD W+LGI++ EM+ G PPY +E
Sbjct: 763 QINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 817

>Kwal_26.7861
          Length = 955

 Score =  101 bits (251), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 115/239 (48%), Gaps = 32/239 (13%)

Query: 318 LERGYGKLN-ITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL- 375
           +++ Y KL  I  D  PSK        +  L  IG+G+ G V    +  T    A+K + 
Sbjct: 647 IQQLYSKLTEICTDGDPSKL-------YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMN 699

Query: 376 -----RKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELF 430
                +K  I+++  V        ++  +D         S+     L++V+ ++ GG L 
Sbjct: 700 LEKQPKKELIINEILVMKASKHANIVNFID---------SYLLRGDLWVVMEYMEGGSLT 750

Query: 431 YHLQH----EGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDF 486
             + H    EG+   A SR    E L  L  LH   VI+RD+K +N+LL   G I L DF
Sbjct: 751 DVVTHCILTEGQIG-AVSR----ETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDF 805

Query: 487 GLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545
           G C    + N K  T  GTP ++APE++  + Y   VD W+LGI++ EM+ G PPY +E
Sbjct: 806 GFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 864

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 104/206 (50%), Gaps = 24/206 (11%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKAL------RKAYIVSKCEVTHTLAERTVLARVDCPF 403
           IG+G+ G V    +  T    A+K +      +K  I+++  V        ++  +D   
Sbjct: 689 IGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELIINEILVMKGSRHNNIVNFID--- 745

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQH----EGRFSLARSRFYIAELLCALDSLH 459
                 S+     L++++ ++ GG L   + H    EG+ + A SR    E L  L  LH
Sbjct: 746 ------SYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIA-AVSR----ETLRGLHFLH 794

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
              VI+RD+K +NILL   G+I L DFG C    + N K  T  GTP ++APE++  + Y
Sbjct: 795 SKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEY 854

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDE 545
              VD W+LGI++ EM+ G PPY +E
Sbjct: 855 GPKVDIWSLGIMIIEMIEGEPPYLNE 880

>Scas_711.25
          Length = 1515

 Score =  101 bits (252), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 85/286 (29%), Positives = 134/286 (46%), Gaps = 20/286 (6%)

Query: 329  VDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCE- 385
            V    S+N      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E 
Sbjct: 1197 VSINKSRNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEA 1256

Query: 386  ----VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLY-LVLAFINGGELFYHLQHEGRFS 440
                V    +E + L  +D   IV     F++ + +Y L L ++ GG +   ++  GRF 
Sbjct: 1257 IISTVEALRSEVSTLKDLDHLNIVQY-LGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFD 1315

Query: 441  LARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTD 500
                R    ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ + +      +D
Sbjct: 1316 EPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKDIYSNSD 1375

Query: 501  -TFCGTPEYLAPEIL-LGQGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYK--KIL 555
             T  GT  ++APE++   QGY+  VD W+LG ++ EM  G  P+ + E V  M+K  K  
Sbjct: 1376 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSK 1435

Query: 556  QQPLLFPDGF---DPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPF 598
              P + PD         +D L      DP  R      D + +HPF
Sbjct: 1436 SAPPIPPDTLPLISQNGRDFLDACFEIDPDNRPTA---DNLLSHPF 1478

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 86/322 (26%), Positives = 141/322 (43%), Gaps = 67/322 (20%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQ----KIYALKALRKA----YIVSKCEVTHTLAE 392
           ++++ ++  IG+G+F +V +           K  A+K + K     + + K     TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 393 RTV---LARVDCPFIVPLKFSFQSPEKLY-LVLAFINGGELFYHLQHEGRFSLARSRFYI 448
             +   L + + P +V L   FQ  +K Y  +  +I GGE+F  +     FS   +R  I
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 449 AELLCALDSLHKLDVIYRDLKPENILLD----------YQG------------------- 479
            ++  A+  LH+ ++I+RD+KPEN++ +          YQ                    
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 480 -------HIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL---------LGQGYTKTV 523
                   + L DFGL +L         T CGT  YLAPE+L             Y+  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 524 DWWTLGILLYEMMTGLPPYYDENVP--VMYKKILQ--QPLLFP--DGFDPAAKDLLIGLL 577
           D W +G +LY M+ G PP+Y++      +  KI +     L P  D     A+DL+  LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 578 SRDPSRRLGVNGTDEIRNHPFF 599
             DP++R  +   D++  HP+ 
Sbjct: 363 QVDPAKRYDI---DQLLAHPWL 381

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 114/242 (47%), Gaps = 7/242 (2%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           + L +VIG+GS+G V +   K T ++ A+K   +    +  E+   +AE ++L  ++   
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIK---EVVYENDEELNDIMAEISLLKNLNHNN 81

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGR-FSLARSRFYIAELLCALDSLHKLD 462
           IV      +   +LY++L +   G L   +       S   S+ Y+ + L  L  LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 463 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKT 522
           VI+RD+K  NILL     + L DFG+  +    N    T  GT  ++APEIL  +G +  
Sbjct: 142 VIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEILGNRGASTL 198

Query: 523 VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPS 582
            D W+LG  + EM+T  PPY++     +Y  +       P  F    KD L     ++  
Sbjct: 199 SDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMY 258

Query: 583 RR 584
           +R
Sbjct: 259 KR 260

>Scas_618.15
          Length = 620

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/367 (25%), Positives = 147/367 (40%), Gaps = 77/367 (20%)

Query: 326 NITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRK----------KDTQKIYALKAL 375
           N T+ YK  +   L    + LL  IGKG+F  V +             K+     A+K +
Sbjct: 140 NSTITYKFKEQAELK--GYKLLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEVAIKII 197

Query: 376 RKAYIVSKC-----EVTHTLAERTVL--------ARVDCPFIVPLKFSFQSPEKLYLVLA 422
           +K  +         + +H  +   VL        A  +C  +V      ++    Y+V  
Sbjct: 198 KKVDLSEDLKDHERDTSHVSSREQVLKEACLHKVASSECSEVVGFIDFVETKSYYYIVQE 257

Query: 423 FINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHI- 481
           +++GGE++  +     FS   +R  I +L  A+  LH + +I+RD+KPEN+L +   HI 
Sbjct: 258 YLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQHIP 317

Query: 482 ---------------------------------ALCDFGLCKLNMKDNDKTDTFCGTPEY 508
                                             L DFGL K      + T+T CGT  Y
Sbjct: 318 STHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSK--QLSTETTNTPCGTISY 375

Query: 509 LAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP----DG 564
            APE++    Y   +D W +G +LY ++ G PP+Y +    + +KI      F     D 
Sbjct: 376 AAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLSPWWDE 435

Query: 565 FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPI---VK 621
               AK+ +  LL  D S+R  +   D++   P      W  +      PP K I     
Sbjct: 436 ISSGAKNCVKHLLEVDVSKRYNI---DDLLADP------WLNMNSSPVNPPIKSIFSHTN 486

Query: 622 SEIDTAN 628
             IDT+N
Sbjct: 487 DNIDTSN 493

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 133/280 (47%), Gaps = 22/280 (7%)

Query: 323 GKLNIT---VDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAY 379
           GKL+++   +D+    +  +++D+   ++ +G G++G V +V  K    + A+K +R   
Sbjct: 345 GKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNNVLMAMKEVRLEL 404

Query: 380 IVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGEL--FYHLQHE- 436
             SK      L E  VL + + PFIV    +F     +Y+ + +++GG L   Y    E 
Sbjct: 405 DESK--FRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDENPEM 462

Query: 437 GRFSLARSRFYIAELLCALDSLHKL-DVIYRDLKPENILLDY-QGHIALCDFGLCKLNMK 494
           G     +  F    ++  L  L ++ +VI+RD+KP NIL    QG + LCDFG+    + 
Sbjct: 463 GGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTVKLCDFGVSGNLVA 522

Query: 495 DNDKTDTFCGTPEYLAPEILLGQG-----YTKTVDWWTLGILLYEMMTGLPPYYDENVPV 549
              KT+  C +  Y+APE +         YT   D W+LG+ + EM  G  PY  E    
Sbjct: 523 SLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMALGRYPYPPETFDN 580

Query: 550 MYKKILQ-----QPLLFPDGFDPAAKDLLIGLLSRDPSRR 584
           ++ ++        P L  D F   A+D +   L + P RR
Sbjct: 581 IFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRR 620

>Scas_668.22
          Length = 893

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 115/249 (46%), Gaps = 29/249 (11%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKAL------RKAYIVSKCEVTHTLAERTVLARVDCPF 403
           IG+G+ G V    +  + +  A+K +      +K  I++         E  V+     P 
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELIIN---------EILVMKGSRHPN 667

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQH----EGRFSLARSRFYIAELLCALDSLH 459
           IV    S+     L++++ ++ GG L   + H    EG+           E L  L  LH
Sbjct: 668 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAV-----CRETLSGLQFLH 722

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
              V++RD+K +NILL   G I L DFG C    + N K  T  GTP ++APE++  + Y
Sbjct: 723 SKGVLHRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEY 782

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ----PLLFPDGFDPAAKDLLIG 575
              VD W+LGI++ EM+ G PPY +E  P+    ++       L  P+      ++ L  
Sbjct: 783 GPKVDIWSLGIMIIEMIEGEPPYLNE-TPLRALYLIATNGTPELKEPENLSAVLRNFLDW 841

Query: 576 LLSRDPSRR 584
            L  DP +R
Sbjct: 842 CLKVDPEQR 850

>Kwal_47.17263
          Length = 1127

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/350 (25%), Positives = 152/350 (43%), Gaps = 93/350 (26%)

Query: 327 ITVDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL---------- 375
           I+++Y P SK K L+   ++++  +G+G  GKV   R   T+++ A+K +          
Sbjct: 89  ISLEYDPISKRKVLNT--YEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRF 146

Query: 376 -------------RKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLA 422
                        R+  I+ KC   H +    VL                +  K+YLVL 
Sbjct: 147 SFKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDD-------------STSRKIYLVLE 193

Query: 423 FINGGELFY----HLQHEGR----FSLARSRFYIAELLCALDSLHKLDVIYRDLKPENIL 474
           + + GE+ +     L+ E R     +  R+R     ++  L+ LH   +I+RD+KP N+L
Sbjct: 194 YCSKGEVKWCPGDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLL 253

Query: 475 LDYQGHIALCDFGLCKLNMK--------DNDKTDTFCGTPEYLAPEILLGQGYTK----- 521
           +   G + + DFG+     K        D  +     GTP + APEI LG   ++     
Sbjct: 254 ISESGTVKISDFGVSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPD 313

