Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR102C83482038770.0
CAGL0K03377g97867716360.0
Scas_721.12885179915330.0
YKL121W85280113101e-168
Scas_717.6890858813051e-167
Kwal_26.765574361812541e-161
Sklu_2430.996684512721e-161
KLLA0B12804g85268110361e-128
ABL024W73458610151e-126
CAGL0K11638g5924265772e-64
AEL246C8152131776e-13
Sklu_2431.127492141652e-11
Scas_721.328222181553e-10
KLLA0E23529g8262111535e-10
Kwal_27.120537552141518e-10
CAGL0H08932g902601501e-09
YBR198C (TAF5)7982121454e-09
CAGL0M05335g8062141331e-07
YGL137W (SEC27)889601341e-07
Kwal_23.64297502151331e-07
KLLA0B01958g890671331e-07
AGL234W6292141321e-07
AFL118W832611284e-07
Scas_571.46011871284e-07
ADL082C5692331267e-07
KLLA0F10263g6823441241e-06
YDL145C (COP1)1201591251e-06
Scas_704.406082201231e-06
Scas_624.111205591232e-06
YCR084C (TUP1)713981222e-06
CAGL0E00561g8362181222e-06
CAGL0E02805g8402681222e-06
YBL008W (HIR1)8403171204e-06
AGR168W8251721204e-06
ADR077C1204591205e-06
Scas_630.6621981195e-06
Sklu_2160.3760511195e-06
Kwal_56.245261210591196e-06
Scas_442.2*7952421179e-06
KLLA0F27511g6232141161e-05
CAGL0L00781g6732271151e-05
Sklu_2318.17112111151e-05
Scas_629.126712291132e-05
KLLA0D02530g7071491133e-05
AFR199C3342601113e-05
CAGL0I03718g1201591133e-05
KLLA0E12287g3261051103e-05
Scas_702.168162831123e-05
KLLA0F04884g1212591114e-05
YIL046W (MET30)640751106e-05
CAGL0B01529g369531086e-05
YLR429W (CRN1)651671096e-05
Sklu_2442.23033171077e-05
Kwal_0.2123033171069e-05
CAGL0M04279g9401831081e-04
Scas_719.526281211071e-04
YLR129W (DIP2)9431771081e-04
Kwal_55.215593511941061e-04
AER114W633941062e-04
Kwal_23.5769627751052e-04
YDR142C (PEX7)375531042e-04
CAGL0C03608g6432331052e-04
AAL009C3033171032e-04
AGL196C9351661034e-04
CAGL0D02090g2771191004e-04
ADL322C5012361025e-04
ACR097W4671591016e-04
AGL190W3701251007e-04
Sklu_2317.3368501007e-04
YNL317W (PFS2)4651761007e-04
KLLA0A04928g8611871018e-04
Scas_713.509831791000.001
KLLA0D16390g936170990.001
Sklu_2382.2126199980.002
CAGL0M09845g93695980.002
Scas_660.851098970.002
Scas_693.3637548970.002
KLLA0B02827g942106960.003
Kwal_26.773650777950.003
Kwal_56.2389536748940.003
KLLA0D04840g303236940.003
CAGL0M08646g337198940.003
KLLA0F11231g43474940.004
CAGL0J04818g654120940.005
Scas_592.4*318109920.005
Scas_721.115*318109920.005
YGL100W (SEH1)349248920.005
Sklu_2423.1944106930.006
KLLA0E21263g42975930.006
Kwal_23.4118939100930.006
Sklu_1880.347180920.006
YMR116C (ASC1)319106920.006
Kwal_27.12586509102920.006
KLLA0E04741g45971920.007
Kwal_56.23920937177930.007
YNL006W (LST8)303237910.007
Scas_581.362659920.007
YLR409C (UTP21)939113920.007
Scas_659.947553910.009
CAGL0A02772g441122910.010
AAR057W92282910.011
Scas_585.8460213900.011
Scas_692.25488206900.012
Sklu_1926.5509140900.012
CAGL0H03729g303231890.012
AER263C51363900.012
YCR072C51563900.012
ACR137W425224900.013
KLLA0E07942g39087890.014
KLLA0E18139g32682890.014
Sklu_2384.332880880.015
YKL213C (DOA1)71577890.016
ABL044C518158890.016
KLLA0E03982g37248880.016
AER081C1023101900.017
Kwal_33.1513647378890.018
CAGL0D05588g47745880.020
KLLA0E24508g327154870.023
AGR207C32040870.023
AAL157C47945870.027
CAGL0K12188g53539870.027
YBR103W (SIF2)535184870.032
ADR090W123398870.033
YLL011W (SOF1)48978860.038
AGL024W756190860.040
KLLA0F05159g123179860.043
KLLA0E11297g512117850.044
YDR267C330134840.046
YGR200C (ELP2)78863850.050
KLLA0F15598g47878850.053
Scas_700.27*43395840.063
Scas_720.4575526840.064
Kwal_55.2145050379830.074
AAR102C591109840.076
Sklu_2406.11426144830.082
Scas_720.83d91568840.082
Sklu_2173.251563830.082
Kwal_26.877643375830.084
CAGL0M04081g455189830.085
Scas_719.3094095830.088
Sklu_1963.2314152820.091
Kwal_26.7570218143810.094
YDL195W (SEC31)127384830.097
Scas_695.15327238810.12
Sklu_2420.244174810.12
ACR166W38887810.13
CAGL0C02937g46770810.14
AGR180W80687810.14
Scas_652.16345250800.15
YMR093W (UTP15)51394810.16
YDR364C (CDC40)455242800.16
YPR137W (RRP9)573111810.16
Scas_512.3534179810.17
YPL151C (PRP46)45174800.18
YJL112W (MDV1)71447800.20
Kwal_23.632451463790.22
YBR175W (SWD3)315146780.24
AER035W1006134800.25
Kwal_55.22067451111780.29
Kwal_34.15818349221780.29
Scas_658.1442171780.31
Sklu_2416.5459134780.34
Scas_465.4100263780.35
YCR057C (PWP2)92368780.35
CAGL0M02277g42776780.36
ACR091W328171770.36
AER255C46775770.38
KLLA0A08866g42384770.39
Kwal_14.90632865760.42
Scas_685.1138464770.43
KLLA0F21406g705224770.43
Kwal_27.10785367151770.44
YKL021C (MAK11)46865770.46
Scas_720.95515196770.47
KLLA0E11143g493198760.54
Kwal_14.88439591760.55
YNL035C38943760.60
Kwal_56.2416372968760.61
CAGL0J03476g517152750.66
AER448W714138750.71
KLLA0D07546g647189750.72
CAGL0K11836g52251750.76
Sklu_2435.1357568750.77
Kwal_23.5351474219750.78
Kwal_26.8628422146750.81
CAGL0K09284g91181750.84
KLLA0E07766g49073740.86
CAGL0G04345g71130750.88
KLLA0B11077g567123750.89
CAGL0F06853g38881740.89
Kwal_27.12239316109740.89
Scas_718.6*54628740.99
Kwal_33.1351539832741.0
CAGL0L04950g80529741.1
YOR269W (PAC1)49476741.1
Scas_721.7325124731.1
Kwal_56.23207933154731.3
KLLA0D06787g436188731.4
Kwal_33.1559171462731.5
Scas_631.17474181721.5
KLLA0A01650g40125721.7
KLLA0C08976g91134721.8
AFL038C33026711.9
Kwal_47.1908332427711.9
CAGL0C00737g81682721.9
Scas_649.1080638722.0
Kwal_26.895345880712.1
KLLA0F13772g52088712.1
YFL009W (CDC4)779199712.2
Kwal_23.503574474712.2
YOR212W (STE4)423125712.2
Scas_558.372557712.3
Scas_684.751187712.3
Scas_595.3*555108712.3
CAGL0J10340g338142702.3
Kwal_33.1497181829712.3
KLLA0F06754g34437702.5
Kwal_47.1757243442702.5
Scas_603.5589191712.6
Kwal_33.1314867320712.6
KLLA0E23617g417193702.6
ACR162C86052712.7
KLLA0B14410g706161702.9
ADL218C40339703.1
YBR097W (VPS15)1454178703.2
Kwal_23.624091326703.2
YJL069C (UTP18)59425703.2
KLLA0F26653g79136693.7
YMR049C (ERB1)80729693.9
AEL153W56725693.9
CAGL0B03575g419143694.0
CAGL0L02761g419180694.1
KLLA0C07425g444153694.1
Scas_692.29456129694.2
CAGL0L09757g32665684.4
KLLA0F22000g793210694.4
YPL183C101388685.1
Kwal_33.15475783185685.5
CAGL0G01628g37643675.5
Sklu_2167.530364675.6
Kwal_14.161133426675.6
KLLA0F02013g56625685.7
Scas_646.1475523686.3
Kwal_56.2303542444676.3
Kwal_27.1155040752676.5
ADL184W449117677.0
CAGL0C01441g100567677.4
Kwal_0.4958425669.0
Sklu_1731.457625669.5
Scas_712.3439927659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR102C
         (820 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...  1498   0.0  
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...   634   0.0  
Scas_721.128                                                          595   0.0  
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...   509   e-168
Scas_717.68                                                           507   e-167
Kwal_26.7655                                                          487   e-161
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                         494   e-161
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...   403   e-128
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...   395   e-126
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...   226   2e-64
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    73   6e-13
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      68   2e-11
Scas_721.32                                                            64   3e-10
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    64   5e-10
Kwal_27.12053                                                          63   8e-10
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    62   1e-09
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    60   4e-09
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    56   1e-07
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    56   1e-07
Kwal_23.6429                                                           56   1e-07
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    56   1e-07
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    55   1e-07
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    54   4e-07
Scas_571.4                                                             54   4e-07
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    53   7e-07
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    52   1e-06
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    53   1e-06
Scas_704.40                                                            52   1e-06
Scas_624.11                                                            52   2e-06
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    52   2e-06
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    52   2e-06
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    52   2e-06
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    51   4e-06
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    51   4e-06
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    51   5e-06
Scas_630.6                                                             50   5e-06
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         50   5e-06
Kwal_56.24526                                                          50   6e-06
Scas_442.2*                                                            50   9e-06
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    49   1e-05
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    49   1e-05
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          49   1e-05
Scas_629.12                                                            48   2e-05
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    48   3e-05
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    47   3e-05
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    48   3e-05
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    47   3e-05
Scas_702.16                                                            48   3e-05
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    47   4e-05
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    47   6e-05
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    46   6e-05
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    47   6e-05
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            46   7e-05
Kwal_0.212                                                             45   9e-05
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    46   1e-04
Scas_719.52                                                            46   1e-04
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    46   1e-04
Kwal_55.21559                                                          45   1e-04
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    45   2e-04
Kwal_23.5769                                                           45   2e-04
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    45   2e-04
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    45   2e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    44   2e-04
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    44   4e-04
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    43   4e-04
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    44   5e-04
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    44   6e-04
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    43   7e-04
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            43   7e-04
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    43   7e-04
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    44   8e-04
Scas_713.50                                                            43   0.001
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    43   0.001
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         42   0.002
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    42   0.002
Scas_660.8                                                             42   0.002
Scas_693.36                                                            42   0.002
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    42   0.003
Kwal_26.7736                                                           41   0.003
Kwal_56.23895                                                          41   0.003
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    41   0.003
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    41   0.003
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    41   0.004
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    41   0.005
Scas_592.4*                                                            40   0.005
Scas_721.115*                                                          40   0.005
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    40   0.005
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             40   0.006
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    40   0.006
Kwal_23.4118                                                           40   0.006
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            40   0.006
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    40   0.006
Kwal_27.12586                                                          40   0.006
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    40   0.007
Kwal_56.23920                                                          40   0.007
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    40   0.007
Scas_581.3                                                             40   0.007
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    40   0.007
Scas_659.9                                                             40   0.009
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    40   0.010
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    40   0.011
Scas_585.8                                                             39   0.011
Scas_692.25                                                            39   0.012
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         39   0.012
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    39   0.012
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    39   0.012
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    39   0.012
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    39   0.013
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    39   0.014
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    39   0.014
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            39   0.015
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    39   0.016
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    39   0.016
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    39   0.016
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    39   0.017
Kwal_33.15136                                                          39   0.018
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    39   0.020
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    38   0.023
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    38   0.023
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    38   0.027
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    38   0.027
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    38   0.032
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    38   0.033
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    38   0.038
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    38   0.040
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    38   0.043
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    37   0.044
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    37   0.046
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    37   0.050
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    37   0.053
Scas_700.27*                                                           37   0.063
Scas_720.45                                                            37   0.064
Kwal_55.21450                                                          37   0.074
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    37   0.076
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      37   0.082
Scas_720.83d                                                           37   0.082
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            37   0.082
Kwal_26.8776                                                           37   0.084
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    37   0.085
Scas_719.30                                                            37   0.088
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         36   0.091
Kwal_26.7570                                                           36   0.094
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    37   0.097
Scas_695.15                                                            36   0.12 
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            36   0.12 
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    36   0.13 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    36   0.14 
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    36   0.14 
Scas_652.16                                                            35   0.15 
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    36   0.16 
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    35   0.16 
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    36   0.16 
Scas_512.3                                                             36   0.17 
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    35   0.18 
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    35   0.20 
Kwal_23.6324                                                           35   0.22 
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    35   0.24 
AER035W [2540] [Homologous to ScYOL087C - SH] complement(699524....    35   0.25 
Kwal_55.22067                                                          35   0.29 
Kwal_34.15818                                                          35   0.29 
Scas_658.1                                                             35   0.31 
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           35   0.34 
Scas_465.4                                                             35   0.35 
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    35   0.35 
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    35   0.36 
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    34   0.36 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    34   0.38 
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    34   0.39 
Kwal_14.906                                                            34   0.42 
Scas_685.11                                                            34   0.43 
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    34   0.43 
Kwal_27.10785                                                          34   0.44 
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    34   0.46 
Scas_720.95                                                            34   0.47 
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    34   0.54 
Kwal_14.884                                                            34   0.55 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    34   0.60 
Kwal_56.24163                                                          34   0.61 
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    33   0.66 
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    33   0.71 
KLLA0D07546g complement(647984..649927) some similarities with s...    33   0.72 
CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021 S...    33   0.76 
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         33   0.77 
Kwal_23.5351                                                           33   0.78 
Kwal_26.8628                                                           33   0.81 
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    33   0.84 
KLLA0E07766g 699154..700626 some similarities with sp|P40463 Sac...    33   0.86 
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    33   0.88 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    33   0.89 
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    33   0.89 
Kwal_27.12239                                                          33   0.89 
Scas_718.6*                                                            33   0.99 
Kwal_33.13515                                                          33   1.0  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    33   1.1  
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    33   1.1  
Scas_721.7                                                             33   1.1  
Kwal_56.23207                                                          33   1.3  
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    33   1.4  
Kwal_33.15591                                                          33   1.5  
Scas_631.17                                                            32   1.5  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    32   1.7  
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    32   1.8  
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    32   1.9  
Kwal_47.19083                                                          32   1.9  
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    32   1.9  
Scas_649.10                                                            32   2.0  
Kwal_26.8953                                                           32   2.1  
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    32   2.1  
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    32   2.2  
Kwal_23.5035                                                           32   2.2  
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    32   2.2  
Scas_558.3                                                             32   2.3  
Scas_684.7                                                             32   2.3  
Scas_595.3*                                                            32   2.3  
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    32   2.3  
Kwal_33.14971                                                          32   2.3  
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    32   2.5  
Kwal_47.17572                                                          32   2.5  
Scas_603.5                                                             32   2.6  
Kwal_33.13148                                                          32   2.6  
KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces...    32   2.6  
ACR162C [1209] [Homologous to ScYPL126W (NAN1) - SH] (637642..64...    32   2.7  
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    32   2.9  
ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887) [...    32   3.1  
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    32   3.2  
Kwal_23.6240                                                           32   3.2  
YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein ...    32   3.2  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    31   3.7  
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    31   3.9  
AEL153W [2353] [Homologous to ScYJL069C - SH] complement(343247....    31   3.9  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    31   4.0  
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    31   4.1  
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    31   4.1  
Scas_692.29                                                            31   4.2  
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    31   4.4  
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    31   4.4  
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    31   5.1  
Kwal_33.15475                                                          31   5.5  
CAGL0G01628g complement(151262..152392) similar to sp|P53962 Sac...    30   5.5  
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            30   5.6  
Kwal_14.1611                                                           30   5.6  
KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces c...    31   5.7  
Scas_646.14                                                            31   6.3  
Kwal_56.23035                                                          30   6.3  
Kwal_27.11550                                                          30   6.5  
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    30   7.0  
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    30   7.4  
Kwal_0.49                                                              30   9.0  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         30   9.5  
Scas_712.34                                                            30   9.7  
Scas_601.2                                                             30   9.8  

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 1498 bits (3877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/820 (88%), Positives = 729/820 (88%)

Query: 1   MTNMAEDKTSISKVHXXXXXXXXXXXXXXXXXXHQESFDXXXXXXXXXXXXXLNLEYSAD 60
           MTNMAEDKTSISKVH                  HQESFD             LNLEYSAD
Sbjct: 1   MTNMAEDKTSISKVHSEFSNSSNTTGSEEESRSHQESFDGESSSGESKSKSKLNLEYSAD 60

Query: 61  IEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDT 120
           IEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDT
Sbjct: 61  IEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDT 120

Query: 121 EQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGXXXXXXXXXXXXXXXAIWSTK 180
           EQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEG               AIWSTK
Sbjct: 121 EQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGETVTSTSKSSEPTSKAIWSTK 180

Query: 181 FSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPK 240
           FSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPK
Sbjct: 181 FSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPK 240

Query: 241 EKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKT 300
           EKQFLDSAT             APVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKT
Sbjct: 241 EKQFLDSATEKYEEKEKLLNLYAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKT 300

Query: 301 VKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQ 360
           VKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQ
Sbjct: 301 VKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQ 360

Query: 361 DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS 420
           DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS
Sbjct: 361 DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS 420

Query: 421 KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ 480
           KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ
Sbjct: 421 KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ 480

Query: 481 LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGXXXXXXXXXXXXX 540
           LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG             
Sbjct: 481 LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGSLRSIFSKSMSRS 540

Query: 541 XXQNNEEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLS 600
             QNNEEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLS
Sbjct: 541 SSQNNEEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLS 600