Query: 522 ------------TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLF-------P 562
                        +D W +G+ L+ ++ G+ P++ E    ++ KI+ Q L+         
Sbjct: 314 RPSSDHGSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMAS 373

Query: 563 DGFD--------PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           +G           AAKDLL  LL+++P +R+ +    EI+ HPF   + W
Sbjct: 374 NGISKISNQEEYEAAKDLLGRLLTKNPFKRIKIA---EIKKHPF---VCW 417

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 103/202 (50%), Gaps = 7/202 (3%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           F +   IG+G+FG V + +     ++ A+K +      S+ EV     E   LA +  P+
Sbjct: 5   FVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLEN--SEEEVELLAQEIFFLAELKSPY 62

Query: 404 IVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLA--RSRFYIAELLCALDSLHKL 461
           +     +      +++ + +  GG +   L++     L   ++RF   E+L  L  LH  
Sbjct: 63  VTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQ 122

Query: 462 DVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILL--GQGY 519
             I+RD+K  NILL  +G + L DFG+    +  + + DTF GTP ++APEI+    +GY
Sbjct: 123 RKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAPEIVAHDSEGY 181

Query: 520 TKTVDWWTLGILLYEMMTGLPP 541
            +  D W+LGI + EM+ G PP
Sbjct: 182 DERADIWSLGITVIEMLRGSPP 203

>Scas_720.94
          Length = 1683

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 120/268 (44%), Gaps = 33/268 (12%)

Query: 350  IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER-TVLARVDCPFIVPLK 408
            IG G+FG V      D  +I A+K ++     +  ++   + E  TVL  ++ P IV   
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQYY 1426

Query: 409  FSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDL 468
                  +K+ + + +  GG +   L+H        ++ Y  ELL  L  LH+  V++RD+
Sbjct: 1427 GVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDI 1486

Query: 469  KPENILLDYQGHIALCDFGLCKLNMKDNDKTDT-------------------------FC 503
            KPENILLD+ G I   DFG  +   K+  K                              
Sbjct: 1487 KPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDML 1546

Query: 504  GTPEYLAPEILLG-QGYTK--TVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQP 558
            GTP Y+APE + G +  TK  + D W+ G ++ EM+TG  P+   D    ++Y     Q 
Sbjct: 1547 GTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIYHVAAGQT 1606

Query: 559  --LLFPDGFDPAAKDLLIGLLSRDPSRR 584
              L +P+   PA +  L   L +DP +R
Sbjct: 1607 PQLPYPNEVSPAGRRFLQRCLVQDPIKR 1634

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 108/218 (49%), Gaps = 15/218 (6%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           D  + L V+G+G+ G V + + +   KI+ALK +       + +      E         
Sbjct: 234 DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTITTLTTDQESQ-KQIFRELQFNKSCKS 292

Query: 402 PFIVPLKFSFQSPE--KLYLVLAFINGGEL---FYHL-QHEGRFSLARSRFYIAE-LLCA 454
            +IV     F   E   +Y+ + ++ G  L   + HL +H GR    +    IAE +L  
Sbjct: 293 DYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVG-EKVLGKIAESVLRG 351

Query: 455 LDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL 514
           L  LH+  +I+RD+KP+NILL+  G + LCDFG+    +  N    TF GT  Y+APE +
Sbjct: 352 LSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAV--NSLATTFTGTSYYMAPERI 409

Query: 515 LGQGYTKTVDWWTLGILLYEMMTGLPPY----YDENVP 548
            GQ Y+ T D W+LG+ L E+     P+    +  N+P
Sbjct: 410 QGQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKFAANMP 447

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 134/292 (45%), Gaps = 20/292 (6%)

Query: 328  TVDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCE 385
            T+    S+N      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E
Sbjct: 1020 TISINKSRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDE 1079

Query: 386  VTHTLAER-----TVLARVDCPFIVPLKFSFQSPEKLY-LVLAFINGGELFYHLQHEGRF 439
               ++ E      + L  ++   IV     F+    +Y L L ++ GG +   ++  GRF
Sbjct: 1080 SAISMVEALKSEVSTLKDLNHVNIVQY-LGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRF 1138

Query: 440  SLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT 499
                 R    ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ + +      +
Sbjct: 1139 DDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNS 1198

Query: 500  D-TFCGTPEYLAPEIL-LGQGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYK--KI 554
            D T  GT  ++APE++    GY+  VD W+LG ++ EM  G  P+ + E V  M++  K 
Sbjct: 1199 DMTMRGTVFWMAPEMVDTAHGYSAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKS 1258

Query: 555  LQQPLLFPDGFD---PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDIS 603
               P +  D  D   PA +  L      DP  R      D +  HPF K  S
Sbjct: 1259 KTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMRPTA---DSLVGHPFCKTSS 1307

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 108/225 (48%), Gaps = 29/225 (12%)

Query: 348 KVIGKGSFGKVMQVRKKD--TQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIV 405
           +++G G+FG V+   K D   ++  A K +  A  V     T  + E T+L +++ P I+
Sbjct: 143 RIVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNII 202

Query: 406 PLKFS-FQSPEKLYLVLAFINGGELFYHLQHEGRF---SLARSRFYIAELLCALDSLHKL 461
            +  S   +   +Y+    I+GG+LF +L         S   S   I ++L AL  LH  
Sbjct: 203 RIHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSN 262

Query: 462 DVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDNDKTDTFCGTPEYLAPEILL-- 515
            +++RDLK +NILL   +    + L DFG+ K L+    ++  T  GTPEY APE+    
Sbjct: 263 GIVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKA 322

Query: 516 -----------------GQGYTKTVDWWTLGILLYEMMTGLPPYY 543
                              GY    D W+LG++ + M+TG+ P+Y
Sbjct: 323 DRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFY 367

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 139/283 (49%), Gaps = 36/283 (12%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAE---RTVL 396
           I + +L + IG+G+F  V     + D Q I A+K +     V +C+      E   R V+
Sbjct: 12  IKELELGETIGQGTFAFVKTASLRADPQTIVAVKFVH----VERCKARGMTDEDLTREVV 67

Query: 397 ARVDCP---FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLC 453
            +  C     +V +     S E L++ +   +GG+LF  ++ +       +RFY  +L+ 
Sbjct: 68  LQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQQLVR 127

Query: 454 ALDSLHK-LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD-------NDKTDTFCGT 505
           AL  LH+   V +RD+KPEN+LLD  G++ + DFGL     +         D+     GT
Sbjct: 128 ALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLARDRR----GT 183

Query: 506 PEYLAPEILLGQGY-TKTVDWWTLGILLYEMMTGLPPYYDENV-PVMYKKILQQPLLFPD 563
             YLAPE++  + Y   T D W+ G+L++ ++TG  P+ + +V   M++  +       D
Sbjct: 184 LPYLAPEVVGERAYHADTADIWSAGVLVFVLLTGETPWSEPSVDDGMFRAFVADGGNLSD 243

Query: 564 GFDPAAK------DLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
           G  P  K      +LL  +L + P+ R  +    ++R HP+FK
Sbjct: 244 G--PWGKIGLVELNLLRKMLQQRPAARATLA---QLRQHPWFK 281

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 157/367 (42%), Gaps = 81/367 (22%)

Query: 336 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVT-HTLAER 393
           N+  ++D  F L+K IG GS+G V   R  +      +   +   + SK  +   +L E 
Sbjct: 16  NQDFTVDKRFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLREL 75

Query: 394 TVL------ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS--- 444
            +L        + C + + + F    P+ ++      NG  L+  L       + +S   
Sbjct: 76  KLLRHFRGHKNITCLYDMDIVFQ---PDGMF------NGLYLYEELMECDMHQIVKSGQP 126

Query: 445 ------RFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLN----MK 494
                 + +I ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +      ++
Sbjct: 127 LTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVE 186

Query: 495 DNDKTDTFCGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK 553
           +N     +  T  Y APEI+L  QGYTK +D W+ G +L E++ G P +  ++      +
Sbjct: 187 NNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNR 246

Query: 554 ILQQ--------------------------------PLLFPDGFDPAAKDLLIGLLSRDP 581
           ILQ                                   L+P+  +P A +LL G+LS DP
Sbjct: 247 ILQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNA-NPDALNLLEGMLSFDP 305

Query: 582 SRRLGVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQ----EFTKEK 637
             R+ V   D+   HP+     W         P  +PI   + D + F+     E  K+ 
Sbjct: 306 QLRITV---DDALQHPYLS--IWHD-------PADEPICTEKFDFS-FESVNEIEQLKQM 352

Query: 638 PIDSVVD 644
            ID V D
Sbjct: 353 VIDEVTD 359

>Kwal_33.14081
          Length = 580

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 143/308 (46%), Gaps = 24/308 (7%)

Query: 323 GKLNIT---VDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAY 379
           GKL+++   VD+    +  +++D+ + L+ +G G++G V +V  K T  I A+K +R   
Sbjct: 250 GKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPTNVIMAMKEVRLEL 309

Query: 380 IVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGEL--FYHLQHEG 437
             SK   T  L E  VL +   P+IV    +F     +Y+ + +++GG L   Y     G
Sbjct: 310 DESK--FTQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKSYDSDVLG 367

Query: 438 RFSLARSRFYIAELLCALDSLHKL-DVIYRDLKPENILLD-YQGHIALCDFGLCKLNMKD 495
                   +    ++  L  L  + ++I+RD+KP N+L    QG + LCDFG+    +  
Sbjct: 368 GIDEPELAYIANAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQGTVKLCDFGVSGNLVAS 427

Query: 496 NDKTDTFCGTPEYLAPEILLG-----QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVM 550
             KT+  C +  Y+APE +         YT   D W+LG+ + EM  G  PY  E    +
Sbjct: 428 LAKTNIGCQS--YMAPERIKSFNPDKATYTVQSDIWSLGLSILEMAIGTYPYPVETFDNI 485

Query: 551 YKKIL----QQPLLFPDG-FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
           + ++       P   P G F P A+D +   L + P RR       E   HP+ K     
Sbjct: 486 FSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQKIPERRRNYAALLE---HPWLKTHHLS 542

Query: 606 KLLLKGYI 613
           ++ +  YI
Sbjct: 543 EVNMSEYI 550

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 143/309 (46%), Gaps = 49/309 (15%)

Query: 336 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVT-HTLAER 393
           N+  +ID  F+L+K IG G++G V   R  +  +   +   +   I SK  +   +L E 
Sbjct: 12  NQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLREL 71