Query: 601 LSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSISNASATSAIPDV 660
           LSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSISNASATSAIPDV
Sbjct: 601 LSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSISNASATSAIPDV 660

Query: 661 VDAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEEYNREVRRXXXXXXXXXXXXXXX 720
           VDAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEEYNREVRR               
Sbjct: 661 VDAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEEYNREVRRRFNSSDSLHSLSRSF 720

Query: 721 XXRAKSNLAGQPAAAYTNTGKGYATGRGYSNICPKSSTSLKTLGSNAQPRTPRESMSSIF 780
             RAKSNLAGQPAAAYTNTGKGYATGRGYSNICPKSSTSLKTLGSNAQPRTPRESMSSIF
Sbjct: 721 NSRAKSNLAGQPAAAYTNTGKGYATGRGYSNICPKSSTSLKTLGSNAQPRTPRESMSSIF 780

Query: 781 SNAHGPTTPTSAMNLPIRCNVCNGSRFEAFSGANDQQDRN 820
           SNAHGPTTPTSAMNLPIRCNVCNGSRFEAFSGANDQQDRN
Sbjct: 781 SNAHGPTTPTSAMNLPIRCNVCNGSRFEAFSGANDQQDRN 820

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/677 (50%), Positives = 449/677 (66%), Gaps = 49/677 (7%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQ--Q 232
           AIWSTKFS DGK+MATGS+DG +R+WKV+ +PVER  LDSS +S     AKS+R++Q   
Sbjct: 306 AIWSTKFSIDGKYMATGSRDGVLRLWKVLSTPVERWGLDSSIDSAHLTSAKSLRLQQNQH 365

Query: 233 VSSLNNPKEKQFLDSAT-XXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNF 291
            SS   P     +   T              APVF PTP+R YKEH+ DVLD++WSKNNF
Sbjct: 366 GSSHGGPLGSPAMRRDTFDNIDAKENSSNLYAPVFQPTPVRTYKEHLHDVLDMDWSKNNF 425

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD 351
           ++SASMDKT KLWHP +  SLK+F HPDFVTCV+FHPTDDRFFISGCLD KCRLWSILDD
Sbjct: 426 LISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDD 485

Query: 352 EVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNA 411
           EVSFE++C+DL+TS+TL+P +G YTI+GTFNGY+H+L T+GL  ++SFHV  ++T E   
Sbjct: 486 EVSFEFNCRDLVTSLTLTPGDGTYTIVGTFNGYIHVLQTKGLEHITSFHVTAKKTHENTH 545

Query: 412 HVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFH 471
            V+    DSK+RHGPRVTGLQ F S +DNS RLVVTS+DSRIR+FDL +RKL+E+L+GF 
Sbjct: 546 EVLCPSNDSKVRHGPRVTGLQCFNSLIDNSLRLVVTSSDSRIRVFDLTRRKLIEILRGFQ 605

Query: 472 SGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGXXXX 531
            GSSQHKAQ+S++  QPIV+NSSDDHWVYGWRLKSSD    +   K K  G++RSG    
Sbjct: 606 CGSSQHKAQISVYRNQPIVINSSDDHWVYGWRLKSSDPV--EINKKAKKHGMSRSGSIRG 663

Query: 532 XXXXXXXXXXXQNNEEKP--HHHLKLTNLLPLPHHS-NDHYIKNTDYISFHAHNAPVTCV 588
                      Q +E++    + LKL++LLP+PH S +D  +KN+DY SFHAHNAPVT V
Sbjct: 664 LFSKSISRSSSQGSEDRQSLRNTLKLSSLLPIPHSSHSDGVMKNSDYFSFHAHNAPVTTV 723

Query: 589 SIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSI 648
           ++AP ETSKTLSLSND ICELSLEFF+ SD  D++        + D +   G+++ P + 
Sbjct: 724 TMAPEETSKTLSLSNDPICELSLEFFEPSDEVDIIK-------LKDTQKG-GHDNIPATK 775

Query: 649 SNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEEYNREVRRXXX 708
           +  + + A P  V+ IG+ILISTD+ G IRVFRADM   IR RVL KL++YNRE+ +   
Sbjct: 776 TPVTTSLAKPTPVEVIGSILISTDSNGLIRVFRADMSKSIRARVLQKLQKYNREMGK--- 832

Query: 709 XXXXXXXXXXXXXXRAKSNLAG---QPAAAYTN--------------TGKGYATGRGYS- 750
                         +++ NL     QP+   T+              +G   +  R +S 
Sbjct: 833 -QYGSTDSLVSENDKSRPNLGTVGHQPSTNSTSFLSSTGSTNTTTVGSGSKASITRNHSF 891

Query: 751 -----NICPKSSTSLKTLGSNAQPRTPRESMSSIFSNAHGPT-TPTSAMNLP-IRCNVCN 803
                   P ++ S   LG+    R PRES+SS+ S++   T TP   M+ P ++C+VC+
Sbjct: 892 RSLKAFKSPTANFSNTALGATMN-RAPRESISSVRSDSTSNTMTP---MSFPGLKCHVCD 947

Query: 804 GSRFEAFSGANDQQDRN 820
           G++FE  + ++  QD++
Sbjct: 948 GTKFEPLTRSSGSQDKS 964

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 79/139 (56%), Gaps = 40/139 (28%)

Query: 56  EYSADIEPLKFRM----------TKTNNTNDKLKYSNNG--------------------- 84
           EYSADI+PL+F+M          T+++  + K   S NG                     
Sbjct: 90  EYSADIQPLQFKMSRRRTTQFDGTESSKASRKANASGNGSDPIKTLRFDEGSLSSSPTAI 149

Query: 85  --NAT------DSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDTEQFENYLREPKYIKML 136
             +AT      D+F +++EH+QRG+  NS L  ++F PF  ID EQFE YL+EP+YI++ 
Sbjct: 150 ASDATRASLQRDTFAKVREHIQRGSVGNSGLTRSDFNPFAFIDREQFETYLKEPRYIRIF 209

Query: 137 KRR-KNLKQFRRLFLAQEL 154
           K+R ++ KQFRRLFLAQEL
Sbjct: 210 KKRSRSSKQFRRLFLAQEL 228

>Scas_721.128
          Length = 851

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/799 (42%), Positives = 461/799 (57%), Gaps = 66/799 (8%)

Query: 54  NLEYSADIEPLKFRMTKTNNTNDKLKYSNNGNA-TDSFMRLKEHLQRGNTLNSNLRVNEF 112
           NLEYSAD++PLKF+MT+T +  +   +    +A  DSF +++  LQ+          +  
Sbjct: 54  NLEYSADLQPLKFKMTRTPDLEEVPSHVKTASADVDSFYKVRNRLQK--------IADPS 105

Query: 113 YPFNSIDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGXXXXXXXXXXXXX 172
           + F+SID EQFE YL+EP+YIK+ K+ ++L++F+RLFLAQEL                  
Sbjct: 106 WNFSSIDQEQFEIYLKEPEYIKVFKKHEDLEEFKRLFLAQELNVTTTKENDPTAQNTDAS 165

Query: 173 XXAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQ 232
             AIW+ KFS DGK+MATGSKDG + +WKVI SPVER ELD + ESN  A AKS+RIKQ 
Sbjct: 166 NKAIWTLKFSHDGKYMATGSKDGCVMLWKVISSPVERWELDRAEESNLVAMAKSIRIKQN 225

Query: 233 VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFI 292
           + +     E      +              AP+FHP P+R+YKEH  D+LD++WSKNNF+
Sbjct: 226 LET----NEAHLNAPSRPPTDTNLESLNLYAPIFHPNPVRIYKEHSHDILDLDWSKNNFL 281

Query: 293 LSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352
           L+ASMDK V LWHPDR+ SLK+F HPDFVT V FHP DDRFF+SGCLDHKCR+WSIL+++
Sbjct: 282 LTASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENK 341

Query: 353 VSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAH 412
           V +E+DCQDLIT++++SP  G++TIIGTFNGY+ IL T  L P+ +FHV D+  Q  + +
Sbjct: 342 VVYEFDCQDLITAISISPGVGEFTIIGTFNGYITILSTFELKPLYTFHVLDKHMQGNSGN 401

Query: 413 ----VMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLK 468
                 +   + K  HGPRVTGLQ F  +  +  +L+V+S DSRIRIFDLE+ KL+EV K
Sbjct: 402 DSSFKNLLGQNLKNHHGPRVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVFK 461

Query: 469 GFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG- 527
           GF SG SQH AQLS W  QPIV+NSS DHW Y W++ +S+ +  Q+    + + L+  G 
Sbjct: 462 GFRSGLSQHNAQLSNWGDQPIVINSSKDHWFYAWKINTSNPKTTQNFSSIRQERLSTGGG 521

Query: 528 --------XXXXXXXXXXXXXXXQNNEEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFH 579
                                    +    HH L   + L LPH S  H +KN+ Y++FH
Sbjct: 522 LNDLLNKSSEKKETTHELSRTSTAGDSSTRHHFLPSLSRL-LPHSS--HVVKNSHYVAFH 578

Query: 580 AHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSL 639
           AH+APV+  +IAP ET+KTLSLSND ICEL+L+  +     D+   +      S+  SS+
Sbjct: 579 AHHAPVSTATIAPQETAKTLSLSNDFICELTLQVME-----DIRKTTTGSSDSSNGRSSV 633

Query: 640 GYNSKPGSISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEEY 699
                    S  + TS IPD V+AIG IL++TD  GTIRVFR DM +  R RVL KL++Y
Sbjct: 634 DKKKNASEKSLPTVTSGIPDAVNAIGPILVTTDTRGTIRVFRVDMSNATRSRVLKKLQDY 693

Query: 700 NREVRRXXXXXXXXXXXXXXXX----------------XRAKSNLAG-QPAAAYTNTGKG 742
            +  +                                  R+++N  G Q   +    G  
Sbjct: 694 KQNSQDIIDSATTLNPLNASDSEGAINTTPLIQVNSIPQRSRTNQNGSQTNGSVQRNGSI 753

Query: 743 YATGRGYSNICPKSSTSL-------KTLGSNAQPRTPRESMSSIFSNA---HGPTTPTSA 792
              G G     P+ STS             ++  R+ + S+ S+ S+A   H  + P+  
Sbjct: 754 SNNGTGTGPKSPRPSTSFTNAIFNRSNSSFSSSNRSRKPSIQSVMSDAEELHHGSRPSR- 812

Query: 793 MNLPIRCNVCNGSRFEAFS 811
               ++C+VC+G  FE  S
Sbjct: 813 ----LKCDVCDGINFEPLS 827

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score =  509 bits (1310), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 309/801 (38%), Positives = 435/801 (54%), Gaps = 82/801 (10%)

Query: 57  YSADIEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSN----LRVNEF 112
           YSADI P + R        D + Y           RL++ L R N++ SN    L  N+ 
Sbjct: 64  YSADIIPAQLRFI------DNIDYG---------TRLRKTLHR-NSVVSNGYNKLSENDR 107

Query: 113 YPFNSIDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQEL--------MAYEGXXXXX 164
           + F+  D + FENYL EP YIK+ K+++ L+QF R+FLAQEL          Y+G     
Sbjct: 108 WYFDLFDRKYFENYLEEPTYIKIFKKKEGLEQFDRMFLAQELKIPDVYKSTTYQGEPAVA 167

Query: 165 XXXXXXXXXXAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARA 224
                     +I    FS DGK+M  G KDG + +WKVI SPV+R+E+  S +S   +RA
Sbjct: 168 NSELFKN---SICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSEKSVSASRA 224

Query: 225 KSMRIKQQVSSL--NNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVL 282
            S++I++ ++S+  +N          +             APVF+    R++ EH  D+L
Sbjct: 225 NSLKIQRHLASISSHNGSISSNDLKPSDQFEGPSKQLHLYAPVFYSDVFRVFMEHALDIL 284

Query: 283 DINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHK 342
           D NWSKN F+++ASMDKT KLWHP+RK SLKTF+HPDFVT   F P DDRF I+GCLDH+
Sbjct: 285 DANWSKNGFLITASMDKTAKLWHPERKYSLKTFVHPDFVTSAIFFPNDDRFIITGCLDHR 344

Query: 343 CRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVA 402
           CRLWSILD+EVS+ +DC+DLITS+TLSP  G+YTIIGTFNGY+++L+T GL  VSSFHV+
Sbjct: 345 CRLWSILDNEVSYAFDCKDLITSLTLSPPGGEYTIIGTFNGYIYVLLTHGLKFVSSFHVS 404

Query: 403 DRQTQEQNAHVMVTETD-SKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQR 461
           D+ TQ    +     ++  K++HGPR+TGLQ F S++D + RL+VT+NDS+I+IFDL ++
Sbjct: 405 DKSTQGTTKNSFHPSSEYGKVQHGPRITGLQCFFSKVDKNLRLIVTTNDSKIQIFDLNEK 464

Query: 462 KLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWRLKSSD--RENDQDEPKRK 519
           K LE+ KGF SGSS+H+ Q  +   +P+V   SDDHW Y W+++S +   E +   P RK
Sbjct: 465 KPLELFKGFQSGSSRHRGQFLMMKNEPVVFTGSDDHWFYTWKMQSFNLSAEMNCTAPHRK 524

Query: 520 P--------KGLARSGXXXXXXXXXXXXXXXQNNEEKPHHHLKLTNLLPLPHHSNDHYIK 571
                    KGL R                  +N+   H     +  +          IK
Sbjct: 525 KRLSGSMSLKGLLR---IVSNKSTNDECLTETSNQSSSHTFTNSSKNVLQTQTVGSQAIK 581

Query: 572 NTDYISFHAHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFF-QTSDSFDVLSRSNDDG 630
           N  YISFHAHN+PVTC SIAP    K LSLSND+I EL+ ++F +   ++     + D+ 
Sbjct: 582 NNHYISFHAHNSPVTCASIAPDVAIKNLSLSNDLIFELTSQYFKEMGQNYSESKETCDNK 641

Query: 631 IMSDVESSLGYNSKPGSISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRK 690
               V  + G+            +S + +VV+ +GTILI+TD+ G IRVFR D+   IRK
Sbjct: 642 PNHPVTETGGF------------SSNLSNVVNNVGTILITTDSQGLIRVFRTDILPEIRK 689

Query: 691 RVLLKLEEYN---REVRRXXXXXXXXXXXXXXXXXRAKS---NLAGQPAAAYTNTGKGYA 744
           +++ K  EYN    E                    R+ +     +  P +   N+   + 
Sbjct: 690 KIIEKFHEYNLFHLEAAGKINNHNNDSILENRMDERSSTEDNEFSTTPPSNTHNSRPSHD 749

Query: 745 TGRGYSNICP-------------KSSTSLKTLGSNAQPRTPRESMSSIFSNAHGPTTPTS 791
               + N  P             K+S   K+ GS    ++  ES SS     H    P  
Sbjct: 750 FCELHPNNSPVISGMPSRASAIFKNSIFNKSNGSFISLKSRSESTSSTVFGPHD--IPRV 807

Query: 792 AMNLP-IRCNVCNGSRFEAFS 811
           +   P ++C+VCNGS FE  S
Sbjct: 808 STTYPKLKCDVCNGSNFECAS 828

>Scas_717.68
          Length = 908

 Score =  507 bits (1305), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 273/588 (46%), Positives = 367/588 (62%), Gaps = 55/588 (9%)

Query: 263 APVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVT 322
           APVF+P+  +++KEH  DVLD++WSKNNF++++SMD+TVKLWH +R+ SLKTF H DFVT
Sbjct: 313 APVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVT 372

Query: 323 CVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFN 382
           CV FHPTDDRFFISGCLDHK RLWSIL++E++FE+DCQDLITS+TLSP +GKYTI+GTFN
Sbjct: 373 CVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTFN 432

Query: 383 GYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSF 442
           GYVH+L+T+GL  VSSFHV D+ TQE+N         +KI HGPRVTGL+ F+ + DNS 
Sbjct: 433 GYVHVLLTKGLEQVSSFHVVDKNTQERNT------ASTKIHHGPRVTGLECFKYEPDNSL 486

Query: 443 RLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGW 502
           R+VVTS+DSRIRIFDLE++KLLE LKGF SG+SQHKA L+   GQ +V++SSDDHWV+GW
Sbjct: 487 RIVVTSSDSRIRIFDLEKKKLLEYLKGFQSGASQHKACLATVKGQQVVLSSSDDHWVHGW 546

Query: 503 RLKS------SDRENDQDE--------PKRKPKGLARSGXXXXXXXXXXXXXXXQNNEEK 548
           +LKS      S++ N+ D+         K     ++RSG                 +E  
Sbjct: 547 KLKSSTSLTESEKNNNIDQTAATTTTTKKSNSHSISRSGSFRSLFSKSSKKDNI--DENG 604

Query: 549 PHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLSLSNDVICE 608
            H HLKLT+L+P  H+ +   IKN+D ISFHAH+APVT   +AP  T+KTLSLSND I E
Sbjct: 605 KHSHLKLTSLIPHCHNGST-VIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSNDFIYE 663

Query: 609 LSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSISNASATSAIP---DVVDAIG 665
           LS EF   S  F++ + S+   + +      G + K    S++S+ + +P     VD IG
Sbjct: 664 LSSEFAMESRDFEMNTNSDTHSVTTS-----GSSDKSKIRSHSSSATLVPPSISAVDLIG 718

Query: 666 TILISTDNVGTIRVFRADMPSVIRKRVLLKLEEYNREVRRXXXXXXXXXXXXXXXX---- 721
           +I+++TDN G IRVFRAD+ S IRK+VL  L++  +E  R                    
Sbjct: 719 SIIVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAPTTVTT 778

Query: 722 --------------XRAKSNLAGQPAAAYTNTGKGYATGRGYSNICP----KSSTSLKTL 763
                          RAKS+ A    A      +  +  R   +  P     S T+   L
Sbjct: 779 GPTGHAKSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCTNFNNL 838

Query: 764 GSNAQPRTPRESMSSIFSNAHGPTTPTSAMNLPIRCNVCNGSRFEAFS 811
                  +PRES++S   +  G     + + + +RC+VC+G RFEA +
Sbjct: 839 NFTIGSGSPRESVTSF--DIDGEHVTNNPIKMGVRCDVCHGMRFEAIT 884

 Score =  146 bits (368), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 111/204 (54%), Gaps = 30/204 (14%)