Query: 394 TVL------ARVDCPFIVPLKFSFQ-SPEKLYLVLAFINGGELFYHLQHEGRFSLARSRF 446
            +L        + C + + + F    S   LYL    +   ++   ++     + A  + 
Sbjct: 72  KLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMEC-DMHQIIKSGQALTDAHYQS 130

Query: 447 YIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK---LNMKDNDKTDT-F 502
           +  ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +    N ++N++  T +
Sbjct: 131 FTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEY 190

Query: 503 CGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ----- 556
             T  Y APEI+L  QGYTK +D W+ G +L E + G P +  ++      +ILQ     
Sbjct: 191 VATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTP 250

Query: 557 -----------------------QPLLFPDGFDPA---AKDLLIGLLSRDPSRRLGVNGT 590
                                  Q + F + F  A   A DLL G+L+ DP +R+ V   
Sbjct: 251 PDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKRITV--- 307

Query: 591 DEIRNHPFF 599
           D+   HP+ 
Sbjct: 308 DKALEHPYL 316

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 95.5 bits (236), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 131/289 (45%), Gaps = 20/289 (6%)

Query: 328  TVDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCE 385
            T++   SKN      +F  +K  +IGKGSFG V       T ++ A+K +      ++ E
Sbjct: 1133 TIEINKSKNARGEYKEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNE 1192

Query: 386  VTHTLAER-----TVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFS 440
            +   + E        L  +D   IV    S        L L ++ GG +   ++  GRF 
Sbjct: 1193 LVKDMVEALKSEVATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFD 1252

Query: 441  LARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTD 500
                R    ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ K +      +D
Sbjct: 1253 EKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSD 1312

Query: 501  -TFCGTPEYLAPEIL-LGQGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYK--KIL 555
             T  GT  ++APE++   QGY+  VD W+LG ++ EM  G  P+ + E V  M++  K  
Sbjct: 1313 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 556  QQPLLFPDG----FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
              P + PD          KD L      DP +R      D++  H F K
Sbjct: 1373 SAPPI-PDDTIQLISSKGKDFLSKCFEIDPEKRPTA---DDLLEHSFSK 1417

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 79/146 (54%), Gaps = 7/146 (4%)

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQH-------EGRFSLARSRFYIAELLCALDSLH 459
           L+   ++ + L++V+ ++ GG L   +++       E   +  +  + + E    L  LH
Sbjct: 577 LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH 636

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
              +I+RD+K +N+LLD  G + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 637 DKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 696

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDE 545
            + VD W+LGI+  EM+ G PPY +E
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPYLNE 722

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 79/147 (53%), Gaps = 7/147 (4%)

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRF------YIAELLC-ALDSLH 459
           L+   ++ + L++V+ ++ GG L   +++      A S        YI    C  L  LH
Sbjct: 645 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH 704

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
             ++I+RD+K +N+LLD +  + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 705 DKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEY 764

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDEN 546
              VD W+LGI+  EM+ G PPY +E+
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNED 791

>Scas_582.1
          Length = 638

 Score = 94.4 bits (233), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 136/297 (45%), Gaps = 29/297 (9%)

Query: 323 GKLNIT---VDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAY 379
           GKL+++   +D+    +  +++ + + ++ +G G++G V +V  K T  I A+K ++   
Sbjct: 306 GKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPTNVIMAMKEVK--L 363

Query: 380 IVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGEL--FYHLQHE- 436
            + + +    L E  VL +   P+IV    +F     +Y+ + +++GG L   Y    E 
Sbjct: 364 ELDEAKFRQILMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDQDPEI 423

Query: 437 ---GRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDY-QGHIALCDFGLCKLN 492
                  LA     +   L  L  +H   +I+RD+KP NIL    QG I LCDFG+    
Sbjct: 424 GGIDEPQLAVIATAVIRGLKVLKDVH--HIIHRDVKPTNILCSAKQGTIKLCDFGVSGNL 481

Query: 493 MKDNDKTDTFCGTPEYLAPEILLG-----QGYTKTVDWWTLGILLYEMMTGLPPYYDENV 547
           +    KT+  C +  Y+APE +         YT   D W+LG+ + EM  G  PY  E  
Sbjct: 482 VASMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMALGRYPYPPETF 539

Query: 548 PVMYKKILQ----QPLLFPDG-FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
             ++ ++       P   P G F   A+D +   L + P RRL      E   HP+ 
Sbjct: 540 DNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRLNYTALLE---HPWL 593

>Scas_688.14
          Length = 479

 Score = 93.2 bits (230), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 137/313 (43%), Gaps = 57/313 (18%)

Query: 336 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSK---CE------ 385
           N+  ++D  F L+K IG G++G V   R  +  +   +   +   + SK   C+      
Sbjct: 14  NQDFTVDKRFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLREL 73

Query: 386 --VTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR 443
             + H    + +    D   +     +F     LYL    +   ++   ++     + A 
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFYPDGTFNG---LYLYEELMEC-DMHQIIKSSQPLTDAH 129

Query: 444 SRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLN----MKDNDKT 499
            + +I ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +      +++N   
Sbjct: 130 YQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFL 189

Query: 500 DTFCGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ- 557
             +  T  Y APEI+L  QGYTK +D W+ G +L E + G P +  ++      +ILQ  
Sbjct: 190 TEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVL 249

Query: 558 -----------------------------PL--LFPDGFDPAAKDLLIGLLSRDPSRRLG 586
                                        P   L+PD  +P A DLL  +L+ DP +R+ 
Sbjct: 250 GTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDA-NPQALDLLEKMLAFDPQKRI- 307

Query: 587 VNGTDEIRNHPFF 599
              TDE   HP+ 
Sbjct: 308 --TTDEALEHPYL 318

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 94.4 bits (233), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 79/146 (54%), Gaps = 7/146 (4%)

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRF------YIAELLC-ALDSLH 459
           L+   ++ + L++V+ ++ GG L   +++    S  +S        YI    C  L  LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
              +I+RD+K +N+LLD +G + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDE 545
            + VD W+LGI+  EM+   PPY +E
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNE 808

>CAGL0I04422g 394159..395427 some similarities with sp|P22209
           Saccharomyces cerevisiae YAR018c KIN3 ser/thr protein
           kinase, hypothetical start
          Length = 422

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 129/287 (44%), Gaps = 69/287 (24%)

Query: 335 KNKP--LSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAE 392
           KN+P   +  D+ ++K IG+GSFG V +V    TQ++   K ++  ++ SK E    +AE
Sbjct: 3   KNQPQHYARSDYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKDIKYGHMNSK-ERQQLIAE 61

Query: 393 RTVLARVDCPFIVPLKFSF---QSPEKLYLVLAFINGGEL---FYHLQHEGRFSLARSRF 446
            T+L+++    IV   +S+   +  E LYL + + + G+L     H + E ++   +  +
Sbjct: 62  CTILSQLKHENIVEF-YSWDFNEQQEVLYLYMEYCSRGDLSGMIKHYKQEHKYIPEKVVW 120

Query: 447 YI-AELLCALDSLHKLD---------------------VIYRDLKPENILLDY------- 477
            I A++L AL   H  +                     VI+RDLKP NI L Y       
Sbjct: 121 GILAQMLTALYKCHYGEELPSLTTIYDRMKPPSKGRNIVIHRDLKPGNIFLSYDDNSSDS 180

Query: 478 ------------------------------QGHIALCDFGLCKLNMKDNDKTDTFCGTPE 507
                                         Q  + + DFGL K      D   T+ GTP 
Sbjct: 181 TDKADIAQSNWYRKPNNRGGDESKLTTDYSQVVVKVGDFGLAKSLATSVDFATTYVGTPY 240

Query: 508 YLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
           Y++PE+L+ Q Y+   D W+LG ++YEM +  PP+  +N   +  KI
Sbjct: 241 YMSPEVLMDQPYSPLSDIWSLGCVIYEMCSLHPPFLAKNYLELQTKI 287

>Scas_640.16
          Length = 505

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 140/320 (43%), Gaps = 47/320 (14%)

Query: 333 PSKNKPLSIDDFDL-------------------LKVIGKGSFGKVMQVRKKDTQKIYALK 373
           P K++PLS++  D+                   L V+G+G+ G V + + K  +K++ALK
Sbjct: 180 PLKDEPLSLEGKDIDQLDCEMWEKADMKEKIVSLGVLGEGAGGSVEKCKLKHGKKVFALK 239

Query: 374 ALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQ--SPEKLYLVLAFINGG--EL 429
            +       + +      E          +IV     F   +   +Y+ + ++ G   E 
Sbjct: 240 IVNTLNTDPEFQ-KQIFRELQFNKSFKSDYIVRYYGMFNDVNSSSIYIAMEYMGGKSLEA 298

Query: 430 FYH--LQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFG 487
            Y   L   GR S          +L  L  LH+  VI+RD+KP+NIL + +G + LCDFG
Sbjct: 299 VYKNLLSRGGRISEKVLGKISESVLRGLSYLHEQKVIHRDIKPQNILFNEKGQVKLCDFG 358

Query: 488 LCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENV 547
           +    +  N    TF GT  Y+APE + GQ Y+ T D W+LG+ + E+  G  P+  + +
Sbjct: 359 VSGEAV--NSLATTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTILEVAQGRFPFGSDKI 416

Query: 548 PVMYKKILQQPLLFPDGFDPAAKD--------------LLIGLLSRDPSRRLGVNGTDEI 593
                 I  + L+    F+P  KD               +   L +DP  R       ++
Sbjct: 417 TATIAPI--ELLVLILTFNPELKDEPELNITWSKAFKSFIHFCLKKDPHER---PSPRQM 471

Query: 594 RNHPFFKDISWKKLLLKGYI 613
            +HP+ +    KK+ ++ +I
Sbjct: 472 IDHPWIQGQMKKKVNMENFI 491

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 131/290 (45%), Gaps = 50/290 (17%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVR-KKDTQKIYALK----------------ALRKAYIVSK 383
           ID   L + IGKGSF  V +   + D   + A+K                 LR+  + S+
Sbjct: 12  IDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDVLREVKLHSR 71

Query: 384 CEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLAR 443
           C          VL  +DC    P          L++ +    GG+LF  ++ +       
Sbjct: 72  CS-----NFVNVLKVIDCNLSDPF---------LWIAMELAEGGDLFDKIEPDIGVDSEV 117

Query: 444 SRFYIAELLCALDSLH-KLDVIYRDLKPENILLDYQGHIALCDFGLCKL-NMKDNDK--T 499
           ++FY  +L+ A+  LH    V +RD+KPENILLD  G++ L DFGL  L   KD  K  +
Sbjct: 118 AQFYYKQLIKAISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASLFKRKDGSKRIS 177

Query: 500 DTFCGTPEYLAPEILLGQG-YTKTVDWWTLGILLYEMMTGLPPYY-----DENVPVMYK- 552
               G+  Y+APEI+   G Y    D W++G+LL+ ++TG  P+      DE      K 
Sbjct: 178 RDQRGSLPYMAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPWELPHEDDETFRNFIKG 237

Query: 553 --KILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
             K+ Q   L     D    +LL  +L  DP +R  +   D +R H +++
Sbjct: 238 EGKLDQGSWL---KIDFVELNLLRKILQPDPEKRASL---DTLRKHTWYQ 281

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 93.2 bits (230), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 115/259 (44%), Gaps = 24/259 (9%)

Query: 350  IGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER-TVLARVDCPFIVPLK 408
            IG G+FG+V      +  +I A+K ++     +  ++   + E  TVL  ++ P IV   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYY 1099

Query: 409  FSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDL 468
                  +K+ + + +  GG L   L H        ++ Y  ELL  L  LH+  V++RD+
Sbjct: 1100 GVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDI 1159

Query: 469  KPENILLDYQGHIALCDFGLCKLNMKDNDKT----------------DTFCGTPEYLAPE 512
            KPENILLD+ G I   DFG  +  +    +T                +   GTP Y+APE
Sbjct: 1160 KPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPE 1219

Query: 513  ILLG---QGYTKTVDWWTLGILLYEMMTGLPPY--YDENVPVMYKKILQQPLLFP--DGF 565
             + G   +G     D W LG ++ EM TG  P+   D    +MY     +    P  D  
Sbjct: 1220 TISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNRDEM 1279

Query: 566  DPAAKDLLIGLLSRDPSRR 584
              A +  L   L +DP+ R
Sbjct: 1280 TAAGRAFLERCLVQDPTMR 1298

>Kwal_23.5290
          Length = 819

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 79/147 (53%), Gaps = 7/147 (4%)

Query: 407 LKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRF------YIAELLC-ALDSLH 459
           L+   ++ + L++V+ ++ GG L   +++      + S        YI    C  L  LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
              +I+RD+K +N+LLD +  + + DFG C        K  T  GTP ++APE++  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDEN 546
            + VD W+LGI+  EM+ G PPY +E+
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNED 749

>Kwal_23.5576
          Length = 504

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 141/310 (45%), Gaps = 51/310 (16%)

Query: 336 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVT-HTLAER 393
           N+  ++D  F L+K IG G++G V   R  +  +   +   +   + SK  +   +L E 
Sbjct: 14  NQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSLREL 73

Query: 394 TVL------ARVDCPFIVPLKFSFQSP-EKLYLVLAFINGGELFYHLQHEGR-FSLARSR 445
            +L        + C + + + FS  +    LYL    +      + +   G+  + A  +
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECD--IHQIIKSGQPLTDAHYQ 131

Query: 446 FYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLN----MKDNDKTDT 501
            +I +LLCAL  +H  DV++RDLKP N+L++    + +CDFGL +      +++N     
Sbjct: 132 SFIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLTE 191

Query: 502 FCGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ---- 556
           +  T  Y APEI+L  QGYTK +D W+ G +L E++ G P +  ++      +ILQ    
Sbjct: 192 YVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGT 251

Query: 557 --------------QPLLFPDGFDP-------------AAKDLLIGLLSRDPSRRLGVNG 589
                         Q  +   G+ P              A DLL  +L+ DP +R+ V  
Sbjct: 252 PPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPQANVQALDLLEKMLTFDPQKRITV-- 309

Query: 590 TDEIRNHPFF 599
            +E   HP+ 
Sbjct: 310 -EEALEHPYL 318

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 109/213 (51%), Gaps = 13/213 (6%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           I D  L   +G+G+F  V     + D   I A+K +       K  ++     + V+ + 
Sbjct: 12  IKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIH-VPTCKKMGLSDKDITKEVVLQS 70

Query: 400 DC---PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALD 456
            C   P ++ L     S E ++++L   +GG+LF  ++ +       ++FY  +L+ A++
Sbjct: 71  KCSKHPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAIN 130

Query: 457 SLH-KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFC----GTPEYLAP 511
            LH +  V +RD+KPENILLD  G++ L DFGL     +  D T        G+P Y+AP
Sbjct: 131 YLHVECGVAHRDIKPENILLDKNGNLKLADFGLAS-QFRRKDGTLRVSMDQRGSPPYMAP 189

Query: 512 EILLGQG--YTKTVDWWTLGILLYEMMTGLPPY 542
           E+L  +   Y    D W++GILL+ ++TG  P+
Sbjct: 190 EVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 90.1 bits (222), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 147/333 (44%), Gaps = 64/333 (19%)

Query: 316 ISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL 375
           +S  RG  +L  T  Y P K      ++F +L+ IG+GSFG V +V    T K+   K +
Sbjct: 1   MSQSRGIRRLQ-TSSY-PQKLGHSQPNEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEI 58

Query: 376 RKAYIVSKCEVTHTLAERTVLARVDCPFIVPL------------KFSFQSPEKLYLVLAF 423
           +  ++ SK E    +AE T+LA +    IV                 + + E LYL + +
Sbjct: 59  KYGHMNSK-ERQQLIAECTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEY 117

Query: 424 INGGELFYHLQHEG---RFSLARSRFYIA-ELLCALDSLH------KLDVIY-------- 465
            + G+L   ++H     ++   R  + IA +LL AL   H      +LD IY        
Sbjct: 118 CSCGDLSQMIKHYKGMRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAI 177

Query: 466 ------------RDLKPENILLDYQG------------HIALCDFGLCKLNMKDNDKTDT 501
                       RDLKP NI L   G             + L DFGL K      +   T
Sbjct: 178 ESEAGKVTSVIHRDLKPGNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATT 237

Query: 502 FCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ---QP 558
           + GTP Y++PE+L+ Q Y+   D W+LG ++YE+     P+   N   + + I +   QP
Sbjct: 238 YVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQP 297

Query: 559 LLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTD 591
           L  PD +    + L+I  +  +P+ +L  +  D
Sbjct: 298 L--PDYYSKELQQLVISCI--NPNEKLRPSAFD 326

>Scas_602.11
          Length = 1186

 Score = 92.0 bits (227), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 93/403 (23%), Positives = 168/403 (41%), Gaps = 114/403 (28%)

Query: 305 AAQIRLYNHHWISLERGYGKLN--------ITVDYKP-SKNKPLSIDDFDLLKVIGKGSF 355
            A    +N+ + +L+   G+ +        I++ Y P SK K L+   ++++K +G G  
Sbjct: 126 TAPFNTFNNKFATLDEKLGRTSTKVKETNRISLTYDPISKRKVLNT--YEIIKELGHGQH 183

Query: 356 GKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLA--------------ERTVLARVDC 401
           GKV   +   T ++ A+K + +     K  +T+                 E  ++ ++  
Sbjct: 184 GKVKLAKDLLTSQLVAIKIVDRH---EKLRLTNFFKFNKRKQQNDDRIKREIAIMKKLHH 240

Query: 402 PFIVPLKFSFQS--PEKLYLVLAFINGGELFYH----LQHEGR----FSLARSRFYIAEL 451
             +V L          K+YLVL +   GE+ +     L+ E +     S   +R  I  +
Sbjct: 241 KHVVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPLLSFQSAREIIRGV 300

Query: 452 LCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLC---------------------- 489
           +  L+ LH   +I+RD+KP N+L+D +G + + DFG+                       
Sbjct: 301 ILGLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNSTANSSSVLGGTPR 360

Query: 490 --------KLNMKDNDKTDTF--------CGTPEYLAPEILLG-QGYTK----------- 521
                    +N  +N+  ++          GTP + APEI LG + + K           
Sbjct: 361 NLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAFFAPEICLGEEAFDKFSLRKNEMFKG 420

Query: 522 -----TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFD---------- 566
                 +D W LGI  Y ++ G+ P+  +    +++KI+ +PL FP   +          
Sbjct: 421 SCISFMIDIWALGITFYCLLFGMLPFISDFELELFEKIVGEPLTFPSYEELQANRVSNVC 480

Query: 567 -----PAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
                 AAK++L  LL ++PS+R  +    E++ HPF   I W
Sbjct: 481 SIEEYEAAKNVLQRLLEKNPSKRCSI---LELKYHPF---ICW 517

>Scas_598.6
          Length = 790

 Score = 91.7 bits (226), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 97/206 (47%), Gaps = 16/206 (7%)

Query: 349 VIGKGSFGKVMQVRKKDTQKIYAL-KALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPL 407
            I  G F +  +V  K   K   L K  RK  IV++  V      + ++          L
Sbjct: 523 AIPPGEFDETPEVGDKVAIKQMILSKQPRKELIVNEILVMKDSRHKNIVNF--------L 574

Query: 408 KFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRF------YIAELLC-ALDSLHK 460
           +   ++ + L++V+ F+ GG L   +++      + S        YI    C  L  LH 
Sbjct: 575 EAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHD 634

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT 520
             +I+RD+K +N+LLD    + + DFG C        K  T  GTP ++APE++  + Y 
Sbjct: 635 KHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQREYD 694

Query: 521 KTVDWWTLGILLYEMMTGLPPYYDEN 546
           + VD W+LGI+  EM+   PPY +E+
Sbjct: 695 EKVDVWSLGIMTIEMLESEPPYLNED 720

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 92.0 bits (227), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 136/289 (47%), Gaps = 22/289 (7%)

Query: 329  VDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEV 386
            V    SKN      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E 
Sbjct: 1107 VSINKSKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDET 1166

Query: 387  T-----HTLAERTVLARVDCPFIVPLKFSFQSPEKLY-LVLAFINGGELFYHLQHEGRFS 440
            T       ++E + L  +D   IV     F++   +Y L L ++ GG +   ++  G F 
Sbjct: 1167 TVNNAEALISEVSTLKDLDHLNIVQY-LGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFD 1225

Query: 441  LARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDNDK 498
                RF   ++L  L  LH   +++RD+K +N+LLD  G   + DFG+ +   N+  N +
Sbjct: 1226 EQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSE 1285

Query: 499  TDTFCGTPEYLAPEIL-LGQGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYK--KI 554
              T  GT  ++APE++   QGY+  VD W+LG ++ EM  G  P+ + E V  M++  K 
Sbjct: 1286 M-TMRGTVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKS 1344