Query: 54  NLEYSADIEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEF- 112
           N +YSADI+PL+F+M     T D+   S    A  S +R           N +++  ++ 
Sbjct: 46  NSKYSADIKPLQFKMNHVPGTRDRKHISYAAAAPSSSLRS----------NGSMKGQKYS 95

Query: 113 YPFNSIDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGXX----------- 161
           Y FNSID +QFE YL EP YIK+LKRRKNLK FRRLFLAQEL A++              
Sbjct: 96  YLFNSIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQING 155

Query: 162 --------XXXXXXXXXXXXXAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELD 213
                                AIW TKFS DGKFMA+  K G IR+WKV+ SP+ER EL 
Sbjct: 156 LQSPPLTPTSSSSNLNALADRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELG 215

Query: 214 SSAESNKEARAKSMRIKQQVSSLN 237
           SS +SN     KS R++ Q+ S N
Sbjct: 216 SSVDSNNATLVKSKRLRSQMFSSN 239

>Kwal_26.7655
          Length = 743

 Score =  487 bits (1254), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 270/618 (43%), Positives = 372/618 (60%), Gaps = 44/618 (7%)

Query: 94  KEHLQRGNTLNSNLRVNEFYPFNSIDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQE 153
           KE  Q  + LN ++ +     F  I+ EQF  YL+EPKY+K+  R+  +KQFRRLFLAQE
Sbjct: 92  KEREQAHSRLNDHIDLTLNNVFGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQE 151

Query: 154 LMAYEG----XXXXXXXXXXXXXXXAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVER 209
           L  +                     A+W+TKFSRDGK+MATG KD  +R+WKVI SP+ER
Sbjct: 152 LRLHASDLTSSSSTTLSTLSENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLER 211

Query: 210 AELDSSAESNKEARAKSMRIKQQVSSLNNPKEK--QFLDSATXXXXXXXXXXXXXAPVFH 267
            +L SSA +  +A+  SMR+    +   + KE+  Q +  A+             APVFH
Sbjct: 212 NDL-SSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPASMDLY---------APVFH 261

Query: 268 PTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFH 327
           P P R+Y+EH QD+LD++WSKN FIL+ SMDKT +LWH DR  +LK F HPDFVTC +FH
Sbjct: 262 PLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFH 321

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
           P DDRFFISGCLDH  RLWSILD+ VSF+Y C D+IT++  SP +GKYT  GTFNG++ I
Sbjct: 322 PNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIII 381

Query: 388 LMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKI-RHGPRVTGLQAFRSQLDNSFRLVV 446
           L TRGL  VS+FHV ++             T  K+   GP++TG++ F+S  DN  R++V
Sbjct: 382 LYTRGLEMVSTFHVLEKPNG----------TTKKVPESGPKITGIEFFKSAPDNDLRIMV 431

Query: 447 TSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPI-VVNSSDDHWVYGWRLK 505
           TSNDSRIRIF ++ + LLEVLKGF +  SQ  A L +   + I V+  S++ WVY WR++
Sbjct: 432 TSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCWRVE 491

Query: 506 SSDRENDQDEPKRKPKGLARSGXXXXXXXXXXXXXXXQNNEEKPHHHLKLTNLLPLPHHS 565
           SS   ++ D+ +    G  R G               Q+ E + + +   ++ L LP  +
Sbjct: 492 SSAGVSNSDDSQN--NGTHRRGSIRGLLQRSLSIGSSQSPERQEYKNGSHSHSLHLPSPT 549

Query: 566 ----NDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFD 621
                D YIKN  YI+FHAH   VT  ++AP  T+KTL+LS+D ICEL++   +T +   
Sbjct: 550 AKSKGDQYIKNQHYIAFHAHRCTVTTTAVAPVNTNKTLALSDDFICELTMALSETDEDVA 609

Query: 622 VLSRSNDDGIMSDVESSLGYNSKPGSISNASATS-AIPDVVDAIGTILISTDNVGTIRVF 680
            L +     ++         +SK GS  +        P ++DAIGTI++STDN G IRVF
Sbjct: 610 FLKQQRRKSLI---------HSKKGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVF 660

Query: 681 RADMPSVIRKRVLLKLEE 698
           R+D+ + +RK+VL  L+E
Sbjct: 661 RSDISTNVRKKVLKCLKE 678

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score =  494 bits (1272), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 322/845 (38%), Positives = 443/845 (52%), Gaps = 107/845 (12%)

Query: 53  LNLEYSADIEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVN-- 110
           L+  YSADI PL+F+M+ T   N        G    +   + + L  G  L+S  R N  
Sbjct: 110 LSNHYSADIAPLRFKMSMTRLDN-AAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIA 168

Query: 111 --------------------EFYPFN------SIDTEQFENYLREPKYIKMLKRRKNLKQ 144
                               + Y F+      SI+ +QFE YL+EP+YIK+ K+RK LKQ
Sbjct: 169 VKPDKISRVTKNPTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQ 228

Query: 145 FRRLFLAQELMA-------------YEGXXXXXXXXXXXX-------------XXXAIWS 178
           FRR FLAQEL                +G                            ++WS
Sbjct: 229 FRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVASSASIATLSSSSPTGSSSSSAGKSVWS 288

Query: 179 TKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNN 238
            KFS+DG+F+ATG KD  +RIWKVI SP ER ELDSS  + K ++   M   + +S   +
Sbjct: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSS--TMKPSKTVCMLNGKLISYSRD 346

Query: 239 PKEKQFL----------DSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK 288
             +  F           DS               APVFHP P R +  H QD+LDI+WSK
Sbjct: 347 VPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK 406

Query: 289 NNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           NNF+L+ SMDKTVKLWH DRK  LK F HPDFVTCV+FHP DDRFFISGCLDHK RLWSI
Sbjct: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466

Query: 349 LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQE 408
           LDDEVSFE+DC DLITS+ +SP + KYTI+GTFNGYV +L+TRGL  V SFH++D+Q ++
Sbjct: 467 LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKK 526

Query: 409 QNAHVMVTETD-----SKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKL 463
                 VT  D     +   HGP+VTG++ FR+  D + +L+VTSNDS+IR+F+L+   L
Sbjct: 527 GKD---VTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNIL 583

Query: 464 LEVLKGFHSGSSQHKAQLSIW--HGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPK 521
            EVLKGF + SSQ  A L     + Q  V+  S+DHW+Y W+L+SS    D+D+     K
Sbjct: 584 QEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGK 643

Query: 522 -GLARSGXXXXXXXXXXXXXXXQNNEEKPHHHLKLTNLLPLPHHS-----NDHYIKNTDY 575
             L RSG                ++  +     + ++   L          + ++KN +Y
Sbjct: 644 NSLPRSGSLRGLLHRKLSIGSNHSDSNRSFSKSQKSHYHHLHLPHPHHSRENQHLKNNEY 703

Query: 576 ISFHAHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIM--- 632
           I+FHAH+ P+T    APPET++TLSLSND ICEL++EF +  D   +++  N        
Sbjct: 704 IAFHAHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNKKQKQKKK 763

Query: 633 --SDVESSLGYNSKPGSISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRK 690
             +D+          G +   +    IP V + IG IL+++D+ G IRVFR+D+ + IRK
Sbjct: 764 KDADIAQEDDACDNDGDV--GTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRK 821

Query: 691 RVLLKLEEYN----REVRRXXXXXXXXXXXXXXXXXRAKSNLAGQPAAAYTNTGKGYATG 746
           RVL KL+E +     + +                   A  NL        TNT K  A  
Sbjct: 822 RVLAKLQEEDVKDATDKKNRNSVSISEVNDEIASAVHALGNLT-------TNTVK--AAT 872

Query: 747 RGYSNICPKSSTS-LKTLGSNAQPRTPRESMSSIFSNAHGPTTP---TSAMNLPIRCNVC 802
            G++  CP  + S   ++ S +  R+ + S +    ++   TT     +A +  +RC+VC
Sbjct: 873 AGFNKSCPMGNYSHSNSVLSLSTMRSSKSSTAQSIPSSQETTTEHVLPAASDSQMRCDVC 932

Query: 803 NGSRF 807
            G  F
Sbjct: 933 GGVNF 937

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score =  403 bits (1036), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 240/681 (35%), Positives = 360/681 (52%), Gaps = 105/681 (15%)

Query: 118 IDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGXXXXXXXXXXXXXXX--- 174
           +  E F+ +L+  +++K+ +++K  KQFRRL LAQEL  +                    
Sbjct: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTATEPM 123

Query: 175 ----AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSM-RI 229
               A+W  +FS DGKFMAT  KD  +RIWKVI SP ER EL+  + S  ++ A ++ ++
Sbjct: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL 183

Query: 230 KQQVS---------SLNNPKEKQFLDSATXXXXXXXXXXXXXAP---------------- 264
             Q++         SLN+      +DS                P                
Sbjct: 184 NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGL 243

Query: 265 ------VFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHP 318
                 VFHP PL  + EH  D+LDI+WSKN+FIL+ SMDK+ KLWH  R  SLKTF+H 
Sbjct: 244 GDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHS 303

Query: 319 DFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTII 378
           DFVT V FHP DDRFF+S CLD KCRLWSIL+ +V FEYDC DLIT++ +S  +G YTI+
Sbjct: 304 DFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDIS-YDGNYTIL 362

Query: 379 GTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAH----VMVTETDSKIRHGPRVTGLQAF 434
           GTFNGY+H+L+T+ L  + SF+V D+ ++ +  H     +  ++  K ++GP++TGL+  
Sbjct: 363 GTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFI 422

Query: 435 R--------SQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWH- 485
           +        S  D S   +V+SNDSRIRI+ L Q + + V+KG  +  SQ  A  ++   
Sbjct: 423 QKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRS 481

Query: 486 GQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGXXXXXXXXXXXXXXXQNN 545
           G+  VV+ S+DHW+Y W+L     ++ +   K      +RSG               +NN
Sbjct: 482 GKAYVVSGSEDHWIYCWKLSDEVVKSTETSSKDSKSTRSRSG-------SLRSFCRRRNN 534

Query: 546 EEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLSLSNDV 605
           +      L    +L   +  N     N++YI FHAH+ P+TC +  P + +K LSLSND+
Sbjct: 535 DSVASETLDA--VLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDL 592

Query: 606 ICELSLEFFQTSDSFDVLSR-------------SNDDGIMSDVESSL----------GYN 642
           ICEL+++F++T+D F + S              S++DG  +D    +          G +
Sbjct: 593 ICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKS 652

Query: 643 SKPGSISN-----------------ASATSAI--PDVVDAIGTILISTDNVGTIRVFRAD 683
              G+ SN                  + T+A   P +++ IG I++S D  G IRVFR+D
Sbjct: 653 GVSGAQSNNVPNIQISDGDNRTTNAVNGTTAANPPSLIEFIGGIVVSADTTGVIRVFRSD 712

Query: 684 MPSVIRKRVLLKLEEYNREVR 704
           + S +RK+VL +L    ++++
Sbjct: 713 ISSNVRKKVLNRLNAIEKQLK 733

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score =  395 bits (1015), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/586 (37%), Positives = 330/586 (56%), Gaps = 33/586 (5%)

Query: 123 FENYLREPKYIKMLKRRKNLKQFRRLFLAQELM--------AYEGXXXXXXXXXXXXXXX 174
              +  EP+YIK+L R+K  + FRRLF+AQEL         A                  
Sbjct: 51  LRRFAAEPEYIKVLARKKGARCFRRLFVAQELQPPVDSPLHANHSSQSLGQAAPAGDKAR 110

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           ++W  +FS+DGK++A+G K  ++ +WKVI SP+ER  L      +K        + QQ+ 
Sbjct: 111 SVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVYGGDKHHSNTLSLLNQQLL 170

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILS 294
             +  + +                    APVFHP P R++ EH+QD+LD +WSKN+F+L+
Sbjct: 171 KYSGKRTEAVPAPGPERKEIPFDLEQQYAPVFHPDPHRVFGEHLQDILDCDWSKNSFLLT 230

Query: 295 ASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVS 354
           ASMDKTVKLWH +R  SLKTF+HPDFVTCV FHP DDRFF SGCLDH  R WSIL+ EV+
Sbjct: 231 ASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVA 290

Query: 355 FEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVM 414
             ++C DLI ++ +SP +G + +IGTFNGYVH+L T GL  + SFH+     Q+ N    
Sbjct: 291 EAFNCGDLIMALDVSP-DGNWLLIGTFNGYVHVLHTNGLKLLHSFHL----LQKPN---- 341

Query: 415 VTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
             ET+++ RHGP++TG++  R +      L++TSNDSR+R+FD+   +LLE+ +GF + S
Sbjct: 342 --ETENRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRLLEIFRGFSNES 399

Query: 475 SQHKA-QLSIWHGQPIVVNSSDDHWVYGWRLKSSD---RENDQDEPKRKPKGLARSGXXX 530
           S+  A  L +  G+ +V+++S++HW+Y W L   +     +D D  +  P  +       
Sbjct: 400 SRISAHHLEMEDGESVVLSASENHWLYTWMLHHEEYMYSHSDLDNARTVPSPIDGKDPKK 459

Query: 531 XXXXXXXXXXXXQNNEEKPHHHLKLTNLLPLPHHSNDH---YIKNTDYISFHAHNAPVTC 587
                        N++     +    +  PL HH   H    +KN++YI+FHAH+ PVT 
Sbjct: 460 HSIRNIFRRSISFNSDILSESNPVARHHFPLFHHKAQHKGGCVKNSEYITFHAHHNPVTA 519

Query: 588 VSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGS 647
            +IAP ET+  LSLS+D+ICEL+++F    ++ + L   +     S    S  +     +
Sbjct: 520 ATIAPKETTHVLSLSDDIICELNMKF--GGEALEHLRTKSIREPGSPAGRS-DHKRNHSA 576

Query: 648 ISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRKRVL 693
             N S ++A  +V    GTI++S    G IRVFR D+ S +R + L
Sbjct: 577 EKNYSQSTAKQNV----GTIIVSAAATGQIRVFRTDVSSSVRAKAL 618

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score =  226 bits (577), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 214/426 (50%), Gaps = 88/426 (20%)

Query: 105 SNLRVNEFYPFNSIDTEQFENYLREPKYIKMLKRRKN--LKQFRRLFLAQELMAYEGXXX 162
           S +++N+   F   D +QFE YL  P Y+K+LK++ +  +  F+RLFLAQEL        
Sbjct: 27  SRVQINDVTNF---DHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQL------ 77

Query: 163 XXXXXXXXXXXXAIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEA 222
                       ++  ++FS+DG     G KDG + + KV+ +  E+  + S AE  +  
Sbjct: 78  ---------GGSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGI-SDAECEETG 127

Query: 223 RAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLY----KEHV 278
           + K                                     AP+F+   +       K H 
Sbjct: 128 KRK----------------------------------IQYAPIFNELDIVSLNSDEKVH- 152

Query: 279 QDVLDINWSKNNFILSASMDKTVKLWHP-DRKNSLKTFIHPDFVTCVEFHPTDDRFFISG 337
           ++VLD++WS N+F+L +S+D  V LW P D    +  F HPD VT  +F   DDRFFISG
Sbjct: 153 REVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISG 212

Query: 338 CLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVS 397
           CLDH  R WS+ D+ V + ++C++ I  VT+SP    +T++GTF GY+++  T GL  + 
Sbjct: 213 CLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLID 272

Query: 398 SFHVADRQTQEQNAHVMVTETDSKIRHGP---RVTGLQAFRS-------QLDNSF---RL 444
            FH+ + ++            D  +R+G    ++TG++   +       Q DN +   R+
Sbjct: 273 KFHIINGRS-----------IDGNLRNGADKIKITGIEWIVTDNRLDEIQEDNEYSTARI 321

Query: 445 VVTSNDSRIRIFDLEQRKL--LEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGW 502
           VVTS D RIR+F L +     LE LKGFH    +H+AQL IW  +P +  SS+D W Y W
Sbjct: 322 VVTSGDERIRVFKLTEGGYHNLE-LKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVW 380

Query: 503 RLKSSD 508
           RL   D
Sbjct: 381 RLNYQD 386

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 33/127 (25%)

Query: 567 DHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRS 626
           ++ ++++   SFHAH+ P+T V+IAP  T   ++ SND I E +   +  +         
Sbjct: 485 NYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVE------- 537

Query: 627 NDDGIMSDVESSLGYNSKPGSISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPS 686
                + DVE                      D  D IG I+++TD+VG +RVFR D+  
Sbjct: 538 -----LRDVEM---------------------DSCDIIGPIVVTTDSVGKLRVFRTDLSD 571

Query: 687 VIRKRVL 693
           + R+ ++
Sbjct: 572 IARETLI 578

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 101/213 (47%), Gaps = 17/213 (7%)

Query: 180 KFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQ--VSSLN 237
           +FS D + +A G +D  I++W + G+P+E ++L S A   K+A      I     V S++
Sbjct: 494 RFSDDSRLVAAGFQDSYIKLWSLDGTPLE-SQLPSKA---KDASNTVTLIGHSGPVYSVS 549

Query: 238 NPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFILSAS 296
              + ++L SA+                   T L  YK H   V D+ +S   ++  + S
Sbjct: 550 FSPDNRYLVSASEDKTVRLWSLDTY------TCLVSYKGHNHPVWDVKFSPLGHYFATGS 603

Query: 297 MDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-LDDEVS 354
            D+T +LW  D    L+ F  H + V CV FHP +  + ++G  D  CR+W I   D V 
Sbjct: 604 HDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHP-NGTYVLTGSSDKTCRMWDIQTGDSVR 662

Query: 355 FEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
                   + SV +SP +G++   G+ +G + +
Sbjct: 663 LFLGHTASVVSVAVSP-DGRWLTTGSEDGVIIV 694

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIW 200
           +W  KFS  G + ATGS D   R+W
Sbjct: 587 VWDVKFSPLGHYFATGSHDQTARLW 611

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 96/214 (44%), Gaps = 19/214 (8%)

Query: 180 KFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRI---KQQVSSL 236
           +FS D    A G +D  I++W + G+P     LDS   S +  +  +  +      V S 
Sbjct: 428 EFSDDATLAAAGFQDSYIKLWSLDGTP-----LDSKLPSKQREKINNTTLIGHSGTVYST 482

Query: 237 NNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFILSA 295
           +   + ++L SA+             + +        YK H   V D+++S   ++  +A
Sbjct: 483 SFSPDNKYLLSASEDKTVRLWSMDTYSSLVS------YKGHNHPVWDVSFSPLGHYFATA 536

Query: 296 SMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-LDDEV 353
           S D+T +LW  D    L+ F  H + V CV FHP +  +  +G  D  CR+W I   D V
Sbjct: 537 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHP-NGTYVFTGSTDKTCRMWDIGTGDSV 595

Query: 354 SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
                    + S  +SP +G++   G+ +G +++
Sbjct: 596 RLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINV 628

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 72/175 (41%), Gaps = 24/175 (13%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSS 235
           ++ST FS D K++ + S+D  +R+W +        +  SS  S K            V  
Sbjct: 479 VYSTSFSPDNKYLLSASEDKTVRLWSM--------DTYSSLVSYKGH-------NHPVWD 523

Query: 236 LNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FILS 294
           ++      +  +A+              P      LR++  H+ DV  +++  N  ++ +
Sbjct: 524 VSFSPLGHYFATASHDQTARLWSCDHIYP------LRIFAGHLNDVDCVSFHPNGTYVFT 577

Query: 295 ASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
            S DKT ++W     +S++ F+ H   V      P D R+  +G  D    +W I
Sbjct: 578 GSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINVWDI 631

>Scas_721.32
          Length = 822

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 95/218 (43%), Gaps = 16/218 (7%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSS-----AESNKEARAKSMRIKQQ 232
           S +FS D + +A G +D  I++W + GS +++ +  S+      + N       +     
Sbjct: 492 SLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSGA 551

Query: 233 VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNF 291
           V S +   + ++L S +                   T L  YK H   V D+ +S   ++
Sbjct: 552 VYSTSFSPDNRYLLSGSEDKTVRLWSTDTY------TSLVSYKGHNHPVWDVQFSPLGHY 605

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-L 349
             +AS D+T +LW  D    L+ F  H   V CV FHP +  +  +G  D  CR+W I  
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHP-NGCYVFTGSSDKTCRMWDIST 664

Query: 350 DDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
            D V         +    +SP +G++   G+ +G +++
Sbjct: 665 GDSVRLFLGHTAPVLCTAVSP-DGRWLATGSEDGIINL 701

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 74/177 (41%), Gaps = 26/177 (14%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           A++ST FS D +++ +GS+D  +R+W          +  +S  S K              
Sbjct: 551 AVYSTSFSPDNRYLLSGSEDKTVRLWST--------DTYTSLVSYK-------------- 588

Query: 235 SLNNPK-EKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FI 292
             N+P  + QF                      H  PLR++  H+ DV  +++  N  ++
Sbjct: 589 GHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYV 648

Query: 293 LSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
            + S DKT ++W     +S++ F+ H   V C    P D R+  +G  D    LW I
Sbjct: 649 FTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSP-DGRWLATGSEDGIINLWDI 704

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 98/211 (46%), Gaps = 13/211 (6%)

Query: 180 KFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNP 239
           +FS D +  A G +D  I++W + GSP++   L S A+ ++   A  +     V S+   
Sbjct: 505 EFSDDARLTAAGFQDSTIKVWYLDGSPLQSI-LPSKAK-DQSNSATLVGHSGPVYSVAFS 562

Query: 240 KEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFILSASMD 298
            + ++L SA+                   T L  YK H   V  + +S   ++ ++AS D
Sbjct: 563 PDNRYLLSASEDKTVRLWSLDTF------TCLVCYKGHNHPVWYVKFSPLGHYFITASHD 616

Query: 299 KTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-LDDEVSFE 356
           +T +LW  D    L+ F  H + V C  FHP +  +  +G  D  CR+W I   D V   
Sbjct: 617 QTARLWSCDHIYPLRIFSGHLNDVDCSTFHP-NGCYVFTGSSDKTCRMWDIQTGDSVRLF 675

Query: 357 YDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
                 +T++ +SP +G++   G+ +G + +
Sbjct: 676 LGHTSPVTALEVSP-DGRWLTTGSEDGTIIV 705

>Kwal_27.12053
          Length = 755

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 94/214 (43%), Gaps = 15/214 (7%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAE-SNKEARAKSMRIKQQVSSL 236
           S +FS D +  A G +D  I+IW + G P++        E +N E           V S 
Sbjct: 432 SLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGH---SGTVYST 488

Query: 237 NNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFILSA 295
           +   + ++L SA+                   T L  YK H   + D+ +S   ++  +A
Sbjct: 489 SFSPDNRYLLSASEDKTVRLWSTDTY------TSLVNYKGHNHPIWDVAFSPLGHYFATA 542

Query: 296 SMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD-DEV 353
           S D+T +LW  D    L+ F  H + V  V FHP +  +  +G  D  CR+W I   D V
Sbjct: 543 SHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHP-NGTYVFTGSSDKTCRMWDITSGDSV 601

Query: 354 SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
                    +TS  +SP +G++   G+ +G +++
Sbjct: 602 RLFLGHTAPVTSTAVSP-DGRWLSTGSEDGVINV 634

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           + ST  S DG++++TGS+DG I +W +
Sbjct: 611 VTSTAVSPDGRWLSTGSEDGVINVWDI 637

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVE 208
           A++S  +S++G  + +G  D  +R+W V  S  E
Sbjct: 653 AVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAE 686

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 40/60 (66%), Gaps = 2/60 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSL-KTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +IL+ S D TVKLW+ +   SL +TF  H  FV CV F+P D   F SGCLDHK ++WS+
Sbjct: 111 YILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL 170

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 99/221 (44%), Gaps = 35/221 (15%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
           ++ N+I+  S D  V++++ +    +  F+ HPD++  +  HP+   + ++G  D   +L
Sbjct: 65  TRKNWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPS-KPYILTGSDDLTVKL 123

Query: 346 WSILDD---EVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVA 402
           W+  +D   E +F+   +  +  V  +P++      G  +  V +      TP  + H  
Sbjct: 124 WNWENDWSLEQTFK-GHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTG 182

Query: 403 DRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRK 462
               QE+  +         + + P           L +   ++ +S+D+ ++IFD + + 
Sbjct: 183 ----QEKGVNY--------VDYYP-----------LPDKPYMITSSDDTTVKIFDYQTKS 219

Query: 463 LLEVLKGFHSGSSQHKAQLSIWHGQ-PIVVNSSDDHWVYGW 502
            +  L+G  S  S      +++H   PI+++ S+D  V  W
Sbjct: 220 CVATLEGHMSNVS-----FAVFHPTLPIIISGSEDGTVKLW 255

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 91/212 (42%), Gaps = 13/212 (6%)

Query: 181 FSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQ--VSSLNN 238
           FS D +  A G +D  I+IW + GS +    +  +     E       +     V S + 
Sbjct: 474 FSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSF 533

Query: 239 PKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFILSASM 297
             + ++L S +                   T L  YK H   V D+++S   ++  +AS 
Sbjct: 534 SPDNKYLLSGSEDKTVRLWSMDTH------TALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 298 DKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-LDDEVSF 355
           D+T +LW  D    L+ F  H + V CV FHP +  +  +G  D  CR+W +   D V  
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHP-NGCYVFTGSSDKTCRMWDVSTGDSVRL 646

Query: 356 EYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
                  + S+ + P +G++   G+ +G +++
Sbjct: 647 FLGHTAPVISIAVCP-DGRWLSTGSEDGIINV 677

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 267 HPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCV 324
           H  PLR++  H+ DV  +++  N  ++ + S DKT ++W     +S++ F+ H   V  +
Sbjct: 598 HIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISI 657

Query: 325 EFHPTDDRFFISGCLDHKCRLWSI 348
              P D R+  +G  D    +W I
Sbjct: 658 AVCP-DGRWLSTGSEDGIINVWDI 680

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 90/214 (42%), Gaps = 14/214 (6%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAE---SNKEARAKSMRIKQQVS 234
           S +FS D +  A G +D  I+IW + GS +   +  SS     S     +  +     V 
Sbjct: 478 SLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVY 537

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFIL 293
           S +   +  +L S +                   T L  YK H   V D+ +S   ++  
Sbjct: 538 STSFSPDNMYLVSGSEDKTVKLWSMDTH------TALVNYKGHNHPVWDVKFSPLGHYFA 591

Query: 294 SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-LDD 351
           SAS D+T +LW  D    L+ F  H + V  V FHP +  +  +G  D  CR+W +   D
Sbjct: 592 SASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHP-NGCYVFTGSSDKTCRMWDVSTGD 650

Query: 352 EVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYV 385
            V         + S  +SP +G++   G+ +G +
Sbjct: 651 SVRLFLGHTAPVLSTQVSP-DGRWLATGSEDGVI 683

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 74/175 (42%), Gaps = 24/175 (13%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSS 235
           ++ST FS D  ++ +GS+D  +++W +       A ++    ++     K   +    +S
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSM---DTHTALVNYKGHNHPVWDVKFSPLGHYFAS 592

Query: 236 LNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FILS 294
            ++ +  +                       H  PLR++  H  DV  +++  N  ++ +
Sbjct: 593 ASHDQTARLW------------------ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFT 634

Query: 295 ASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
            S DKT ++W     +S++ F+ H   V   +  P D R+  +G  D    LW I
Sbjct: 635 GSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSP-DGRWLATGSEDGVICLWDI 688

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 42/108 (38%), Gaps = 18/108 (16%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMR--IKQQV 233
           + ST+ S DG+++ATGS+DG I +W +                    R K MR   K  V
Sbjct: 662 VLSTQVSPDGRWLATGSEDGVICLWDI----------------GTGKRIKQMRGHGKNAV 705

Query: 234 SSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDV 281
            SL+  KE   L S                    P P + +  HV D+
Sbjct: 706 HSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDI 753

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSL-KTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           ++LS S D TVKLW+ +   +L +TF  H  FV CV F+P D   F SGCLD   ++WS+
Sbjct: 111 YVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL 170

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 90/221 (40%), Gaps = 47/221 (21%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
           ++ N+I+  S D  +++++ +    +  F  HPD++  +  HPT   + +SG  D   +L
Sbjct: 65  ARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPT-KPYVLSGSDDLTVKL 123

Query: 346 WSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPV--SSFHVA- 402
           W+                        E  + +  TF G+ H +M     P   S+F    
Sbjct: 124 WNW-----------------------ENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGC 160

Query: 403 -DRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLD-----NSFRLVVTSNDSRIRIF 456
            DR        V V        +    TG +   + +D     +   ++  S+D  I+I+
Sbjct: 161 LDRT-------VKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIW 213

Query: 457 DLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQ-PIVVNSSDD 496
           D + +  +  L+G  S  S      +++H   PI+++ S+D
Sbjct: 214 DYQTKSCVATLEGHMSNVS-----FAVFHPTLPIIISGSED 249

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           I+S S D T+K+W+       KT  +  +   C+  HPT  + +I+   D+   + S+ +
Sbjct: 243 IISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGN 302

Query: 351 DEVSFEYD 358
           DE +   D
Sbjct: 303 DEPTLSLD 310

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           ++++AS D T+K+W    K+ + T   H   V+   FHPT     ISG  D   ++W
Sbjct: 200 YMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPT-LPIIISGSEDGTLKIW 255

>Kwal_23.6429
          Length = 750

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 86/215 (40%), Gaps = 40/215 (18%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV-IGSPVERAELD-SSAESNKEARAKSMRIKQQV 233
           +   +FS DG+F+ATG      +++KV  G  + R   D SSA S  +A A S   K   
Sbjct: 403 VCCVRFSHDGEFLATGCNK-TTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASP 461

Query: 234 SSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFIL 293
           +   +     ++ S                  F P                      F+ 
Sbjct: 462 AVATSASSDLYIRSV----------------CFSP-------------------DGKFLA 486

Query: 294 SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352
           + + DK +++W    +  + T   H   +  +++ P+ D+  +SG  D   R+W +   +
Sbjct: 487 TGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDLRTGQ 545

Query: 353 VSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
            S     +D +T+V +SP +GK    G+ +  V I
Sbjct: 546 CSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRI 580

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 71/186 (38%), Gaps = 39/186 (20%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIK---QQ 232
           I S  FS DGKF+ATG++D  IRIW +                    R   M ++   Q 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDL------------------ATRRIVMTLQGHEQD 514

Query: 233 VSSLNN-PKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNF 291
           + SL+  P   + +  +                      L L  E     + ++      
Sbjct: 515 IYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCS------LTLSIEDGVTTVAVSPGDGKL 568

Query: 292 ILSASMDKTVKLWHP---------DRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHK 342
           I + S+D+TV++W           D +N L T  H D V  V F   D    +SG LD  
Sbjct: 569 IAAGSLDRTVRIWDSETGFLVERLDSENELGTG-HKDSVYSVVFT-RDGHGVVSGSLDRS 626

Query: 343 CRLWSI 348
            +LW++
Sbjct: 627 VKLWNL 632

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 291 FILSASMDKTVKLWHPDRK-NSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           F+L+ S D T+KLW+ ++     +TF  H  FV  V F+P D   F SGCLDH  ++WSI
Sbjct: 111 FVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI 170

Query: 349 LDDEVSF 355
             D  +F
Sbjct: 171 GQDVPNF 177

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 91/218 (41%), Gaps = 41/218 (18%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
           ++ N+++  S D  +++++ +    +  F  HPD++  +  HPT   F ++G  D   +L
Sbjct: 65  ARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPT-KPFVLTGSDDLTIKL 123

Query: 346 WSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVA--- 402
           W+   +     + CQ                   TF G+ H +M+    P      A   
Sbjct: 124 WNWEKN-----WGCQQ------------------TFTGHEHFVMSVAFNPKDPNQFASGC 160

Query: 403 -DRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQR 461
            D   +  +    V     K      V  +  +  Q D  + L+ TS+D  I+++D + +
Sbjct: 161 LDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQ-DKPY-LITTSDDGTIKVWDYQTK 218

Query: 462 KLLEVLKGFHSGSSQHKAQLS--IWHGQ-PIVVNSSDD 496
             +  L+G       H A +S  ++H   PI+++ S+D
Sbjct: 219 SNVATLEG-------HMANVSYAVFHPTLPIIISGSED 249

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
            I+S S D T+K+W+ +     KT  I  +   C+  HP+  R +I+   D+   + S+ 
Sbjct: 242 IIISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDNGFTVLSLG 301

Query: 350 DDEVSFEYD 358
           DD+     D
Sbjct: 302 DDQPKLSLD 310

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 83/214 (38%), Gaps = 32/214 (14%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV-IGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           +   +FS DG+++ATG      +++KV  G  + R   DS A  N EA            
Sbjct: 279 VCCVRFSNDGEYLATGCNK-TTQVYKVSTGELLARLSDDSVAGVNNEA---------STG 328

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILS 294
             NN       +++              +  F P                      ++ +
Sbjct: 329 PANNGTADNGGENSATIQPASSSDLYIRSVCFSP-------------------DGKYLAT 369

Query: 295 ASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEV 353
            + DK +++W    K  L T   H   +  +++ P  D+  +SG  D   R+W +   + 
Sbjct: 370 GAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKL-VSGSGDRTVRIWDLRTGQC 428

Query: 354 SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
           S     +D +T+V +SP +GKY   G+ +  V +
Sbjct: 429 SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRV 462

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 290 NFILSASMDKTVKLWHPDRKNSL-KTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           +++LSAS D TVKLW+ ++  +L +TF  H  FV  V F+P D   F + CLDH  ++WS
Sbjct: 110 SYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWS 169

Query: 348 I 348
           +
Sbjct: 170 L 170

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 22/123 (17%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           I+S S D TVK+W+ +     +T  +  +   CV  HPT  R FI+   D+   + +I +
Sbjct: 243 IISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFTVLAIGN 302

Query: 351 DEVSFEYD--------------CQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPV 396
           DE     D                D++T+V    EE +       +G V  L ++ L  V
Sbjct: 303 DEPRLSLDPVGKLVWCGGKTSSATDVLTAVIRGNEEAE-------DGAVLSLQSKELGTV 355

Query: 397 SSF 399
             F
Sbjct: 356 DVF 358

>Scas_571.4
          Length = 601

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 80/187 (42%), Gaps = 18/187 (9%)

Query: 290 NFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           N + S+S+D TVK+W+  +   + T  H D VT + F P D  +  +   + K  +W I 
Sbjct: 162 NVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDP-DGAYLATITRNKKLTIWDIA 220

Query: 350 DDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQ 409
             +          I S T S +  K   +  + GY  I+ T G +        DR+    
Sbjct: 221 SKQ----------IVSQTKSHQGPKNQRV-VWLGYSRIIATTGFS-----KSMDREIGIW 264

Query: 410 NAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
           +A  +   T +K     + +G+      L N    VV   D  IR F+L+ RKL + L  
Sbjct: 265 DALDLKEGTINKFYKIDQSSGILMPFYDLTNRILYVVGKGDGNIRCFELKDRKLQQ-LSE 323

Query: 470 FHSGSSQ 476
           FHS   Q
Sbjct: 324 FHSREPQ 330

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 89/233 (38%), Gaps = 61/233 (26%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333
           Y+ H   VL ++ S    I+S S DKTVK+WH + +       H  +V CV+ HP     
Sbjct: 335 YRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393

Query: 334 FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVH-----IL 388
           F SG  D   R+W I  +                        T +  F+G+V      I 
Sbjct: 394 F-SGSDDMTIRMWDIRTN------------------------TCVRVFHGHVGQVQKVIP 428

Query: 389 MTRG-----------LTPVSSFHVADRQTQEQN--------AHVMVTETDSKIRHGPRVT 429
           +T G           + P ++    D   Q  N         H++    D+ I+     T
Sbjct: 429 LTLGSDLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT 488

Query: 430 GLQAFRSQLD----------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHS 472
           G    R+Q            ++FR+V  S+D   +++DL+  K +    G H+
Sbjct: 489 G-ACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 82/212 (38%), Gaps = 37/212 (17%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDR 332
           +K H+  VL +  + N  +L+ S D TV +W       ++    H D V  + F   DD+
Sbjct: 255 FKGHMDGVLSLQLT-NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQ 310

Query: 333 FFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRG 392
             I+G LD   R+W              + +T   +S   G    + + + +  ++++  
Sbjct: 311 KLITGSLDKTIRVW--------------NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGS 356