Query: 555  LQQPLLFPDGFDPAAKD---LLIGLLSRDPSRRLGVNGTDEIRNHPFFK 600
               P +  D     ++D    L      DP  R      D + +HPF +
Sbjct: 1345 KSAPPIPEDTLPHISQDGRAFLDDCFMIDPEERPTA---DTLLSHPFCQ 1390

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 130/281 (46%), Gaps = 29/281 (10%)

Query: 310 LYNHHWISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKI 369
           LYN+   S  R      + + Y P   + + +++F++L  +G G +GKV   R   T  +
Sbjct: 17  LYNNASNSSSRIKETRKVKLLYNPLTKRQI-LNNFEILATLGNGQYGKVKLARDLGTGAL 75

Query: 370 YALKAL-----RKAYIVS-KCEVTHTLAERTVLARVDCPFIVPLKFSFQSPE--KLYLVL 421
            A+K L     R  Y +  K E      E  V+ R     +V L      PE  K+YLVL
Sbjct: 76  VAIKILNRFEKRSGYSLQLKVENPRVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVL 135

Query: 422 AFINGGELFYHLQHEGR--------FSLARSRFYIAELLCALDSLHKLDVIYRDLKPENI 473
            + + G + +  +++           +  +SR  + +++  L+ LH   + +RD+KP N+
Sbjct: 136 EYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNL 195

Query: 474 LLDYQGHIALCDFGLC------KLNMKDNDKT---DTFCGTPEYLAPEILLGQ---GYTK 521
           L+   G + + DFG+         N++ + +        GTP + APE+   +     + 
Sbjct: 196 LISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSS 255

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP 562
            +D W+LG+ +Y ++ G  P+   +   ++  I+ +PL FP
Sbjct: 256 AIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFP 296

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 100/206 (48%), Gaps = 21/206 (10%)

Query: 349 VIGKGSFGKVMQVRKKDTQKIYALKALR--------KAYIVSKCEVTHTLAERTVLARVD 400
           V+G+G+ G V + + +  +K++ALK +         +  ++ + +   +     ++    
Sbjct: 185 VLGEGAGGSVAKCKLRTGKKVFALKTINILNGDPEFQKQLLRELQFNKSFKSEYIVRYFG 244

Query: 401 CPFIVPLKFSFQSPEKLYLVLAFINGG--ELFYH--LQHEGRFSLARSRFYIAELLCALD 456
                   F+ +    +Y+ + ++ G   E  Y   L   GR S          +L  L 
Sbjct: 245 M-------FTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLS 297

Query: 457 SLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG 516
            LH+  VI+RD+KP+NILL+  G + LCDFG+    +  N    TF GT  Y+APE + G
Sbjct: 298 YLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAV--NSLATTFTGTSYYMAPERIQG 355

Query: 517 QGYTKTVDWWTLGILLYEMMTGLPPY 542
           Q Y+ T D W+LG+ + E+  G  P+
Sbjct: 356 QPYSVTCDVWSLGLTILEVAQGHFPF 381

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 132/305 (43%), Gaps = 54/305 (17%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL------A 397
           + L+ +IG+G++G V     K T    A+K ++         VT TL E  +L       
Sbjct: 13  YKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQP--FTRPMFVTRTLRELKLLKFFHSHE 70

Query: 398 RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDS 457
            +     +    S+Q  E +YLV   +         Q     S    +++  ++L AL S
Sbjct: 71  NIISVLDIVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKS 130

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDNDKTDT------FCGTPEYLA 510
           LH   VI+RDLKP N+LL+    + LCDFGL + L   D  + +       +  T  Y A
Sbjct: 131 LHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRA 190

Query: 511 PEILLG-QGYTKTVDWWTLGILLYEMMTGLPPY--------------------------- 542
           PEI+L  Q YT  +D W+ G +L EM++G P +                           
Sbjct: 191 PEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWIILEILGTPSFEDFEQI 250

Query: 543 -------YDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRN 595
                  Y  N+P M  KI     L  +  +P A DLL  +L+ +P +R  ++  D ++ 
Sbjct: 251 KSKRAKAYIANLP-MRPKIPWNVALSTNDINPLAMDLLDKMLTFNPDKR--ISAADALK- 306

Query: 596 HPFFK 600
           HP+ +
Sbjct: 307 HPYLE 311

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 125/279 (44%), Gaps = 25/279 (8%)

Query: 351 GKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFS 410
           G G++G V +V  K T  I A+K +R     SK      L E  VL     P+IV    +
Sbjct: 425 GHGNYGNVSKVLHKPTHIIMAMKEVRLELDESK--FRQILMELEVLHNCQSPYIVDFYGA 482

Query: 411 FQSPEKLYLVLAFINGGEL--FYHLQHEGRF---SLARSRFYIAELLCALDSLHKLDVIY 465
           F     +Y+ + +++GG L   Y  +  G      LAR    + + L  L  +H  ++I+
Sbjct: 483 FFIEGAVYMCMEYMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVH--NIIH 540

Query: 466 RDLKPENILLDY-QGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG-----QGY 519
           RD+KP NIL    QG I LCDFG+    +    KT+  C +  Y+APE +         Y
Sbjct: 541 RDVKPTNILCSASQGTIKLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDKSTY 598

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ----QPLLFPDG-FDPAAKDLLI 574
           +   D W+LG+ + EM  G  PY  E    ++ ++       P   P+G F   A++ + 
Sbjct: 599 SVQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVS 658

Query: 575 GLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYI 613
             L + P RR       E   HP+ K      + +  YI
Sbjct: 659 MCLQKIPERRPTYAALLE---HPWLKKYENVDVRMSEYI 694

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 135/313 (43%), Gaps = 74/313 (23%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSK---CE--------VTHTLAE 392
           F L+K IG G++G V   R  ++ +   +   +   + SK   C+        + H    
Sbjct: 23  FQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSLRELKLLRHFRGH 82

Query: 393 RTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS-------- 444
           + +    D   ++    SF             NG +L+  L       + +S        
Sbjct: 83  KNITCLYDMDIVLLPDGSF-------------NGLDLYEELMEWDMHQIIKSGQPLTDAH 129

Query: 445 -RFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK---LNMKDNDKTD 500
            + ++ ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +    N  +ND+  
Sbjct: 130 YQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFL 189

Query: 501 T-FCGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ-- 556
           T +  T  Y APEI+L  QGYT+ +D W+ G +L E++ G P +  ++      +ILQ  
Sbjct: 190 TEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVL 249

Query: 557 ----------------------------QPL--LFPDGFDPAAKDLLIGLLSRDPSRRLG 586
                                        P   L+P+  +P A DLL  +L+ DP  R+ 
Sbjct: 250 GTPPEETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNA-NPDAADLLERMLALDPKTRIT 308

Query: 587 VNGTDEIRNHPFF 599
           V   DE   HP+ 
Sbjct: 309 V---DEALEHPYL 318

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/317 (27%), Positives = 138/317 (43%), Gaps = 65/317 (20%)

Query: 336 NKPLSIDD-FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVT-HTLAER 393
           N+  S+D  F L+K IG G++G V   R  +  +   +   +   + SK  +   +L E 
Sbjct: 14  NQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLREL 73

Query: 394 TVL------ARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS--- 444
            +L        + C + + + F    P+        ING  L+  L       + +S   
Sbjct: 74  KLLRHFRGHKNITCLYDMDIVFY---PD------GSINGLYLYEELMECDMHQIIKSGQP 124

Query: 445 ------RFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK---LNMKD 495
                 + +  ++LC L  +H  DV++RDLKP N+L++    + +CDFGL +    N  +
Sbjct: 125 LTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVE 184

Query: 496 NDKTDT-FCGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKK 553
           N +  T +  T  Y APEI+L  QGYTK +D W+ G +L E + G P +  ++      +
Sbjct: 185 NSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQ 244

Query: 554 ILQQPLLFPD------------------GFDP-------------AAKDLLIGLLSRDPS 582
           ILQ     PD                  GF P              A DLL  +L+ DP 
Sbjct: 245 ILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQ 304

Query: 583 RRLGVNGTDEIRNHPFF 599
           +R+ V   DE   HP+ 
Sbjct: 305 KRITV---DEALEHPYL 318

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 149/332 (44%), Gaps = 64/332 (19%)

Query: 327 ITVDYKPSKNKPLSIDDFDLLK-VIGKGSFGKVM-----------QVRKKDTQKIYALKA 374
           IT++Y  +      +D++++   V+G G+FG V+           +  +K T K YA+K 
Sbjct: 141 ITINYTEN------VDNWNISNIVVGNGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVK- 193

Query: 375 LRKAYIVSKCEVTHTLAERTVLARVDCPFIVPL-KFSFQSPEKLYLVLAFINGGELFYHL 433
                 + K +++    E  +L +++ P I+ + K        LY+    I GG+LF +L
Sbjct: 194 ------IVKMKLSKLDKEAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYL 247

Query: 434 QHEGRF---SLARSRFYIAELLCALDSLHKLDVIYRDLKPENILL---DYQGHIALCDFG 487
                    S   +  ++ ++L AL  LH   +++RDLK +NILL   +    I L DFG
Sbjct: 248 AKGDCLMPISQTEALVFVYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFG 307

Query: 488 LCKLNMKDNDKTDTFCGTPEYLAPEI-----------------LLGQGYTKTVDWWTLGI 530
           + +       +  T  GTPEY APE+                 L  QGY    D W+LG+
Sbjct: 308 IARTVTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKCDLWSLGV 367

Query: 531 LLYEMMTGLPPYYDEN-----VPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRL 585
           + + M+TG+ P+Y +      V      IL   +      D  A++ +  LL  +  +RL
Sbjct: 368 ITHIMLTGISPFYGDGTEQSIVENAKAGILNFNVSQWSTIDIMAQNFVSKLLEVNVDKRL 427

Query: 586 GVNGTDEIRNHPF-------FKDISWKKLLLK 610
                ++  NH +        K+I  KK+LL+
Sbjct: 428 ---DCEQCFNHLWISKHQKSLKEIYEKKVLLR 456

>Kwal_14.2497
          Length = 418

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 102/189 (53%), Gaps = 14/189 (7%)

Query: 421 LAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH-KLDVIYRDLKPENILLDYQG 479
           +   +GG+LF  ++ +       +RFY  +L+ A+D LH +  V +RD+KPEN+LLD +G
Sbjct: 1   MELASGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERG 60

Query: 480 HIALCDFGLC-KLNMKDNDK---TDTFCGTPEYLAPEILLGQG-YTKTVDWWTLGILLYE 534
           ++ L DFGL  +   KD  K   +DT    P Y+APEI+  +  Y  + D W+ G+L++ 
Sbjct: 61  NLKLADFGLASQFKRKDGSKRIMSDTRGSLP-YMAPEIVYSKSYYADSTDIWSCGVLVFV 119

Query: 535 MMTGLPPYYDENVPVMYKKILQQPLLFPDG----FDPAAKDLLIGLLSRDPSRRLGVNGT 590
           ++TG  P+   +    +   L+       G     D +  +LL  +L  DP+RR      
Sbjct: 120 LLTGETPWDSPSDDSRFDDFLENSGGIASGSWAKIDISQLNLLRKMLHPDPARRATA--- 176

Query: 591 DEIRNHPFF 599
           +++++H ++
Sbjct: 177 EQLKSHNWY 185

>Kwal_33.13222
          Length = 148

 Score = 82.4 bits (202), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 411 FQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKP 470
           +++   LY+VL ++  GELF  L   G      +  +  +++  +   H L +++RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 471 ENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTK 521
           EN+LLD++ +I + DFG+  L  KD    +T CG+P Y APEI+ G   ++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESKDK-LLETSCGSPHYAAPEIVSGTALSR 125

>Kwal_55.22001
          Length = 363

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 147/330 (44%), Gaps = 57/330 (17%)

Query: 332 KPSKNKPLSIDDFDLLKVIGKGSFGKVMQV-RKKDTQKIYALKALRKAYIVSKCEVTHTL 390
           + S  +P+ + ++   K IG G+FG V+Q     D  K Y   A++K       +  +  
Sbjct: 17  RSSSTRPMLVKEY---KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKV----PAQTEYKS 69

Query: 391 AERTVLARVDCPFIVPLKFSFQ--SPE--KLYLVLAF-----INGGELFYHLQHEGRFSL 441
            E  +L   D P +V L++ F   SP+  KLY  LA          E+  +  ++    L
Sbjct: 70  RELEILRIADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPL 129

Query: 442 ARSRFYIAELLCALDSLHKLDVIYRDLKPENILLD-YQGHIALCDFGLCKLNMKDNDKTD 500
             ++ Y  ++   +  LH L + +RD+KP N+L+D   G + +CDFG  K  ++ N  + 
Sbjct: 130 KHTKLYTYQIARGMLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAK-KLEQNQPSI 188

Query: 501 TFCGTPEYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI----- 554
           ++  +  Y APE+++G   YT  +D W LG ++ EM+ G   +  +   +  ++I     
Sbjct: 189 SYICSRFYRAPELIVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG 248

Query: 555 ------------------LQQPLL-------FPDGF---DPAAKDLLIGLLSRDPSRRLG 586
                               +PL        F   F    P   DLL+ +L+ +P RRL 
Sbjct: 249 PPDKKFLFFSNPSYDGPLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRL- 307

Query: 587 VNGTDEIRNHPFFKDISWKKLLL-KGYIPP 615
                 I  HPFF+D+  ++    +G+  P
Sbjct: 308 --SPRRILAHPFFEDLKKERYFFPRGHTQP 335

>Scas_619.5*
          Length = 510

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 135/281 (48%), Gaps = 52/281 (18%)

Query: 348 KVIGKGSFGKVMQVRKKD--------TQKIYALKALR-KAYIVSKCEVTHTLAERTVLAR 398
           ++IG G+FG V+   KK         ++  +A+K ++ + Y V K        E  +L +
Sbjct: 172 RIIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLK 223

Query: 399 VDCPFIVPLKFSFQS--PEKLYLVLAFINGGELFYHL---QHEGRFSLARSRFYIAELLC 453
           ++   I+ + ++F       LY+    I GG+LF +L   +     S   +   + ++L 
Sbjct: 224 LNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILK 283

Query: 454 ALDSLHKLDVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDNDKTDTFCGTPEYL 509
           AL  +H   +++RDLK +NILL   +    I L DFG+ K L++K N + +T  GTPEY 
Sbjct: 284 ALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLK-NTRMNTIVGTPEYC 342

Query: 510 APEI-------LLGQ-------------GYTKTVDWWTLGILLYEMMTGLPPYY-DENVP 548
           APE+       ++ Q             GY    D W+LG++ + M+TG+ P+Y D +  
Sbjct: 343 APEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEN 402

Query: 549 VMYKKILQQPLLFP----DGFDPAAKDLLIGLLSRDPSRRL 585
            + + + +  L F     +  +  AK  +  LL  D  +RL
Sbjct: 403 SIIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRL 443

>Scas_707.34
          Length = 905

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 135/310 (43%), Gaps = 67/310 (21%)

Query: 342 DDFDLLKVIGKGSFGKV------------MQVRKKDTQKI-----YALKALRKAYIVSKC 384
           D + + K IGKGSF  V            +     D+  I     +A+K + ++ + +K 
Sbjct: 36  DRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKK 95

Query: 385 EVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRF----S 440
            + +   E  +L ++  P IV L    ++ +  YL++ + + G+L + ++   +      
Sbjct: 96  LLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 441 LARSRF--------------------YIAELLCALDSLHKLDVIYRDLKPENILL----- 475
           L    F                    Y+ +L  AL  L   ++++RD+KP+N+LL     
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 476 DYQGH----------------IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGY 519
           +Y                   + + DFG  +  + +    +T CG+P Y+APEIL  Q Y
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYMAPEILNYQKY 274

Query: 520 TKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQP--LLFPD--GFDPAAKDLLIG 575
               D W++G +LYEM  G PP+   N   +YKKI +    + FP     D   K L+  
Sbjct: 275 NAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEIDNNLKSLISK 334

Query: 576 LLSRDPSRRL 585
           LL+ DP  R+
Sbjct: 335 LLTFDPQERI 344

>Scas_680.20
          Length = 482

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 140/304 (46%), Gaps = 58/304 (19%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPF 403
           +  L++ G GSFG V++ +     +I ALK + +       E+        +L  +D P 
Sbjct: 167 YKTLEIQGSGSFGLVLKAKTLHNGEIVALKKIIQNKKFKNRELH-------MLRLLDHPN 219

Query: 404 IVPLKFSFQSP-----EKLYLVLAFINGGELFYHLQHEGRFSLARS-------RFYIAEL 451
           I+ LK+ F  P       L L+  F+    L+  ++     + +         + Y+ ++
Sbjct: 220 IISLKYFFVEPIDNDESYLNLIFEFV-PLSLYQRIRQVATTTSSVQPSHKLEFKCYMWQI 278

Query: 452 LCALDSLH-KLDVIYRDLKPENILLD-YQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYL 509
             ALD LH ++++ +RD+KP+NIL+D     + +CDFG  K  +  +DK  +F  +  Y 
Sbjct: 279 FKALDYLHNEVNICHRDIKPQNILIDPMDWSLKICDFGSAK-RLNPHDKNVSFICSRFYR 337

Query: 510 APEILLGQ-GYTKTVDWWTLGILLYEMMTGLPPYY----DENVPVMYKKILQQPL----- 559
           APE++LG   YT ++D W+ G +  E++  L P++    D +  V   +IL  P      
Sbjct: 338 APELILGAIQYTNSIDLWSTGCVFAELLL-LKPFFAGKSDTDQIVEIIRILGTPTLKDII 396

Query: 560 ---------------------LFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPF 598
                                LF D  + +A DLL  +L  DP+ R+    + +   HP+
Sbjct: 397 SMNENYKDYRFPRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTERI---DSSKCLIHPY 453

Query: 599 FKDI 602
           F D+
Sbjct: 454 FDDL 457

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 88.6 bits (218), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 149/358 (41%), Gaps = 106/358 (29%)

Query: 327 ITVDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAL---------- 375
           ++++Y P SK K L+   +++++ +G G  GKV   R   T+++ A+K +          
Sbjct: 99  VSLEYDPISKRKVLNT--YEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTFND 156

Query: 376 -------------------RKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEK 416
                              R+  I+ KC   H +    VL                   K
Sbjct: 157 KFSNRFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKS-------------RK 203

Query: 417 LYLVLAFINGGELFYH----LQHEGR----FSLARSRFYIAELLCALDSLHKLDVIYRDL 468
           +YLVL + + GE+ +     ++ + R     S  R+R     +L  L+ LH   +I+RD+
Sbjct: 204 IYLVLEYCSKGEIKWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDI 263

Query: 469 KPENILLDYQGHIALCDFGLCKLNMKDNDKTDTF--------CGTPEYLAPEILLGQGYT 520
           KP N+LL   G + + DFG+  L    +  TD+          GTP + APEI L +   
Sbjct: 264 KPANLLLSEDGIVKISDFGVS-LAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTI 322

Query: 521 KT---------------VDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGF 565
           K                 D W +GI L+ ++ G+ P+  +    ++ KI+ +PL+    F
Sbjct: 323 KKFDLDPNSKEPIISFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLV----F 378

Query: 566 DP-------------------AAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
           +P                    A++LL  LL ++P +R+ +    + + HP+   + W
Sbjct: 379 EPYQKIEQCQVSQVECKEEYEEAQNLLNKLLEKNPKKRMAI---QDAKKHPW---VCW 430

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 130/297 (43%), Gaps = 49/297 (16%)

Query: 348 KVIGKGSFGKVMQVRKKDTQKI-----YALKALR--------KAYIVSK---CEVTHTLA 391
           +V+G G+FG+V+   +K          YA+K +R        +A I+ +        T  
Sbjct: 147 QVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETTG 206

Query: 392 ERTVLARVDCPFIVPLKFSF-QSPEKLYLVLAFINGGELFYHLQHE---GRFSLARSRFY 447
           E  VL R   P ++ +  +F    + +Y+    + GG+LF +L  +      S   +   
Sbjct: 207 EEHVLTRGQ-PNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVI 265

Query: 448 IAELLCALDSLHKLDVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDNDKTDTFCG 504
           + ++L AL  LH   +++RDLK +NILL   +    I L DFG+ K       +  T  G
Sbjct: 266 VYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTRVRMHTIVG 325

Query: 505 TPEYLAPEI-----------------LLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENV 547
           TPEY APE+                 +  QGY    D W+LG++ + M+TG+ P+Y +  
Sbjct: 326 TPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGT 385

Query: 548 PV-MYKKILQQPLLFPD----GFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFF 599
              + + +    L F      G    AK  +  LL  +  +R+ V    +   HP+ 
Sbjct: 386 EASIIRNVKIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRMSVQ---DCFKHPWI 439