Query: 393 L-TPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDS 451
               V  +HV  R       H   T   + ++  P+             SF     S+D 
Sbjct: 357 ADKTVKVWHVESRTCYTLRGH---TGWVNCVKLHPK-------------SFTCFSGSDDM 400

Query: 452 RIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSI 483
            IR++D+     + V  G H G  Q    L++
Sbjct: 401 TIRMWDIRTNTCVRVFHG-HVGQVQKVIPLTL 431

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/344 (21%), Positives = 134/344 (38%), Gaps = 39/344 (11%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV-IGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           +   +FS DG+F+ATG  +   +++KV  G  V R   DS+++   + + +++  +   S
Sbjct: 324 VCCVRFSSDGEFLATGC-NKTTQVYKVSTGELVARLSDDSASQPQPQPQNQTVTAETSTS 382

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTP-----------LRLY--------- 274
           + N    +    +               +  F P             +R++         
Sbjct: 383 NSNGSSAEDGTGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVM 442

Query: 275 --KEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDD 331
             K H QD+  +++    N ++S S D+TV++W         T    D VT V   P + 
Sbjct: 443 TLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEG 502

Query: 332 RFFISGCLDHKCRLWSI--------LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
           +F  +G LD   R+W          LD E       +D + SV  +  +GK  + G+ + 
Sbjct: 503 KFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFT-RDGKGVVSGSLDR 561

Query: 384 YVHILMTRGLTPVSSF---HVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDN 440
            V +    GL+   S     V     ++    V  T+ D  I  G +  G+  + ++  N
Sbjct: 562 SVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGN 621

Query: 441 SFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIW 484
              ++    +S I +       L      F +GS   KA+  IW
Sbjct: 622 PLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKAR--IW 663

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIG 204
           +++S  F+RDGK + +GS D  +++W + G
Sbjct: 541 SVYSVVFTRDGKGVVSGSLDRSVKLWNLNG 570

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +I+SAS D+T+++W+   +  +     H  FV C +FHPTDD   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDI 166

>Scas_704.40
          Length = 608

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 94/220 (42%), Gaps = 27/220 (12%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333
           Y+ H   V+ ++  K   I+S S DKTVK+WH + +       H ++V CV+ HP     
Sbjct: 329 YRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 387

Query: 334 FISGCLDHKCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIGTFNG-------- 383
           F SG  D   R+W I  +     F      +   + L+  + +  ++   +G        
Sbjct: 388 F-SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEP 446

Query: 384 YVHILMTRGLTPVSSFHVADRQTQEQN----AHVMVTETDSKIRHGPRVTGLQAFRSQLD 439
                 T  +   ++ +  + QT +++     H++    D+ I+     TG Q  R+Q  
Sbjct: 447 ASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTG-QCIRTQFG 505

Query: 440 ----------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
                     ++FR++  S+D  I+I+DL+  K +    G
Sbjct: 506 HVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545

>Scas_624.11
          Length = 1205

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +I+SAS D+T+++W+   +  +     H  FV C +FHPTDD   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDI 166

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 14/75 (18%)

Query: 284 INWSKNN----FILSASMDKTVKLWHPDRKNSLKTFI------HPDFVTCVEFHPTDDRF 333
           +NW+  +     I+S S D+ VKLW   + NS K +       H + V CV FHPT  +F
Sbjct: 212 VNWASFHPTLPMIVSGSDDRQVKLW---KYNSTKAWEVDTCRGHTNNVDCVIFHPT-QKF 267

Query: 334 FISGCLDHKCRLWSI 348
            +S   D   R+W +
Sbjct: 268 ILSVGEDKTLRIWDL 282

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           ++L A    T++LW       L  F  H   V  V+FHPT    F+SG  D+  ++WS+
Sbjct: 25  WVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQP-IFVSGGDDYTIKVWSL 82

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 291 FILSASMDKTVKLWH-PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           F+ + + D+ +++W   +RK  +    H   +  +++ P+ D+  +SG  D   R+W + 
Sbjct: 457 FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDLR 515

Query: 350 DDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
             + S     +D +T+V +SP +GKY   G+ +  V +
Sbjct: 516 TGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRV 553

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 4/114 (3%)

Query: 271 LRLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT 329
           + + + H QD+  +++    + ++S S D+TV++W         T    D VT V   P 
Sbjct: 478 VMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG 537

Query: 330 DDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
           D ++  +G LD   R+W   D E  F  +  D         ++  Y+++ T +G
Sbjct: 538 DGKYIAAGSLDRAVRVW---DSETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 72/186 (38%), Gaps = 39/186 (20%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIK---QQ 232
           I S  FS DGKF+ATG++D  IRIW +                  E R   M ++   Q 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDI------------------ENRKIVMILQGHEQD 487

Query: 233 VSSLNN-PKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNF 291
           + SL+  P   + +  +                      L L  E     + ++     +
Sbjct: 488 IYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQC------SLTLSIEDGVTTVAVSPGDGKY 541

Query: 292 ILSASMDKTVKLWHP---------DRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHK 342
           I + S+D+ V++W           D +N   T  H D V  V F   D +  +SG LD  
Sbjct: 542 IAAGSLDRAVRVWDSETGFLVERLDSENESGTG-HKDSVYSVVF-TRDGQSVVSGSLDRS 599

Query: 343 CRLWSI 348
            +LW++
Sbjct: 600 VKLWNL 605

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 444 LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWR 503
           L   + D  IRI+D+E RK++ +L+G      Q    L  +     +V+ S D  V  W 
Sbjct: 458 LATGAEDRLIRIWDIENRKIVMILQGHE----QDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 504 LKS 506
           L++
Sbjct: 514 LRT 516

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 90/218 (41%), Gaps = 21/218 (9%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPV------ERAELDSSAESNKEARAKS--- 226
           +   KFS DG+F+ATG  +   +I++V    +      E A  D  A+ N  A A++   
Sbjct: 494 VCCVKFSNDGEFLATGC-NKTTQIYRVSDGELVARFSDENAHTDK-ADGNDNAEAETSAG 551

Query: 227 MRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINW 286
                 + S+    + +FL +                 V       + K H QD+  +++
Sbjct: 552 ATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVM------VLKGHEQDIYSLDY 605

Query: 287 -SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
               + ++S S D+TV++W         T    D VT V   P D +F  +G LD   R+
Sbjct: 606 FPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRV 665

Query: 346 WSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
           W   D +  F  +  D    +    ++  Y+++ T +G
Sbjct: 666 W---DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDG 700

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           F+ + + DK +++W  ++K  +     H   +  +++ P+ D+  +SG  D   R+W + 
Sbjct: 569 FLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKL-VSGSGDRTVRIWDLK 627

Query: 350 DDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
             + +     +D +T+V +SP +GK+   G+ +  V +
Sbjct: 628 TGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRV 665

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 72/186 (38%), Gaps = 39/186 (20%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIK---QQ 232
           I S  FS DGKF+ATG++D  IRIW +                  E +   M +K   Q 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDI------------------EQKKIVMVLKGHEQD 599

Query: 233 VSSLNN-PKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNF 291
           + SL+  P   + +  +                      L L  E     + ++     F
Sbjct: 600 IYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCT------LTLSIEDGVTTVAVSPGDGKF 653

Query: 292 ILSASMDKTVKLWHPD---------RKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHK 342
           I + S+D+ V++W  D          +N L T  H D V  V F   D    +SG LD  
Sbjct: 654 IAAGSLDRAVRVWDSDTGFLVERLDSENELGTG-HKDSVYSVVFT-RDGNGVVSGSLDRS 711

Query: 343 CRLWSI 348
            +LW++
Sbjct: 712 VKLWNL 717

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 89/246 (36%), Gaps = 60/246 (24%)

Query: 270 PLRLYKEHVQDV----LDINWSKNNFILSASMDKTVKLWHPDRKNSL-----KTFIHPDF 320
           PL    +HV+ +    LD++ S     +    +    L++P    S+     KT  H   
Sbjct: 434 PLEQRADHVKPIPPFLLDLDASSVPENMKKQTNDYYVLFNPALPRSIDLDLHKTLEHTSV 493

Query: 321 VTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGT 380
           V CV+F   D  F  +GC +   +++ + D E+   +             +E  +T    
Sbjct: 494 VCCVKFS-NDGEFLATGC-NKTTQIYRVSDGELVARFS------------DENAHTDKAD 539

Query: 381 FNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDN 440
            N       + G T                       TD  IR         +     D 
Sbjct: 540 GNDNAEAETSAGAT-----------------------TDLYIR---------SVCFSPDG 567

Query: 441 SFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVY 500
            F L   + D  IRI+D+EQ+K++ VLKG      Q    L  +     +V+ S D  V 
Sbjct: 568 KF-LATGAEDKLIRIWDIEQKKIVMVLKGHE----QDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 501 GWRLKS 506
            W LK+
Sbjct: 623 IWDLKT 628

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 15/84 (17%)

Query: 277 HVQDVLDINWSKN-NFILSASMDKTVKLWH------------PDRKNSLKTFI-HPDFVT 322
           H   V  + ++++ N ++S S+D++VKLW+            P       T+  H DFV 
Sbjct: 687 HKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVL 746

Query: 323 CVEFHPTDDRFFISGCLDHKCRLW 346
            V     DD + +SG  D     W
Sbjct: 747 SVATT-EDDEYILSGSKDRGVLFW 769

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 113/268 (42%), Gaps = 18/268 (6%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSM-RIKQQVS 234
           I++   S DGK +ATG  DGKIRIW V  + V  A  +S  + +      SM R    V+
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSV-DALVSAAAGESGVDRDTHRPLASMSRHTGSVT 78

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXX---------XXXAPVFHPTPLRLYKEHVQDVLDIN 285
            +    +  +L S +                          H T  +    H  D+ DI 
Sbjct: 79  CVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDIC 138

Query: 286 WSKNNFIL-SASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKC 343
           W+ ++ IL +  +D++V +W+      LK F +H   V  V F P  +++F +   D   
Sbjct: 139 WAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPA-NKYFATASDDRTM 197

Query: 344 RLWSI-LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLT-PVSSFHV 401
           R++      EVSF  + Q ++     SP    +  +       HI +      PVSS  +
Sbjct: 198 RVFRYHKTGEVSFTIE-QVIVEPFIASPLTTYFRRLSWSPDGQHIAVPNATNGPVSSVAI 256

Query: 402 ADRQTQEQNAHVMVTETDSKI-RHGPRV 428
            +R T + +  ++  +  +++ R  PR+
Sbjct: 257 INRGTWDSSISLIGHDAPTEVARFNPRL 284

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 127/317 (40%), Gaps = 50/317 (15%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSM------RI 229
           I++   S DGK +ATG  DGKIRIW  I S +   EL+S        +   M      R 
Sbjct: 20  IYTVDVSHDGKRLATGGLDGKIRIWS-IDSILRCMELESLTPEIPLPQDLQMPLCSMSRH 78

Query: 230 KQQVSSLNNPKEKQFLDSATXXXXX---XXXXXXXXAPVF-------HPTPLRLYKEHVQ 279
              ++ +    + ++L S +                 P F       H T  +    H  
Sbjct: 79  TGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDN 138

Query: 280 DVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISG 337
           D+ DI W+ ++ IL +  +D++V +W+      LK F +H   V  V F P  +++F + 
Sbjct: 139 DIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPA-NKYFATT 197

Query: 338 CLDHKCRLWSI-LDDEVSFEYDCQDLITS-------------VTLSPEEGKYTIIGTFNG 383
             D   +++      ++SF    + +IT               + SP+     +    NG
Sbjct: 198 SDDRTMKIFRYHKTGDISFTI--EHIITEPFKESPLTTYFRRPSWSPDGQHIAVPNATNG 255

Query: 384 YVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKI-RHGPRVTGLQAFRSQL--DN 440
                      PVSS  + +R T + N  ++  +  +++ R  PR+    A   Q   D+
Sbjct: 256 -----------PVSSMAIVNRGTWDTNVSLIGHDAPTEVARFNPRLFERNAGVKQKKDDD 304

Query: 441 SFRLVVTSNDSRIRIFD 457
               +V  ND ++  FD
Sbjct: 305 PENALVGQNDDKVHHFD 321

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 74/172 (43%), Gaps = 14/172 (8%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPV---ERAELDSSAESNKEARAKSMRIKQQ 232
           I++   S DG+ +ATG  DGKIRIW V    V    +    +  E  ++  A   R    
Sbjct: 20  IYTVDVSSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGS 79

Query: 233 VSSLNNPKEKQFLDSATXXXXXXXXXXXXXA--PVF-------HPTPLRLYKEHVQDVLD 283
           V++L    + ++L S +             A  P+F       H    R    H  D+ D
Sbjct: 80  VTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQD 139

Query: 284 INWSKNNFIL-SASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRF 333
           I W+ ++ IL +  +D+++ +W+      +K F +H   V  V F P +  F
Sbjct: 140 ICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYF 191

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +I+SAS D+T+++W+   +  +     H  FV C +FHPT+D   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTED-LVVSASLDETVRIWDI 166

>Scas_630.6
          Length = 621

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 291 FILSASMDKTVKLWH-PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           F+ + + DK +++W+  +RK  +    H   +  +++ P D +  +SG  D   R+W + 
Sbjct: 355 FLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFP-DGQKLVSGSGDRSIRIWDLK 413

Query: 350 DDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHI 387
             + S     +D +T+V +SP EGK    G+ +  V I
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRI 451

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 90/228 (39%), Gaps = 54/228 (23%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIK---QQ 232
           I S  FS DG+F+ATG++D  IRIW                  N + R   M +K   Q 
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIW------------------NIKERKIVMVLKGHEQD 385

Query: 233 VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFI 292
           + SL+   + Q L S +                     L L  E     + ++ ++   I
Sbjct: 386 IYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQ-----CSLTLSIEDGVTTVAVSPNEGKLI 440

Query: 293 LSASMDKTVKLWHPDRKNSLKTFI-------------HPDFVTCVEFHPTDDRFFISGCL 339
            + S+D++V++W     +S   F+             H D V  V F   D +  +SG L
Sbjct: 441 AAGSLDRSVRIW-----DSSTGFLVERLDSDNESGNGHQDSVYSVAFT-KDGQHVVSGSL 494

Query: 340 DHKCRLWSILDDEVSFEYDCQ-------DLITSVTLSPEEGKYTIIGT 380
           D   +LW+ L D  S    C+       D + SV  S ++ KY   G+
Sbjct: 495 DRTVKLWN-LGDTQSGTGKCEVTYIGHKDFVLSVATSNDD-KYIFSGS 540

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 72/178 (40%), Gaps = 22/178 (12%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSS 235
           I+S  +  DG+ + +GS D  IRIW +      +  L  S E      A S    + +++
Sbjct: 386 IYSLDYFPDGQKLVSGSGDRSIRIWDL---KTGQCSLTLSIEDGVTTVAVSPNEGKLIAA 442

Query: 236 LNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FILS 294
            +  +  +  DS+T                           H   V  + ++K+   ++S
Sbjct: 443 GSLDRSVRIWDSSTGFLVERLDSDNESG-----------NGHQDSVYSVAFTKDGQHVVS 491

Query: 295 ASMDKTVKLWHPDRKNSLK-----TFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
            S+D+TVKLW+     S       T+I H DFV  V     DD++  SG  D    +W
Sbjct: 492 GSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGVIIW 548

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 300 TVKLWHPDRKNSL-KTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           T+KLW+ ++  +L +TF  H  FV CV F+P D   F S CLDH  ++WS+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL 52

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
            I+S S D TVK+W+ +     KT  +  +   CV  HPT  R +++   D+   + S+ 
Sbjct: 124 IIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGFNVLSMG 183

Query: 350 DDE 352
           +DE
Sbjct: 184 NDE 186

>Kwal_56.24526
          Length = 1210

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +I+SAS D+T+++W+   +  +     H  FV C +FHPT+D   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDI 166

>Scas_442.2*
          Length = 795

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 97/242 (40%), Gaps = 36/242 (14%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI----HPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           I++    +T+ LW+P  +NS   F     H   VTCV+F  TD  + +S   DH  ++W 
Sbjct: 29  IVAFGAGQTIALWNPLDENSQGVFATLKGHEAEVTCVKF-ITDTPYMVSCSEDHHVKIWK 87

Query: 348 ILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTP-VSSFHVADRQT 406
                            +  ++ E   +T + T + Y H ++   + P + +   AD + 
Sbjct: 88  ----------------QNPGVAREVDGWTCVQTLDHYSHTVVALAVLPGLIAVGCADGKV 131

Query: 407 ----QEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRK 462
               Q+    V +   + +++ G     L AF   +D+ + L V   +  + +F      
Sbjct: 132 SLWVQKMKEDVFILGEEFEVQKGVLPLAL-AFSKVIDDKYLLAVGGTNVNVFVFSFVLNA 190

Query: 463 LLEVLKGFH-----SGSSQHKAQLSIWH----GQPIVVNSSDDHWVYGWRLKSSDRENDQ 513
             E ++         G       L+  H    G  ++ + S D ++  WR++ +D    Q
Sbjct: 191 TAETIETLQLAAKLEGHEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQ 250

Query: 514 DE 515
           DE
Sbjct: 251 DE 252

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 89/214 (41%), Gaps = 28/214 (13%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333
           Y+ H   VL ++ S    I+SAS DKTVK+WH + +       H ++V CV+ HP     
Sbjct: 388 YRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 446

Query: 334 FISGCLDHKCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTR 391
           + S   D   R+W I  +     F      +   + L       TI  T N  V   + +
Sbjct: 447 Y-SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL-------TIKDTENLVVDEKIEK 498

Query: 392 GLTPVSSFHVADRQTQ------EQNAHVMVTETDSKIRHGPRVTGLQAFRSQLD------ 439
              P      AD  T       +   H++    D+ I+     +G +  R+Q        
Sbjct: 499 VPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSG-RCIRTQFGHVEGVW 557

Query: 440 ----NSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
               ++FR+V  S+D  I+++DL+  K ++   G
Sbjct: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG 591

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 277 HVQDVLDINWSKNNF-ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFF 334
           HV+ V DI  + +NF I+S S DK++K+W       ++TF  H   + CV      D  F
Sbjct: 552 HVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI---GDSSF 606