>Kwal_33.14167
          Length = 838

 Score = 87.8 bits (216), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 133/300 (44%), Gaps = 38/300 (12%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC- 401
           +++ L+++G+G   KV +V+  +  K+YALK +          +     E  +L +++  
Sbjct: 514 EYEKLELLGRGGTSKVYKVKNANNNKVYALKRVSFDEF-DDSSIDGFKGEIELLKKLETQ 572

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS--RFYIAELLCALDSLH 459
           P +V L         LY+V+      +L   L H     L     R++  E+L  +  +H
Sbjct: 573 PRVVKLIDHEMDHGVLYVVME-CGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVH 631

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDNDKTDTFCGTPEYLAPEILLGQ 517
              +++ DLKP N +   +G + + DFG+         N   +T  GTP Y+APE L+  
Sbjct: 632 DAGIVHSDLKPANFVF-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 690

Query: 518 GYT-------------KTVDWWTLGILLYEMMTGLPPY-----YDENVPVMYKKILQQPL 559
            YT             K  D W+ G ++Y+M+ G PPY      +  + +M  ++    +
Sbjct: 691 NYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK---I 747

Query: 560 LFP------DGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYI 613
           ++P      D     A D +   L R+P++R  V   +E+ N  F K +S     ++  I
Sbjct: 748 VYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTV---EEVANGSFVKPVSVTHFFIRDLI 804

>Scas_700.35
          Length = 439

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 111/233 (47%), Gaps = 14/233 (6%)

Query: 347 LKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIV 405
           L ++G+G+ G V + R +K++ +++ALK +       + +      E          +IV
Sbjct: 152 LGMLGEGAGGSVAKCRLRKNSSQVFALKTINTLNTDPEFQ-KQLFRELEFNKSFKSNYIV 210

Query: 406 PLKFSFQSP--EKLYLVLAFINGGEL--FYH--LQHEGRFSLARSRFYIAE-LLCALDSL 458
                F       +Y+ + ++ G  L   Y   L   GR    +    IAE +L  L  L
Sbjct: 211 TYYGMFNDTLNGSIYIAMEYMGGQSLDTIYKSLLSRGGRIG-EKILGKIAESVLRGLSYL 269

Query: 459 HKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQG 518
           H+  +I+RD+KP+NILL+ +G + LCDFG+    +  N    TF GT  Y+APE + G  
Sbjct: 270 HERKIIHRDIKPQNILLNEEGEVKLCDFGVSGEAV--NSLATTFTGTSFYMAPERIQGHP 327

Query: 519 YTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKD 571
           Y+ T D W+LG+ + E+  G  P+  + +      I    L+    F P  KD
Sbjct: 328 YSVTCDVWSLGLTILEVAQGRFPFDSDKITTTIAPI--DLLMLILTFTPELKD 378

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 120/281 (42%), Gaps = 29/281 (10%)

Query: 351 GKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFS 410
           G G++G V +V  K T  + A+K +R     SK      L E  VL +   P+IV    +
Sbjct: 384 GHGNYGTVSKVLHKPTNIMMAMKEVRLELDESKFR--QILMELEVLHKCQSPYIVDFYGA 441

Query: 411 FQSPEKLYLVLAFINGGEL--FYHLQHEGRFSLARSRFYIAELLCALDSLHKL-DVIYRD 467
           F     +Y+ + F++GG L   Y     G     +       ++  L  L  + ++I+RD
Sbjct: 442 FFIEGAVYMCMEFMDGGSLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHNIIHRD 501

Query: 468 LKPENILLDY-QGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG-----QGYTK 521
           +KP NIL    QG + LCDFG+    +    +T+  C +  Y+APE +         Y+ 
Sbjct: 502 VKPTNILCSATQGTVKLCDFGVSGNLVASLARTNIGCQS--YMAPERIKSLNPDKATYSV 559

Query: 522 TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ---------PLLFPDGFDPAAKDL 572
             D W+LG+ + EM  G  PY     P  Y  I  Q         P L  D F   A+D 
Sbjct: 560 QSDIWSLGLSIVEMALGAYPY----PPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDF 615

Query: 573 LIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYI 613
           +   L + P RR       E   HP+ K      + +  YI
Sbjct: 616 VRLCLQKIPERRPTYASLLE---HPWLKKYRGLDVHMSEYI 653

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 130/275 (47%), Gaps = 24/275 (8%)

Query: 348 KVIGKGSFGKVMQVRKKDTQKI-----YALKALRKAYIVSKCEVTHTL-AERTVLARVDC 401
           +VIGKGSFG V    KK+ + +     YA+K  R+    +  + +  L +E  + + +  
Sbjct: 334 EVIGKGSFGVVRICHKKNLKSVSGEILYAVKEFRRRPTENPVKYSKRLTSEFCISSSLKH 393

Query: 402 PFIVPLKFSFQSPEKLYL-VLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460
             I+     FQ  +  Y  V+ + +GG+LF  +   G+     +  ++ +L+  +  +H 
Sbjct: 394 TNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCFLKQLITGVVYMHN 453

Query: 461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDK----TDTFCGTPEYLAPEILLG 516
           + V +RDLKPEN+LL + G + + DFG  +      +K    +   CG+  Y+APE    
Sbjct: 454 MGVCHRDLKPENLLLTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQ 513

Query: 517 QGYT-KTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYKKILQQPLLFPDGFDPAAK---- 570
           + +  + VD W  G++   M TG   +   +     Y K L+       G+DP  K    
Sbjct: 514 EEFDPRAVDIWACGVIYMAMRTGRQLWATAQKEDEFYLKYLKG-RKNAAGYDPIEKLKRA 572

Query: 571 ---DLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDI 602
              +++  +L   PSRRL     D+I N  + ++I
Sbjct: 573 RCRNVIYSILDPVPSRRL---SGDQILNSEWGREI 604

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 113/265 (42%), Gaps = 30/265 (11%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALKALR-KAYIVSKCE--VTHTLAERTV----------- 395
           IG GSFG V       T ++ A+K +  K  I +  +  V    AE+ V           
Sbjct: 395 IGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNLHRK 454

Query: 396 -----------LARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS 444
                      L  +    IV    S Q    L + L ++ GG +   L + G F     
Sbjct: 455 MIDALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLI 514

Query: 445 RFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK----LNMKDNDKTD 500
             +  ++L  +  LH+ ++I+RD+K  NIL+D +G + + DFG+ K    LN ++ DK  
Sbjct: 515 VNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQENQDKRT 574

Query: 501 TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYD-ENVPVMYKKILQQPL 559
           +  G+  +++PE++     T   D W+ G ++ EM TG  PY D   +  ++K       
Sbjct: 575 SLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPYPDFSQMQALFKIGTNVTP 634

Query: 560 LFPDGFDPAAKDLLIGLLSRDPSRR 584
             P    P  +D +      D  RR
Sbjct: 635 EIPSWASPQGRDFIRKTFELDYQRR 659

>Kwal_27.9773
          Length = 406

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 117/254 (46%), Gaps = 42/254 (16%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDC 401
           +++ +L+ IG+GSFG V +V    T ++   K ++  ++ SK E    ++E  +L+++  
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 402 PFIVPLKFSFQSPEKLYLVLAFINGGEL---FYHLQHEGRFSLARSRFYI-AELLCALDS 457
             IV         + LY  + + + G+L     H + E ++   R  + +  ++L AL  
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 458 LH------KLDVIY---------------RDLKPENILL---------------DYQG-H 480
            H       L+ IY               RDLKP NI L               DY    
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 481 IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLP 540
           + L DFGL K      +   T+ GTP Y++PE+L+ Q Y+   D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 541 PYYDENVPVMYKKI 554
           P+  +    + ++I
Sbjct: 256 PFQAKTYTELQRRI 269

>Kwal_56.23841
          Length = 432

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 145/337 (43%), Gaps = 73/337 (21%)

Query: 347 LKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERT-----VLARVDC 401
           L  +G G+FG V       T +  A+K + K +       T  LA+RT     +L  +  
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 402 PFIVPLKFSFQSP-EKLYLVLAFINGGELFYHLQH---EGRFSLARSRFYIAELLCALDS 457
             ++ L+  F SP E +Y V   + G +L   LQ    E +F     ++++ ++L  L  
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQFV----QYFLYQILRGLKY 134

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG- 516
           +H   VI+RDLKP NIL++    + +CDFGL ++    + +   +  T  Y APEI+L  
Sbjct: 135 VHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 517 QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKIL--------------------- 555
           Q Y   VD W+ G +  EM+ G P +  ++    +  I                      
Sbjct: 192 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLK 251

Query: 556 -------QQPLLFPDGF---DPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWK 605
                  + P+ F + F   +P A DLL  +L  DP++R  +   D + +HP        
Sbjct: 252 FVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKR--ITAADAL-SHP-------- 300

Query: 606 KLLLKGYIPPYKPIVKSEIDTANFDQEFT-KEKPIDS 641
                 Y+ PY       +  A FD  F   + P+D+
Sbjct: 301 ------YLAPYHDPTDEPVADAKFDWHFNDADLPVDT 331

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 99/211 (46%), Gaps = 18/211 (8%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVL------A 397
           + L+ ++G+G++G V     K T    A+K ++         VT TL E  +L       
Sbjct: 13  YQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQP--FSRSMFVTRTLRELKLLKFFHSHE 70

Query: 398 RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDS 457
            +     +    S+   E +YLV   +        + ++   S    ++++ ++L AL S
Sbjct: 71  NIISVLDIVRPTSWHKFEAVYLVQELMETD--LQKIINQQNLSEDHIQYFVYQILRALKS 128

Query: 458 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCG-------TPEYLA 510
           LH   VI+RDLKP N+LL+    + +CDFGL +     +   +   G       T  Y A
Sbjct: 129 LHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEYVATRWYRA 188

Query: 511 PEILLG-QGYTKTVDWWTLGILLYEMMTGLP 540
           PEI+L  Q YT  +D W+ G +L EM+ G P
Sbjct: 189 PEIMLSFQEYTTAMDIWSCGCILAEMIMGKP 219

>Scas_713.21
          Length = 641

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 37/299 (12%)

Query: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTV--LARV 399
           ++  +++++GKG   KV +V+ + T K YALK +    +    E   T  ER +  L R+
Sbjct: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGR---FSLARSRFYIAELLCALD 456
                V     ++  +++  VL      +L  H+ HE     F +   R    E++  + 
Sbjct: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDL-SHVLHERVNRPFDINFVRLMSKEMIECIK 433

Query: 457 SLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT---DTFCGTPEYLAPEI 513
           ++H  D+++ DLKP N +   +G + L DFG+    + DN      +T  GTP Y+APE 
Sbjct: 434 AVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-KIADNTLNVYRNTQMGTPNYMAPET 491