Query: 335 ISGCLDHKCRLWSILD 350
           +SG    + ++W   D
Sbjct: 607 VSGDELGEVKMWHFDD 622

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 88/227 (38%), Gaps = 47/227 (20%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333
           Y+ H   V+ ++ S    I+S S DKTVK+WH + +       H ++V CV+ HP    F
Sbjct: 410 YRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS--F 466

Query: 334 FISGCLDH-KCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMT 390
               C D    R+W I  +     F      +   + L       TII   N     L+T
Sbjct: 467 SCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPL-------TIIDAQN-----LVT 514

Query: 391 RGLTPVSSFHVADRQTQEQN------------------AHVMVTETDSKIRHGPRVTGLQ 432
               P     +A   T E +                   H++    D+ I+     +G +
Sbjct: 515 HERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSG-R 573

Query: 433 AFRSQLD----------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
             R+Q            ++FR++  S+D  I+I+DL+  K +    G
Sbjct: 574 CIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 90/224 (40%), Gaps = 37/224 (16%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPT 329
           ++ +K H+  VL + ++    + + S D TV +W       ++    H D V  + F   
Sbjct: 327 IQEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--- 382

Query: 330 DDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILM 389
           DD+  I+G LD   R+W              + IT   +S   G    + + + +  I++
Sbjct: 383 DDQKLITGSLDKTIRVW--------------NYITGECISTYRGHTDSVMSVDSHKKIIV 428

Query: 390 TRGL-TPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTS 448
           +      V  +HV  R       H   TE  + ++  P+             SF     S
Sbjct: 429 SGSADKTVKVWHVESRTCYTLKGH---TEWVNCVKLHPK-------------SFSCYSCS 472

Query: 449 NDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVN 492
           +D+ IR++D+     L V +G H G  Q    L+I   Q +V +
Sbjct: 473 DDTTIRMWDIRTNTCLRVFRG-HVGQVQKVIPLTIIDAQNLVTH 515

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 94/211 (44%), Gaps = 26/211 (12%)

Query: 270 PLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHP 328
           P+ +   H  +V  ++ SKNNF++S+S DKT K+WH    +++   + H   V   +F P
Sbjct: 91  PVYMLIGHKGNVCSLS-SKNNFVISSSWDKTAKVWH--NGSAIYDLVGHSASVWDAKFLP 147

Query: 329 TDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYT------------ 376
             D FF++   D   +LW       +F    +D+I  + +SP+   +             
Sbjct: 148 EKD-FFLTASADCTIKLWHGNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKIND 206

Query: 377 ----IIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQ 432
               I+ TF G+   + +    P       D  +  ++  V V      ++   R+  + 
Sbjct: 207 MDGNILKTFTGHESFVYSVKFLP-----NGDLVSCGEDRSVRVWSKTGAVKQVLRLPAVS 261

Query: 433 AFRSQLDNSFRLVVTSNDSRIRIFDLEQRKL 463
            +   +  +  ++V S+D+ +RIF +E+ ++
Sbjct: 262 IWDLDILPNGDILVGSSDNMVRIFTVEESRI 292

>Scas_629.12
          Length = 671

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 20/229 (8%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVI-GSPVERAELDS--SAESNKEARAKSMRIKQ 231
            +   KFS DG+F+ATG  +   +I++V  G  + +   DS  S +++      +     
Sbjct: 330 VVCCVKFSNDGQFLATGC-NKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDL 388

Query: 232 QVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNF 291
            + S+    + +FL +                 V       + K H QDV  +++  N  
Sbjct: 389 YIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVM------VLKGHEQDVYSLDYFPNGE 442

Query: 292 -ILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-- 348
            ++S S D+TV++W         T      VT V   P D +F  +G LD   R+W    
Sbjct: 443 KLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTT 502

Query: 349 ------LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTR 391
                 LD E       +D + SV  +  +G   + G+ +  V +   R
Sbjct: 503 GFLVERLDSENELGTGHRDSVYSVVFT-RDGNEVVSGSLDKTVKLWNMR 550

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 93/233 (39%), Gaps = 54/233 (23%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIK---QQ 232
           I S  FS DG+F+ATG++D  IRIW +                  + R   M +K   Q 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDI------------------QERKIVMVLKGHEQD 431

Query: 233 VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFI 292
           V SL+     + L S +                     L L  E+    + ++ +   FI
Sbjct: 432 VYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQ-----CSLTLSIEYGVTTVAVSPNDGKFI 486

Query: 293 LSASMDKTVKLWHP---------DRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKC 343
            + S+D+ V++W           D +N L T  H D V  V F   D    +SG LD   
Sbjct: 487 AAGSLDRAVRVWDSTTGFLVERLDSENELGTG-HRDSVYSVVFT-RDGNEVVSGSLDKTV 544

Query: 344 RLWSIL---------DDEVSFEYDCQ-------DLITSVTLSPEEGKYTIIGT 380
           +LW++          +D+ S    C+       D + SVT S ++ KY + G+
Sbjct: 545 KLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTS-QDDKYILSGS 596

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 439 DNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHW 498
           D  F L   + D  IRI+D+++RK++ VLKG      Q    L  +     +V+ S D  
Sbjct: 398 DGEF-LATGAEDKLIRIWDIQERKIVMVLKGHE----QDVYSLDYFPNGEKLVSGSGDRT 452

Query: 499 VYGWRLKS 506
           V  W L++
Sbjct: 453 VRIWDLRT 460

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 64/180 (35%), Gaps = 57/180 (31%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           +++S  F+RDG  + +GS D  +++W +      R   +S+ ESN +  A          
Sbjct: 522 SVYSVVFTRDGNEVVSGSLDKTVKLWNM------RHSGNSNNESNDKGSA---------- 565

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FIL 293
                       SAT                        Y  H   VL +  S+++ +IL
Sbjct: 566 ------------SATCEVT--------------------YVGHKDFVLSVTTSQDDKYIL 593

Query: 294 SASMDKTVKLWHPDRKNSL-------KTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           S S D+ +  W  +  N L        + I           P  +  F +G  D K R+W
Sbjct: 594 SGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYN-VFATGSGDCKARIW 652

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 62/149 (41%), Gaps = 20/149 (13%)

Query: 268 PTPLRLYKEHVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTFI--------- 316
           P  + L++ H   VLD ++S  N   + S S D  + +W       L  ++         
Sbjct: 83  PDQVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDL 142

Query: 317 --------HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTL 368
                   H   V  + FHP  +    S  LD+  ++W I  +EV F     D++TS++ 
Sbjct: 143 KPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSF 202

Query: 369 SPEEGKYTIIGTFNGYVHILMTRGLTPVS 397
           S  +GK+ +  + +  + +   R    VS
Sbjct: 203 S-YDGKHLVTVSRDKKLRVWDVRAEKIVS 230

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           + S  FS DGK + T S+D K+R+W V
Sbjct: 197 VTSMSFSYDGKHLVTVSRDKKLRVWDV 223

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 104/260 (40%), Gaps = 36/260 (13%)

Query: 267 HPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCV 324
           +  P+R +K H   V D   + +  + LSAS DKT++LW       +K F+ H   V  V
Sbjct: 70  YGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSV 129

Query: 325 EFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEG----------- 373
              P   +  +S   D   ++W+ + D V       D +++V ++P E            
Sbjct: 130 SIDPRATQ-IVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAG 188

Query: 374 -----------KYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKI 422
                       +TI   F G+ + + T   +P  S       +  ++  +++   + K 
Sbjct: 189 MDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFA----SAGKDGQIILWNLNEKT 244

Query: 423 RHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLK----GFHSGSSQHK 478
                    + F      +   +  +  S I+IFDLE+R +++ LK    G++     H 
Sbjct: 245 ALYTLDAKDEVFAVAFSPNRYWLTAATASGIKIFDLEERTIVDDLKPEFAGYNKAQDPHA 304

Query: 479 AQLSIWH--GQPIVVNSSDD 496
             L+ W   GQ +    +D+
Sbjct: 305 VSLA-WSADGQTLFAGYTDN 323

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +++SAS D+TV++W+   +  L     H  FV C +FH T+D   +S  LD   R+W I
Sbjct: 109 WVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDI 166

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 3/105 (2%)

Query: 269 TPLRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEF 326
            P+R YK H   V D+  S + N+ +SAS DKT++LW+    NS   F+ H   V  V  
Sbjct: 57  VPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPE 371
                +  IS   D   R+W+ + D         D +T V ++P+
Sbjct: 117 DANSSK-IISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPK 160

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 91/242 (37%), Gaps = 49/242 (20%)

Query: 274 YKEHVQDVLDINWSKNNF-ILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT--- 329
           +  H  DVL +    N+  I+SAS DKT+++W+     +     H D+VT V   P    
Sbjct: 104 FVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLE 163

Query: 330 -----DDRF-FISGCLDHKCRLWSILDDEVSFEYDC---QDLITSVTLSPEEGKYTIIGT 380
                D R  F+S  +D   R WS+ +D    E D     + I  V  SP +G       
Sbjct: 164 DGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSP-DGSLAASAG 222

Query: 381 FNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDN 440
            +G +++   +  +   +F   D                            + F      
Sbjct: 223 KDGQIYVWNLKHKSAFMNFDAKD----------------------------EVFALAFSP 254

Query: 441 SFRLVVTSNDSRIRIFDLEQRKLLEVLK----GFHSGSSQHKAQLSIWH--GQPIVVNSS 494
           S   +  +  S I+I+DLE   L++ LK    G+      H   L+ W   GQ +    +
Sbjct: 255 SRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLA-WSADGQTLFAGYT 313

Query: 495 DD 496
           D+
Sbjct: 314 DN 315

>Scas_702.16
          Length = 816

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 111/283 (39%), Gaps = 42/283 (14%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV--IGSPVERAELDSSAESNKEAR---AKSMRIK 230
           I++   S DGK +ATG  DGKIRIW V  I   V+   L      +KE +   A   R  
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRHT 79

Query: 231 QQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKE----------HVQD 280
             V+ L      ++L S +              P+         KE          H  D
Sbjct: 80  GSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVAHDND 139

Query: 281 VLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGC 338
           + DI W+ + + ++S  +D+ V +W+      LK F +H   V  V F P  +++F +  
Sbjct: 140 IQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPA-NKYFATAS 198

Query: 339 LDHKCRLW---SILDDEVSFEYDCQD---------LITSVTLSPEEGKYTIIGTFNGYVH 386
            D   +++    I D   + E+   +             ++ SP+          NG   
Sbjct: 199 DDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHIAAPNATNG--- 255

Query: 387 ILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSK-IRHGPRV 428
                   PVSS  + +R T + N  ++  +  ++ +R  PR+
Sbjct: 256 --------PVSSVAIINRGTWDSNISLIGHDAPTEVVRFNPRL 290

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +I+S+S D+T+++W+   +  +     H  FV C +FHP +D   +S  LD   R+W I
Sbjct: 109 WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDI 166

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 288 KNNFILSASMDKTVKLWHPDRKNSLKTFIHP-DFVTCVEFHPTDDRF 333
           + N I+S   DKTV++W  D++  +K F    D    V  HP  + F
Sbjct: 264 QQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLF 310

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333
           Y+ H   VL ++ S    I+S S DKTVK+WH + +       H ++V CV+ HP     
Sbjct: 378 YRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436

Query: 334 FISGCLDHKCRLWSI 348
           F S   D   R+W I
Sbjct: 437 F-SCSDDTTIRMWDI 450

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 85/212 (40%), Gaps = 37/212 (17%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDR 332
           +K H+  VL + ++    + + S D T+ +W       ++    H D V  + F   DDR
Sbjct: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353

Query: 333 FFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRG 392
             I+G LD   R+W              + IT   +S   G    + + + Y  ++++  
Sbjct: 354 KLITGSLDKTIRVW--------------NYITGECISTYRGHSDSVLSVDSYQKVIVSGS 399

Query: 393 L-TPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDS 451
               V  +HV  R       H   TE  + ++  P+             SF     S+D+
Sbjct: 400 ADKTVKVWHVESRTCYTLRGH---TEWVNCVKLHPK-------------SFSCFSCSDDT 443

Query: 452 RIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSI 483
            IR++D+     L+V +G H G  Q    L+I
Sbjct: 444 TIRMWDIRTNSCLKVFRG-HVGQVQKIIPLTI 474

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 5/53 (9%)

Query: 270 PLRLYKEHVQDVLDINW---SKNNFILSASMDKTVKLWHPDRKNSLKTFI-HP 318
           P+ ++ EH ++V   NW   SK+NF+ S+S D  VK+W P+RK SL TF  HP
Sbjct: 96  PIAMFHEHSKEVYSCNWNLVSKSNFV-SSSWDGQVKIWSPNRKASLITFSPHP 147

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 290 NFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           N + S+S D TVKLW+ +    + T  HPD VT + F   D  +  +   D K R+W+I 
Sbjct: 154 NVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS-YDGNYLATVARDKKLRVWNIR 212

Query: 350 DDEVSFE 356
           ++++  E
Sbjct: 213 EEKIVSE 219

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           + S  FS DG ++AT ++D K+R+W +
Sbjct: 185 VTSMSFSYDGNYLATVARDKKLRVWNI 211

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 46/121 (38%), Gaps = 19/121 (15%)

Query: 268 PTPLRLYKEHVQDVLDINWSKNN--FILSASMDKTVKLW----------HPDRKNSLKTF 315
           P  + L++ H   VLD ++   N   I S S D  + +W          H D        
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDI 130

Query: 316 IHPDFVTC-------VEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTL 368
               F+T        V +HP  +    S   D+  +LW++   +        D++TS++ 
Sbjct: 131 KPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSF 190

Query: 369 S 369
           S
Sbjct: 191 S 191

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/317 (19%), Positives = 118/317 (37%), Gaps = 54/317 (17%)

Query: 187 FMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQFLD 246
            +A+   D  IR W+ +     R                      QV+ L    +K+FL 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRT---------------IQHADSQVNRLEITSDKRFLA 48

Query: 247 SATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWH 305
           +A                  +P P+  ++ H  +V  I++ ++N +++S+S D T+K+W 
Sbjct: 49  AAGHLHVRLYDIRTT-----NPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWD 103

Query: 306 PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITS 365
               +  + + H   V  V  HP      IS   D   R+W + +++ + +   +D    
Sbjct: 104 VRAPSVQRNYKHHAPVNEVVIHPNQGEL-ISCDQDGNIRIWDLGENQCTHQLTPEDDTPL 162

Query: 366 VTLS-PEEGKYTIIGTFNGYVHILM------TRGLTPVSSF-----HVADRQTQEQNAHV 413
            +LS   +G   + G   G  ++           L PV+ F     ++          H+
Sbjct: 163 QSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHL 222

Query: 414 MVTETDSKIRHGPRVTGLQ---AFRSQLD-------------NSFRLVVTSNDSRIRIFD 457
                D    H  RV  ++      + LD             +S  LV   +D  +R++D
Sbjct: 223 ATCSAD----HTARVWSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

Query: 458 LEQRKLLEVLKGFHSGS 474
           L  R+++    G H G+
Sbjct: 279 LSTREIVRQYGGHHKGA 295

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 77/210 (36%), Gaps = 31/210 (14%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVER-----------------AELDSSAE--- 217
           S  F +D K+M + S+DG I++W V    V+R                  EL S  +   
Sbjct: 80  SISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPNQGELISCDQDGN 139

Query: 218 -------SNKEARAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTP 270
                   N+     +      + SL+   +   L +                   +  P
Sbjct: 140 IRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKP 199

Query: 271 LRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVEFH 327
           +  ++ H + +  +  S +   + + S D T ++W  +    L+T +  H  +V    F 
Sbjct: 200 VTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLDGHQRWVWDCAF- 258

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEVSFEY 357
             D  + ++ C DH  RLW +   E+  +Y
Sbjct: 259 SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>Kwal_0.212
          Length = 303

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 116/317 (36%), Gaps = 54/317 (17%)

Query: 187 FMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQFLD 246
            +A+   D  IR W+ +     R    S +               QV+ L    +K+FL 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDS---------------QVNRLEISSDKRFLA 48

Query: 247 SATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWH 305
           +A                  +P P+  ++ H  +V  I + + N +++S+S D T+K+W 
Sbjct: 49  AAGHLNVRLYDIRTT-----NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWD 103

Query: 306 PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITS 365
               +  + + H   V  V  HP      IS   D   R+W + +++   +   +D    
Sbjct: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGE-LISCDQDGNVRIWDLGENQCVHQLAPEDDTPL 162

Query: 366 VTLS-PEEGKYTIIGTFNGYVHILMTRGLT------PVSSF-----HVADRQTQEQNAHV 413
            +LS   +G   + G   G  ++      T      PV+ F     ++          H+
Sbjct: 163 QSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHL 222

Query: 414 MVTETDSKIRHGPRVTGLQ---AFRSQLDNSFR-------------LVVTSNDSRIRIFD 457
                D    H  RV  +       + LDN  R             LV   +D  +R++D
Sbjct: 223 ATCSAD----HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWD 278

Query: 458 LEQRKLLEVLKGFHSGS 474
           L  R+++    G H G+
Sbjct: 279 LSTREIVRQYGGHHKGA 295

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 79/211 (37%), Gaps = 33/211 (15%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVER-----------------AELDSSAESNK 220
           S  F ++ K+M + S+DG I++W V    V+R                  EL  S + + 
Sbjct: 80  SIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGEL-ISCDQDG 138

Query: 221 EARAKSMRIKQQV-----------SSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPT 269
             R   +   Q V            SL+   +   L +                   +P 
Sbjct: 139 NVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPK 198

Query: 270 PLRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVEF 326
           P+  ++ H + +  +  S +   + + S D T ++W  D    L+T +  H  +V    F
Sbjct: 199 PVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAF 258

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEY 357
              D  + ++ C DH  RLW +   E+  +Y
Sbjct: 259 -SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 76/183 (41%), Gaps = 26/183 (14%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEA------RAKSMR 228
           AIWS   + DG+ + TGS D  +R W       E +E+  S ESNK           ++ 
Sbjct: 472 AIWSLDLTSDGRKLVTGSADKTVRFW-----TFEVSEVPVSDESNKTMPMLQLFHDTTLE 526

Query: 229 IKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKE---HVQDVLDIN 285
           +   + S+    + +F+                   VF    ++ +     H   VL ++
Sbjct: 527 LDDDILSVVISPDDKFI---------AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 577