Query: 514 LLGQGYT-----------KTVDWWTLGILLYEMMTGLPPY-----YDENVPVMYKKI-LQ 556
           L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  + +M   I + 
Sbjct: 492 LISQNYSNNNNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551

Query: 557 QPLLFPDG--FDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLKGYI 613
            P   P G     +   L+   L+RDP  R     TDEI++  FF  +   K  L+  I
Sbjct: 552 YPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLESLI 607

>Kwal_55.20326
          Length = 750

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 101/230 (43%), Gaps = 36/230 (15%)

Query: 350 IGKGSFGKVMQVRKKDTQKIYALK-------------------------------ALRKA 378
           IG GSFG V       T ++ A+K                               A++ +
Sbjct: 464 IGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSAVKNS 523

Query: 379 YIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGR 438
             V +  V     E  +L  +    IV    S Q    L + L ++ GG +   L   G 
Sbjct: 524 SQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGP 583

Query: 439 FSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCK----LNMK 494
           F     R +  ++L  L  LH+ D+I+RD+K  NIL+D +G + + DFG+ K    LN +
Sbjct: 584 FEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQ 643

Query: 495 DNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYD 544
            N K  +  G+  ++APE++     TK  D W++G ++ EM TG  P+ D
Sbjct: 644 QN-KRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPFPD 692

>Scas_623.11
          Length = 378

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 117/221 (52%), Gaps = 22/221 (9%)

Query: 334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAER 393
           S N P++I  F   ++IGKGSFG V     ++T ++ A+K + +       E+       
Sbjct: 38  SNNDPITIT-FPTTEIIGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKNREL------- 89

Query: 394 TVLARVDCPFIVPLKFSFQSPE-----KLYLVLAFINGGELFYHLQH--EGRFSLAR--S 444
            ++  +  P ++ LK+ F   +      L L+L ++    L+  L+H    R S++R   
Sbjct: 90  EIMKLIQHPNVINLKYYFYEKDVDDEVYLNLILDYMPQS-LYQRLRHFVHQRQSMSRLEI 148

Query: 445 RFYIAELLCALDSLHKL-DVIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDNDKTDTF 502
           +FY+ +L  +L+ LH   +V +RD+KP+NIL+D    ++ LCDFG  K  +K  +   ++
Sbjct: 149 KFYMFQLFKSLNYLHNAKNVCHRDIKPQNILVDPNSWNLKLCDFGSAK-QLKPTEPNVSY 207

Query: 503 CGTPEYLAPEILLGQ-GYTKTVDWWTLGILLYEMMTGLPPY 542
             +  Y APE++ G   Y+  +D W+ G ++ E++ G P +
Sbjct: 208 ICSRYYRAPELIFGATNYSNQIDIWSSGCVMAELLLGQPMF 248

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 118/253 (46%), Gaps = 40/253 (15%)

Query: 341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALK--------ALRKAYIVSKCEVTHTLAE 392
           + D   L  +G G+ G VM+V    + ++ A K        A+ K  I  +  +  ++AE
Sbjct: 101 LRDLVQLGKLGSGNSGTVMKVLHVPSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAE 160

Query: 393 RTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGEL------FYHLQHEGRFSLARSRF 446
              +        +    S      + +++ ++N G L      +  LQ  G  +  RS +
Sbjct: 161 HRNIVEFYGAHNLS-SDSINGSNDVVILMEYMNCGSLDTITRTYKSLQRRGILAANRS-Y 218

Query: 447 YIAE--------------LLCALDSLHK-LDVIYRDLKPENILLDYQGHIALCDFGLC-K 490
            + E              +L  L  L++   +I+RD+KP N+L++ +G I LCDFG+  K
Sbjct: 219 PVQEWFSKPVIISRIAYSVLNGLSYLYENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRK 278

Query: 491 LNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDEN---- 546
           LN   N   DTF GT  Y++PE + G  YT   D W+LG++L E++TG  P    N    
Sbjct: 279 LN---NSIADTFVGTSTYMSPERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGGHNDTPD 335

Query: 547 -VPVMYKKILQQP 558
            +  + ++I+ +P
Sbjct: 336 GILDLLQRIVNEP 348

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 124/256 (48%), Gaps = 22/256 (8%)

Query: 343  DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYI-----VSKCEVTHTLAERTVLA 397
            DF +L+ +G+G++GKV     K+ + I  +K + K  I     V   ++    +E  +LA
Sbjct: 945  DFVVLQKMGEGAYGKVNLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQILA 1004

Query: 398  RVDC---PFIVPLKFSFQSPEKLYLVL---AFINGGELFYHLQHEGRFSLARSRFYIAEL 451
             ++      I+ L   F+  +  YL           +LF  ++ +   +   ++    ++
Sbjct: 1005 TINKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEFKSNMTEFEAKLIFKQI 1064

Query: 452  LCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAP 511
            +  +  LH   +++RD+K EN+++D +G + L DFG        +   D F GT +Y AP
Sbjct: 1065 VSGIKHLHDQGIVHRDIKDENVIVDSKGFVKLIDFGSAA--YVKSGPFDVFVGTIDYAAP 1122

Query: 512  EILLGQGYT-KTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPA-- 568
            E+L G  Y  K+ D W +GILLY ++    P+Y+        +IL+  L F D  D +  
Sbjct: 1123 EVLGGNPYEGKSQDIWAIGILLYTLIYKENPFYN------IDEILEGELRFNDSADVSQE 1176

Query: 569  AKDLLIGLLSRDPSRR 584
             K L+  +L+R   +R
Sbjct: 1177 CKALITKILNRCVRKR 1192

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 149/355 (41%), Gaps = 85/355 (23%)

Query: 327 ITVDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRK-------- 377
           I+++Y P SK K L  + +++++ +G G  GKV       T++  A+K + +        
Sbjct: 91  ISLEYDPISKRKVL--NTYEIIRELGSGQHGKVKLALDLVTKQHVAIKIVDRHGKKKSSW 148

Query: 378 --AYIVSKCEVTHTLAERTVLARVDCPFIVPL--KFSFQSPEKLYLVLAFINGGELFY-- 431
                  + E      E  ++ + D   +V L          K+YLVL + + GE+ +  
Sbjct: 149 KLKKTPVREESEKIRREIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWCP 208

Query: 432 --HLQHEGR----FSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCD 485
              L+   R     +  R+R  +  ++  L+ LH   +I+RD+KP N+LL     + + D
Sbjct: 209 GDQLEAAARGPPLLTFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSEHDIVKISD 268

Query: 486 FGLCKLNMK-----------------------DNDKTDTFCGTPEYLAPEILLGQ-GYTK 521
           FG+   +                         D+ +     GTP + APEI LG   Y K
Sbjct: 269 FGVSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEK 328

Query: 522 -----------------TVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFP-- 562
                             +D W LG+ LY ++ G  P+  E    +++KI+  PL FP  
Sbjct: 329 LNIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRL 388

Query: 563 -----DGFDP--------AAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFKDISW 604
                +G           +A+DLL  LL ++P +R+ +    +I+ HPF   + W
Sbjct: 389 EFMQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIV---DIKAHPF---VCW 437

>YAR018C (KIN3) [73] chr1 complement(170393..171700)
           Serine/threonine protein kinase [1308 bp, 435 aa]
          Length = 435

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 123/278 (44%), Gaps = 67/278 (24%)

Query: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402
           ++ +L+ IG+GSFG V +V    T+K+   K ++  ++ SK E    +AE ++L+++   
Sbjct: 24  EYQVLEEIGRGSFGSVRKVIHIPTKKLLVRKDIKYGHMNSK-ERQQLIAECSILSQLKHE 82

Query: 403 FIVPL-KFSF-QSPEKLYLVLAFINGGEL---FYHLQHEGRFSLARSRFYI-AELLCALD 456
            IV    + F +  E LYL + + + G+L     H + E ++   +  + I A+LL AL 
Sbjct: 83  NIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALY 142

Query: 457 SLH---------------------KLDVIYRDLKPENILLDYQ-----------GH---- 480
             H                     K  VI+RDLKP NI L Y            GH    
Sbjct: 143 KCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVN 202

Query: 481 ------------------------IALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG 516
                                   + L DFGL K          T+ GTP Y++PE+L+ 
Sbjct: 203 SNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMD 262

Query: 517 QGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKI 554
           Q Y+   D W+LG +++EM +  PP+  +N   +  KI
Sbjct: 263 QPYSPLSDIWSLGCVIFEMCSLHPPFQAKNYLELQTKI 300

>Scas_683.6
          Length = 377

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 106/215 (49%), Gaps = 22/215 (10%)

Query: 344 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKALR---KAYIVSKCE-----VTHTLAERTV 395
           + L+ +IG+G++G V     K +    A+K ++   KA  V++       +T+      +
Sbjct: 13  YQLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKAMFVTRTLREIKLLTYFNNHENI 72

Query: 396 LARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARS--RFYIAELLC 453
           ++ +D   I P+  S    + +YLV   +          +    SL     +++  ++L 
Sbjct: 73  ISILDK--IKPI--SMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILR 128

Query: 454 ALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCG-------TP 506
           AL S+H   VI+RDLKP N+LL+    + +CDFGL +     ND   T  G       T 
Sbjct: 129 ALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATR 188

Query: 507 EYLAPEILLG-QGYTKTVDWWTLGILLYEMMTGLP 540
            Y APEI+L  Q YT  +D W++G +L EM+TG P
Sbjct: 189 WYRAPEIMLTFQEYTTAMDIWSVGCILAEMVTGRP 223

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 98/202 (48%), Gaps = 2/202 (0%)

Query: 340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV 399
           ++DD+   K  G+G++  V    KK T +  A+K ++ +      +++  L E   L  +
Sbjct: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-ALREVKFLQEL 64

Query: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLH 459
               ++ L   F + + L LVL F+              FS A  + +I   L  +   H
Sbjct: 65  KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124

Query: 460 KLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLG-QG 518
           +  +++RDLKP N+LL   G + + DFGL +L     +   +   T  Y APE+L G + 
Sbjct: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184

Query: 519 YTKTVDWWTLGILLYEMMTGLP 540
           YT  VD W++G++  E+M  +P
Sbjct: 185 YTSAVDIWSVGVIFAELMLRIP 206

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,176,712
Number of extensions: 1170834
Number of successful extensions: 6423
Number of sequences better than 10.0: 738
Number of HSP's gapped: 5542
Number of HSP's successfully gapped: 831
Length of query: 665
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 557
Effective length of database: 12,857,365
Effective search space: 7161552305
Effective search space used: 7161552305
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)