Query: 286 WSKNN-FILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFFISGCLDHKC 343
            S ++  I++ S DK +K+W  D  +  K+ F H D +  V+F P    FF S   D   
Sbjct: 578 ISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFF-SCSKDATV 636

Query: 344 RLW 346
           + W
Sbjct: 637 KYW 639

>Scas_719.52
          Length = 628

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 50/121 (41%), Gaps = 19/121 (15%)

Query: 268 PTPLRLYKEHVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTFIHPDF----- 320
           P  + L++ H   VLD ++   N   I S+S D  + +W      S + ++ PD      
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNI 130

Query: 321 ------------VTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTL 368
                       V  V FHP  +    S  LD+  +LW+I   E        D++TS++ 
Sbjct: 131 KPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSF 190

Query: 369 S 369
           S
Sbjct: 191 S 191

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 290 NFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           N + S+S+D TVKLW+ +   ++ T  HPD VT + F    +    + C D K R+W I 
Sbjct: 154 NVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFSYGGNH-LATVCRDKKLRVWDIR 212

Query: 350 DDEVSFE 356
           + ++  E
Sbjct: 213 EGKIVSE 219

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 75/177 (42%), Gaps = 37/177 (20%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIW--KVIGS----------PVERAELDSSAESNKE- 221
           AIWS   + DGK + TGS D  ++ W  KV  S          PV +   D++ E   + 
Sbjct: 475 AIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDI 534

Query: 222 --ARAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQ 279
              R         +S L+N  +  FLDS                  F+   L LY  H  
Sbjct: 535 LCVRVSPDDRYLAISLLDNTVKVFFLDSMK----------------FY---LSLYG-HKL 574

Query: 280 DVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFF 334
            VL I+ S  +  I+++S DK +K+W  D  +  K+ F H D +  V+F P    FF
Sbjct: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFF 631

>Kwal_55.21559
          Length = 351

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 89/194 (45%), Gaps = 22/194 (11%)

Query: 271 LRLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTFI---HPDFVTCVEF 326
           L + +EH QDV  + W S+ + + S+S D T++LW  D  +     +   H   V C +F
Sbjct: 168 LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDF 227

Query: 327 HPTDDRFFISGCLDHK-CRLWSILDDEVSFEYDCQDLITSVTLSP---EEGKYTIIGTFN 382
             ++    ++ C D    R+W+ +++E + E    D+     + P       Y++  + +
Sbjct: 228 EKSESSLRLASCSDDSTVRVWNYVEEEENGE----DVWAQEAILPNVHSRAVYSVSWSLD 283

Query: 383 GYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSF 442
           GY+  + + GL  V       ++ ++    V+V + ++   HG     +  + + +D+S 
Sbjct: 284 GYIASVGSDGLLVVY------KEVKKGEWEVVVQQHEA---HGIYEINVVKW-ATVDDSV 333

Query: 443 RLVVTSNDSRIRIF 456
            L+   +D    I+
Sbjct: 334 LLLTGGDDGCANIW 347

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 265 VFHPTPLRLYKEHVQDVLDINW--SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVT 322
           V H  P++    H + V  + +  +    + S+S+D TV+LW+ ++  +     HPD VT
Sbjct: 127 VEHVAPVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVT 186

Query: 323 CVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFE 356
            + F      +  + C D   R+W I   EV  E
Sbjct: 187 SMSFS-YGGTYLATVCRDKMLRVWDIRKGEVVSE 219

>Kwal_23.5769
          Length = 627

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333
           Y  H   VL ++ S    I+S S DKTVK+WH + +       H ++V  V+ HP     
Sbjct: 393 YPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTC 451

Query: 334 FISGCLDHKCRLWSI 348
           F SG  D   R+W I
Sbjct: 452 F-SGSDDTTIRMWDI 465

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 266 FHPTPLRLYKEHVQDVLDINW---SKNNFILSASMDKTVKLWHPDRKNSLKTF 315
           F   P+ ++KEH ++V   NW   ++ NF LS+S D ++K+W P RK SL T 
Sbjct: 92  FKEFPIAIFKEHEREVFSCNWNLVNRQNF-LSSSWDGSIKIWSPLRKQSLMTL 143

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 94/233 (40%), Gaps = 18/233 (7%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
            +   KFS +G+++ATG  +   +I++V    +    +D +    ++A + S      + 
Sbjct: 320 VVCCVKFSNNGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDANSAS-SADLYIR 377

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINW-SKNNFIL 293
           S+    + +FL +                 V       + + H QD+  +++    N ++
Sbjct: 378 SVCFSPDGKFLATGAEDKLIRIWDIAQRKIVM------VLRGHEQDIYSLDYFQSGNKLV 431

Query: 294 SASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI----- 348
           S S D+T+++W         T    D VT V   P +  +  +G LD   R+W       
Sbjct: 432 SGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFL 491

Query: 349 ---LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSS 398
              LD E       +D + SV  +  +GK  + G+ +  V +   R +   S+
Sbjct: 492 VERLDSEGETGVGHKDSVYSVVFT-RDGKNIVSGSLDRSVKLWNLRNINGAST 543

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 15/69 (21%)

Query: 292 ILSASMDKTVKLWH----------PDRK---NSLKTFI-HPDFVTCVEFHPTDDRFFISG 337
           I+S S+D++VKLW+          P  K   N   T+I H DFV  V     +D++ +SG
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVT-TTENDQYILSG 579

Query: 338 CLDHKCRLW 346
             D     W
Sbjct: 580 SKDRGVIFW 588

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/317 (19%), Positives = 118/317 (37%), Gaps = 54/317 (17%)

Query: 187 FMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQFLD 246
            +A+   D  IR W+ +     R                      QV+ L    +K++L 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRT---------------IQHADSQVNRLEITSDKRYLA 48

Query: 247 SATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWH 305
           +A                  +P P+  ++ H  +V  I + ++N +++S+S D T+K+W 
Sbjct: 49  AAGHLHVRMYDIRTT-----NPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWD 103

Query: 306 PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITS 365
               +  + + H   V  V  HP      IS   D   ++W + +++ + +   +D    
Sbjct: 104 VRSPSVQRNYKHDAPVNEVVIHPNQGE-LISCDQDGNIKIWDLGENQCTNQLALEDNTAL 162

Query: 366 VTLS-PEEGKYTIIGTFNGYVHILM------TRGLTPVSSF-----HVADRQTQEQNAHV 413
            +LS   +G   + G   G  ++        T  L PV+ F     ++          H+
Sbjct: 163 QSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHL 222

Query: 414 MVTETDSKIRHGPRVTGLQ---AFRSQLD-------------NSFRLVVTSNDSRIRIFD 457
                D    H  RV  ++      + LD             +S  LV   +D  +R++D
Sbjct: 223 ATCSAD----HTARVWSVEDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWD 278

Query: 458 LEQRKLLEVLKGFHSGS 474
           L  R+++    G H G+
Sbjct: 279 LSTREIVRQYGGHHKGA 295

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 77/210 (36%), Gaps = 31/210 (14%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVER-----------------AELDSSAE--- 217
           S  F +D K+M + S+DG I++W V    V+R                  EL S  +   
Sbjct: 80  SIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVIHPNQGELISCDQDGN 139

Query: 218 -------SNKEARAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTP 270
                   N+     ++     + SL+   +   L +                      P
Sbjct: 140 IKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKP 199

Query: 271 LRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVEFH 327
           +  ++ H + +  +  S +   + + S D T ++W  +    L+T +  H  +V    F 
Sbjct: 200 VTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAF- 258

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEVSFEY 357
             D  + ++ C DH  RLW +   E+  +Y
Sbjct: 259 SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 15/166 (9%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKV-IGSPVERAELDSSAESNKEARAKSMRIKQQV 233
           AIWS   + DGK + T S D  ++ W   +   +    LD      K     ++ + + +
Sbjct: 469 AIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDL 528

Query: 234 SSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKE---HVQDVLDINWSKNN 290
             +    E +FL                   VF    ++ +     H   VL ++ S ++
Sbjct: 529 WCVKISPEDRFL---------AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDS 579

Query: 291 -FILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFF 334
             I+++S DK +K+W  D  +  K+ F H D +  V+F P    FF
Sbjct: 580 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 625

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 6/119 (5%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEF 326
            P++ +K H   V D   ++N  + LS S DKT++LW      + +TF+ H   V  V  
Sbjct: 56  VPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAI 115

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTL---SPEEGKYTIIGTFN 382
                   ISG  D   ++WSI  D ++      D ++ V +   S ++ K T+I   N
Sbjct: 116 DK-KASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGN 173

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 95/236 (40%), Gaps = 32/236 (13%)

Query: 180 KFSRDGKFMATGSKDGKIRIWKVIG----------SPVERAELDSSAESNKEARAKSMRI 229
           +++  G+ + TG + G++R+W V G          +P+   + +S         A +M I
Sbjct: 201 EWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260

Query: 230 KQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPT--------------PLRLYK 275
              V S    +   F ++ T                  P               P+   +
Sbjct: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320

Query: 276 EHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRF 333
            H + +  I ++++N  +LSAS D T+++W     N    F  H   +T    H  DD  
Sbjct: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA--HWVDDDT 378

Query: 334 FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVT--LSPEEGKYTIIGTFNGYVHI 387
            IS  +D   R+WS+  +  +      D + + T  LSP++GK+   GT +G V +
Sbjct: 379 IISTSMDGSIRVWSLASNS-TVASATVDGVPNFTGALSPDQGKFA-TGTLDGEVMV 432

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 18/159 (11%)

Query: 277 HVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI------HPDFVTCVEFHPT 329
           H Q VL      N N + SA +D    ++   RK+ ++  I      H  +++ +EF   
Sbjct: 168 HSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEF--L 225

Query: 330 DDRFFISGCLDHKCRLWSILDDEVSFEY-DCQDLITSVTLSPEE----GKYTIIGTFNGY 384
           DD   ++   D  C LW I   +   E+ D    + S++ +P E    G     G  +GY
Sbjct: 226 DDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGY 285

Query: 385 VHILMTRGLTPVSSFHVADRQTQE----QNAHVMVTETD 419
           ++I   R  T V SF V+D    +    +N + + T +D
Sbjct: 286 LYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIATGSD 324

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPT 329
           + ++K H   + +I +  +N IL+AS D T  LW   +   +  F  H   V  +   PT
Sbjct: 209 VSIFKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPT 268

Query: 330 DDR----FFISGCLDHKCRLW 346
           +       F SG  D    +W
Sbjct: 269 ETEGNGNVFASGGSDGYLYIW 289

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 53/125 (42%), Gaps = 16/125 (12%)

Query: 270 PLRLYKEHVQDVLDINWS---KNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEF 326
           P+ L++EH ++V   NW+   K+ F+ S+S D TVK+W P R  S+ T +       V  
Sbjct: 96  PIALFQEHQREVFSCNWNLLHKDTFV-SSSWDGTVKVWTPARPQSMLTLLPAPANRSVMV 154

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVH 386
            P      +S    HK        D      D +D I     SP +    +  + N YV 
Sbjct: 155 EPGARGLPLSNQQQHK--------DAA----DNKDCIYQAQFSPHDPNLVMSCSGNSYVS 202

Query: 387 ILMTR 391
           +   R
Sbjct: 203 LFDLR 207

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 4/50 (8%)

Query: 270 PLRLYKEHVQDVLDINWS---KNNFILSASMDKTVKLWHPDRKNSLKTFI 316
           P+ +++EH ++V   NW+   K  F+ S+S D TVK+W P R+ SL T +
Sbjct: 96  PISIFQEHQKEVFSCNWNLVNKQTFV-SSSWDGTVKIWSPMRQESLTTLV 144

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 68/176 (38%), Gaps = 23/176 (13%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           A+ + K+S D  +M +G  DG I+IW+   S V+  E+D+         A +  I+    
Sbjct: 137 AVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVK--EIDA---------AHTESIRDMAF 185

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINW-SKNNFIL 293
           S N+ K     D                         R+   H  DV   +W  +   I 
Sbjct: 186 SSNDSKFVTCSDDNILKIWNFSNGKQE----------RVLSGHHWDVKSCDWHPEMGLIA 235

Query: 294 SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           SAS D  VKLW P   N + + +     V    F PT     ++   D  CR++ I
Sbjct: 236 SASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDI 291

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 82/187 (43%), Gaps = 19/187 (10%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSM----RIKQ 231
           +++   S D + +ATG  DGKIRIW +    + +   + +A ++K+   K +    R   
Sbjct: 20  VYTCDVSPDSQRLATGGLDGKIRIWSI--PDILKFASNPNASTDKDILMKPLSTMSRHAG 77

Query: 232 QVSSLNNPKEKQFLDSATXXXXXX--XXXXXXXAPVF--------HPTPLRLYKEHVQDV 281
            V+++    + ++L S +                P+F        H    R    H  D+
Sbjct: 78  SVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDI 137

Query: 282 LDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCL 339
            DI W+ ++ I+ S  +D+ + +W+      +K F +H   V  V F P  +++F +   
Sbjct: 138 QDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPA-NKYFATASD 196

Query: 340 DHKCRLW 346
           D   +++
Sbjct: 197 DRTIKMF 203

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIG 204
           ++ + KFS DGK++A+GS D  + IW++ G
Sbjct: 78  SVTTVKFSPDGKYLASGSDDRILLIWELEG 107

>Scas_713.50
          Length = 983

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 76/179 (42%), Gaps = 41/179 (22%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWK-------VIGS-----PVERAELDSSAESNKEA 222
           AIWS   + DGK + TGS D  ++ W        V G+     P      D++ E + + 
Sbjct: 513 AIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDI 572

Query: 223 RAKSMRIKQQ-----VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEH 277
              S+R+  +     VS L+N  +  FLDS                       L LY  H
Sbjct: 573 L--SVRVSPEDKFLAVSLLDNTVKVFFLDSMKFF-------------------LSLYG-H 610

Query: 278 VQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFF 334
              VL I+ S  +  I+++S DK +K+W  D  +  K+ F H D +  V+F P    FF
Sbjct: 611 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFF 669

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 70/170 (41%), Gaps = 17/170 (10%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIW--KVIGSPVERAELDSSAESNKEARAKSMRIKQQ 232
           AIWS   + +GK + TGS D   + W  +V+   V   + D      K     ++ +   
Sbjct: 466 AIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTK-DKYIPQLKLVHDTTLELTDD 524

Query: 233 VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKE---HVQDVLDINWSKN 289
           + ++    E ++L                   VF    L+ Y     H   VL I++S +
Sbjct: 525 ILAVKISSEDRYL---------AVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVD 575

Query: 290 N-FILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFFISG 337
           +  ++++S DK +K+W  D  +  K+ F H D +  V F      FF  G
Sbjct: 576 SKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCG 625

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 50/99 (50%), Gaps = 6/99 (6%)

Query: 270 PLR-LYKEHVQDVLDINWSKN--NFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVE 325
           PL+ + + H + +L ++W K   N +LS+  D T  LW+P     L  F    ++    +
Sbjct: 242 PLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCFKTK 301

Query: 326 FHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLIT 364
           F P     F S  LD+K ++ ++    ++ + D +D+++
Sbjct: 302 FAPEAPDLFASASLDNKIQVQTL--QNLTNKLDLEDIVS 338

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 2/95 (2%)

Query: 433 AFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVN 492
           +FR+  D S  + V S+   I  +DL +R  + +LK  HS       + S  +GQPI+V 
Sbjct: 253 SFRT--DGSSHICVGSSKGDILFYDLNRRARIHLLKNVHSEEFGGVTRASFLNGQPIIVT 310

Query: 493 SSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG 527
           S  D+ +  +    S  ++D+D   + P+ L   G
Sbjct: 311 SGGDNSLKEYVFDPSLSQSDEDMVVQPPRFLRSRG 345

>Scas_660.8
          Length = 510

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 311 SLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQ-------DLI 363
           S+    HP  VT  +FHP D++  I+   D   RLW     ++S  Y  Q       D +
Sbjct: 119 SINASTHPTHVT--KFHPQDNKTLITASDDRVIRLW-----DISNAYQPQLELTGSTDYV 171

Query: 364 TSVTLSPEEGKYTIIGTFNGYVHILMTR--GLTPVSSF 399
            SVT  P      + G+++G + +  TR  G +P+ S 
Sbjct: 172 RSVTCVPSAPHMIVSGSYDGIIRLYDTRASGSSPIYSL 209

>Scas_693.36
          Length = 375

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 270 PLRLYKEHVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTF 315
           P+ ++ EH ++V+  NW+  N     S+S D TVK+W P RK SL T 
Sbjct: 96  PIAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLLTL 143

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 1/106 (0%)

Query: 421 KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ 480
           KIR     T + +   + D +  + V S    +  +DL+ R  ++VLKG H   +   A+
Sbjct: 243 KIRTIKTPTRISSISFRTDGASHISVASTSGDLIFYDLDHRSRVQVLKGIHKEVNGGVAR 302

Query: 481 LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARS 526
            S  +GQPIVV    D+ +  +    S  + D  E   +P  L RS
Sbjct: 303 ASFLNGQPIVVTCGGDNQLKEFVFDPSLSQGDS-EVVIQPARLLRS 347

>Kwal_26.7736
          Length = 507

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD-DEVSFEY-DCQDLITSVTLSPEEGK 374
           HP  V   +FHP D R  ++   D   R+W I    E   E     D + SV + P+   
Sbjct: 125 HPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPH 182

Query: 375 YTIIGTFNGYVHILMTR 391
             + G+++G V +  TR
Sbjct: 183 LVVTGSYDGQVRLFDTR 199

>Kwal_56.23895
          Length = 367

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 270 PLRLYKEHVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTF 315
           P+ ++ EH ++V   NW+  N    +S+S D TVK+W P R  SL T 
Sbjct: 96  PIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATL 143

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 93/236 (39%), Gaps = 34/236 (14%)

Query: 268 PTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEF 326
           P P+  ++ H  +V  I + + N +++S+S D T+K+W     +  + + H   V  V  
Sbjct: 65  PNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAI 124

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLS-PEEGKYTIIGTFNGYV 385
           HP      IS   D   R+W + +++ + +   +D     +LS   +G   + G   G  
Sbjct: 125 HPNQGE-LISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNC 183

Query: 386 HILM------TRGLTPVSSF-----HVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQ-- 432
           ++           L PV+ F     ++          H+     D    H  RV  ++  
Sbjct: 184 YVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSAD----HTARVWNIEDN 239

Query: 433 -AFRSQLD-------------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
               + LD             +S  LV   +D  +R++DL   +++    G H G+
Sbjct: 240 FELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGA 295

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 31/210 (14%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVER-----AELDSSAESNKEARAKS------ 226
           S  F ++ ++M + S+DG I++W V    V+R     A ++  A    +    S      
Sbjct: 80  SIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHPNQGELISCDQDGN 139

Query: 227 MRI----KQQVSSLNNPKEK---QFLDSATXXXXXXXXXXXXXAPVF---HPT------P 270
           +RI    + Q ++   P++    Q L  A+               V+   H T      P
Sbjct: 140 IRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDASTLEP 199

Query: 271 LRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVEFH 327
           +  +K H + +  +  S +   + + S D T ++W+ +    L+T +  H  +V    F 
Sbjct: 200 VTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAF- 258

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEVSFEY 357
             D  + ++ C DH  RLW +   E+  +Y
Sbjct: 259 SADSAYLVTACSDHYVRLWDLSTSEIVRQY 288

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 85/198 (42%), Gaps = 20/198 (10%)

Query: 271 LRLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWH---PDRKNSLKTFIHPDFVTCVEF 326
           + + +EH QDV  + W +K+N + S+S D TV++W     D + +     H   + C +F
Sbjct: 150 ISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209

Query: 327 HPTDDRF-FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTF---N 382
              +D     SG  D   R+W  + D+   E D Q+ +   TL P   +  I G     +
Sbjct: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDD---EDDQQEWVCESTL-PNAHRSQIYGVAWSPS 265

Query: 383 GYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFR-SQLDNS 441
           G +  +   G+  V        + ++ ++ V   E  +  +    V  +   +   +D  
Sbjct: 266 GRIASVGADGVLAV-------YKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGK 318

Query: 442 FRLVVTSNDSRIRIFDLE 459
             L+   +D R+ +++ +
Sbjct: 319 EMLITAGDDGRVNLWNYQ 336

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 277 HVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFF 334
           HV  V DI  SK + ++ SAS DK VK W  +R  +++ F  H   V  V+ HP+ D   
Sbjct: 164 HVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIA 223

Query: 335 ISGCLDHKCRLWSI 348
            +G  D   RLW I
Sbjct: 224 TAG-RDAVVRLWDI 236

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 82/204 (40%), Gaps = 36/204 (17%)

Query: 304 WHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLI 363
           WH   K S     H  +V CV   P D+ +F +G  D   ++W                 
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWD---------------- 151

Query: 364 TSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIR 423
               L+  + K T+IG      H++  R +            ++++       E ++ IR
Sbjct: 152 ----LAAGKLKITLIG------HVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIR 201

Query: 424 --HGPRVTGLQAFRSQLDNSFRLVVTSN-DSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ 480
             HG  ++G+      +  S  ++ T+  D+ +R++D+  R  + VL G  S  ++ K  
Sbjct: 202 DFHG-HLSGVHTV--DVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKC- 257

Query: 481 LSIWHGQPIVVNSSDDHWVYGWRL 504
           L +    P +++ S D  V  W +
Sbjct: 258 LPV---DPQIISCSGDATVRLWDI 278

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 18/120 (15%)

Query: 268 PTPLRLYKEHVQDVLDINWS--KNNFILSASMDKTVKLWH-PDRKNSLKT---------- 314
           P  + L++ H   VLD ++    +N + S+S D  + +W  P   + LK+          
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIE 130

Query: 315 ---FI--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLS 369
              F+  H   V  + +HPT      S  LD+  R+W++   E  ++    D++TS++ S
Sbjct: 131 PTKFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSFS 190

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           + S  FS DG  +AT ++D K+R+W V
Sbjct: 184 VTSMSFSYDGTHLATVARDKKLRVWNV 210

>Scas_592.4*
          Length = 318

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEF 326
            P+R +K H   V D   +++  + LSAS DKT++LW      + + F+ H   V  V  
Sbjct: 56  VPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 327 HPTDDR---FFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEE 372
               DR     ISG  D   ++W+I    ++      D ++ V ++P +
Sbjct: 116 ----DRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 274 YKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDD 331
           +  H  DV+ +    K + I+S S DKT+K+W   +   L T + H D+V+ V   PTD 
Sbjct: 103 FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPTDQ 161

Query: 332 R----FFISGCLDHKCRLWSILDDEVSFEYDCQDL-ITSVTLSPE 371
                  IS   D   + W++   ++  ++   +  + +VT SP+
Sbjct: 162 NDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPD 206

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           ++SA  DK VK W+ ++      F+ H   V  V   P D     S   D +  LW++ +
Sbjct: 168 VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASP-DGTLIASAGKDGEIMLWNLAE 226

Query: 351 DEVSFEYDCQDLITSVTLSP 370
            +  +    QD + S+  SP
Sbjct: 227 KKAMYTLSAQDEVFSLAFSP 246

>Scas_721.115*
          Length = 318

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEF 326
            P+R +K H   V D   +++  + LSAS DKT++LW      + + F+ H   V  V  
Sbjct: 56  VPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 327 HPTDDR---FFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEE 372
               DR     ISG  D   ++W+I    ++      D ++ V ++P +
Sbjct: 116 ----DRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 274 YKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDD 331
           +  H  DV+ +    K + I+S S DKT+K+W   +   L T + H D+V+ V   PTD 
Sbjct: 103 FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPTDQ 161

Query: 332 R----FFISGCLDHKCRLWSILDDEVSFEYDCQDL-ITSVTLSPE 371
                  IS   D   + W++   ++  ++   +  + +VT SP+
Sbjct: 162 NDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPD 206

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           ++SA  DK VK W+ ++      F+ H   V  V   P D     S   D +  LW++ +
Sbjct: 168 VISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASP-DGTLIASAGKDGEIMLWNLAE 226

Query: 351 DEVSFEYDCQDLITSVTLSP 370
            +  +    QD + ++  SP
Sbjct: 227 KKAMYTLSAQDEVFALAFSP 246

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 92/248 (37%), Gaps = 38/248 (15%)

Query: 78  LKYSNNGNATDSFMRLKEHLQ----RGNTLNSNLRVNEFYPFNSIDTEQFENYLREPKYI 133
           LK +  GN  D  +RL + L+    R  TL S ++V    P          N+L+    +
Sbjct: 123 LKLACLGN--DGILRLYDALEPSDLRSWTLTSEMKVLSIPP---------ANHLQSDFCL 171

Query: 134 KMLKRRKNLKQFRRLFLAQELMAYEGXXXXXXXXXXXXXXXAI-----WSTKFSRDGKFM 188
                R + ++     L Q ++   G               ++     W+    R  + +
Sbjct: 172 SWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLI 231

Query: 189 ATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQFLDSA 248
           ATG KDG+IRI+K+       A  +S   SN    +  + +  Q  S +N +EK  L S 
Sbjct: 232 ATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSN 291

Query: 249 TXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWHPD 307
                                 L  + +H  +V  ++W+    IL SA  D  V+LW   
Sbjct: 292 -----------------LQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKAT 334

Query: 308 RKNSLKTF 315
             N  K  
Sbjct: 335 YSNEFKCM 342

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 274 YKEHVQDVLDINWSKNNF---ILSASMDKTVKLWHPD 307
           ++ H   ++ I+W+   +   I SAS DKTVKLW  D
Sbjct: 51  WRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEED 87

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 422 IRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQL 481
           I+   R++ L +FR+  D S  L V S +  +  +DL++R  + VLK  H  +    ++ 
Sbjct: 251 IKTPVRISSL-SFRT--DGSAHLSVASTNGDLIFYDLDRRSRIHVLKNIHKEAHGGISKA 307

Query: 482 SIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG 527
              +GQPI+V S  D+ +  +    S  + D +   + P+ L   G
Sbjct: 308 CFLNGQPIIVTSGGDNQLKEYVFDPSLSQGDSEIVVQPPRFLRSRG 353

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 271 LRLYKEHVQDVLDINWSKNNF-ILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT 329
           LR Y+ H   + D+N++ N     SAS DK VK+W+ ++    K         C+ FHP 
Sbjct: 172 LRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPK 231

Query: 330 DDRFFISGCLDHKCR 344
           D    + G  + + R
Sbjct: 232 DKNQLVVGLSNSEIR 246

>Kwal_23.4118
          Length = 939

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 422 IRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQL 481
           I+   R++ L  FR+  D    L   +++  +  +DL++R  + VLK  H  +    A+ 
Sbjct: 246 IKTPVRISSL-TFRT--DGPAHLAAGASNGDLIFYDLDRRSRIHVLKNVHREAFGGIAKA 302

Query: 482 SIWHGQPIVVNSSDDH----WVYGWRLKSSDRENDQDEPK 517
           +  +GQPIVV S DD+    +V+   L +SD E     P+
Sbjct: 303 AFLNGQPIVVTSGDDNQLKEYVFDPSLSNSDGEVVVQPPR 342

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 7/80 (8%)

Query: 269 TPLRLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDR---KNSLKTFIHPDFVTCV 324
           T LR Y+ H + V DIN+ S     LS S D+T+K+W  +    K+ LK    P+   C 
Sbjct: 213 TLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPN---CA 269

Query: 325 EFHPTDDRFFISGCLDHKCR 344
            +HPT++  +I G  + + R
Sbjct: 270 TYHPTNNNEYIVGLSNSEIR 289

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEF 326
            P+R +K H   V D   + +  + LSAS DKT++LW      + + F+ H   V  V+ 
Sbjct: 56  VPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEE 372
                   ISG  D   ++W+I    ++      D ++ V + P E
Sbjct: 116 DK-KASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNE 160

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 274 YKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPT-- 329
           +  H  DV+ ++  K  + I+S S DKT+K+W   +   L T + H D+V+ V   P   
Sbjct: 103 FVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRVVPNEK 161

Query: 330 ---DDRFFISGCLDHKCRLWSILDDEVSFEYDCQDL-ITSVTLSPE 371
              D    IS   D   + W++   ++  ++   +  I ++T SP+
Sbjct: 162 ADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPD 207

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           I+SA  DK VK W+ ++      FI H   +  +   P D     S   D +  LW++  
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASP-DGTLIASAGKDGEIMLWNLAA 227

Query: 351 DEVSFEYDCQDLITSVTLSP 370
            +  +    QD + S+  SP
Sbjct: 228 KKAMYTLSAQDEVFSLAFSP 247

>Kwal_27.12586
          Length = 509

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 3/102 (2%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           S+NN +LS S DKT+++W     +S   F+         F   DD+  I+  LD   RLW
Sbjct: 345 SENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDDK-VIATSLDGSVRLW 403

Query: 347 SILDDEVSFEYDCQDL-ITSVTLSPEEGKYTIIGTFNGYVHI 387
           S L + +        + I   +LSP++ K+  IG  +G V +
Sbjct: 404 SHLTNTLQAISMVDGVPIFCGSLSPDKLKFA-IGKMDGEVTV 444

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 277 HVQDVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFF 334
           H + +  ++WS+N + L S S D T+K+W   +K +++T + H   V+ V+F+  +  + 
Sbjct: 346 HSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYL 405

Query: 335 ISGCLDHKCRL 345
           +S   D K  +
Sbjct: 406 VSSGYDKKVNI 416

>Kwal_56.23920
          Length = 937

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 73/177 (41%), Gaps = 37/177 (20%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIW--KVIGSPVE----------RAELDSSAESNKEA 222
           AIWS   + DGK + TGS D  +  W  +V   PV           +   D++ E N + 
Sbjct: 469 AIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDV 528

Query: 223 RAKSMRIKQQ---VSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQ 279
            A  +    +   VS L+N  +  F+DS                       L LY  H  
Sbjct: 529 LAVKISPDNRLLAVSLLDNTVKVFFMDSMKFF-------------------LSLYG-HKL 568

Query: 280 DVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFF 334
            VL I+ S  +  ++++S DK +K+W  D  +  ++ F H D +  V F P    FF
Sbjct: 569 PVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFF 625

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIW 200
           +W+   S DG+F+ + S D  IR+W
Sbjct: 654 VWTLAISSDGRFVVSASHDQSIRVW 678

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 99/237 (41%), Gaps = 36/237 (15%)

Query: 268 PTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEF 326
           P P+  ++ H  +V  +++ ++N +++++S D T+K+W     +  + + H   V  V  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLS-PEEGKYTIIGTFNGYV 385
           HP      IS   D   R+W + +++ + +   +D  +  +LS   +G         G  
Sbjct: 125 HPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183

Query: 386 HILM------TRGLTPVSSF-----------------HVADRQTQEQNAHVMVTETDSKI 422
           ++           L PV+ F                 H+A   + +  A V   + D K+
Sbjct: 184 YVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLA-TCSADHTARVWSIDDDFKL 242

Query: 423 RHGPRVTGLQAFRSQLDNSFR-----LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
                + G Q  R   D +F      LV  S+D  +R++DL  R+++    G H G+
Sbjct: 243 E--TTLDGHQ--RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 77/210 (36%), Gaps = 31/210 (14%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIG----------SPVERAELD-SSAESNKEARAKS 226
           S  F +D ++M T S+DG I++W V            +PV    +  +  E     R  +
Sbjct: 80  SVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGN 139

Query: 227 MRI----------------KQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTP 270
           +RI                   + SL+   +   L +A                  H  P
Sbjct: 140 IRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKP 199

Query: 271 LRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVEFH 327
           +  ++ H   +  I  S +   + + S D T ++W  D    L+T +  H  +V    F 
Sbjct: 200 VTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAF- 258

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEVSFEY 357
             D  + ++   DH  RLW +   E+  +Y
Sbjct: 259 SADSAYLVTASSDHYVRLWDLSTREIVRQY 288

>Scas_581.3
          Length = 626

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKY 375
           H   VT + FHP +D    SG +D  C LW   ++++    D ++ + +V   P+   Y
Sbjct: 490 HSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNNDLIDSIDLKEDVIAVQWLPDRDTY 548

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 7/113 (6%)

Query: 422 IRHGPRVTGLQAFRSQL-------DNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
           +R G R+  ++  +S++       D S  L V ++   +  +DL++R  + VLK  H  S
Sbjct: 235 MRKGKRIRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRES 294

Query: 475 SQHKAQLSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG 527
                Q +  +GQPI+V S  D+ +  +    S  +   D   + P+ L   G
Sbjct: 295 YGGVTQATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRG 347

>Scas_659.9
          Length = 475

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMR 228
           ++  KFS D K++ +GS DG +R+W+      ER+ + ++ E NK A  + ++
Sbjct: 345 VFQVKFSMDAKYIVSGSDDGNVRLWR--SKAWERSNVKTTKEKNKLAYDEKLK 395

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCVEFH 327
           L ++K+HV  V+D+++S   + I++ S DKT+++++    +S + +       V  V+F 
Sbjct: 292 LNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQVKF- 350

Query: 328 PTDDRFFISGCLDHKCRLW 346
             D ++ +SG  D   RLW
Sbjct: 351 SMDAKYIVSGSDDGNVRLW 369

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 102/265 (38%), Gaps = 59/265 (22%)

Query: 290 NFILSASMDKTVKLW------HPDRKNS---------LKTFIHPDFV-TCVEFHPTDDRF 333
           NF+LS S DKTVKLW      + + KN+         LKT+ + DF    ++ H +   F
Sbjct: 130 NFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTY-YSDFAFQGIDHHRSKSNF 188

Query: 334 FISGCLDHKCRLWSI-----LDD---------EVSFEYDCQDLITSVTLSPEEGKYTIIG 379
              G    K +LW       L D          V F  +  D++ S         Y +  
Sbjct: 189 VTGGA---KIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRT 245

Query: 380 T--FNGYVHILMTRGL--TPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFR 435
                  V  + T  +   P+ +F+      ++ NA+         +R+  R   L  F+
Sbjct: 246 NSPTQKIVQTMRTNAICWNPMEAFNFV-VANEDHNAYYY------DMRNMSR--ALNVFK 296

Query: 436 SQ----LDNSF-----RLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHG 486
                 +D  F      +V  S D  IRIF+       E+   +H+   QH  Q+     
Sbjct: 297 DHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREI---YHTKRMQHVFQVKFSMD 353

Query: 487 QPIVVNSSDDHWVYGWRLKSSDREN 511
              +V+ SDD  V  WR K+ +R N
Sbjct: 354 AKYIVSGSDDGNVRLWRSKAWERSN 378

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 289 NNFILSASMDKTVKLW--HPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
            + ILS   D TVKLW  + DRK  L+ F+ H   +  ++F  +D   F+SG  D + ++
Sbjct: 161 GHLILSGGNDNTVKLWDFYHDRK-CLRDFVGHSKPIKTLDF-TSDSSQFLSGSYDQQVKI 218

Query: 346 WSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTR-----GLTPVSSFH 400
           W     +V+   +      S    P  G   ++G  +  +    TR     GL  V   H
Sbjct: 219 WDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDHH 278

Query: 401 VA 402
           ++
Sbjct: 279 LS 280

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 271 LRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTFIHPDFV--TCVEFH 327
           L  ++EH   V  + ++KN  I+ S+S+D TVK W   R  + +TF   + +  +C+   
Sbjct: 391 LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAAD 450

Query: 328 PTDDRFFISGCLD-HKCRLWSI 348
           PT +    +G LD +  ++WS+
Sbjct: 451 PTGE-VVCAGSLDNYDIQVWSV 471

>Scas_585.8
          Length = 460

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 81/213 (38%), Gaps = 26/213 (12%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           A+   ++S  G +M +G  DG I+IW+   + V+  E          A  + +R    +S
Sbjct: 133 AVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFE---------NAHTECIR---DIS 180

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINW-SKNNFIL 293
             NN  + +F+  +                       R    H  D+   +W  +   I+
Sbjct: 181 FSNN--DSKFVTCSDDNVLKIWNFSNGQVE-------RTLSGHHWDIKSCDWHPEMGLIV 231

Query: 294 SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD- 351
           SAS D  VKLW P     + T I     V    F PT      +   D  CR++ I    
Sbjct: 232 SASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSM 291

Query: 352 -EVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
            E+    D  D +T +T +P       +G ++G
Sbjct: 292 KELMCVRDEVDYMT-LTWNPINESMFTVGNYDG 323

>Scas_692.25
          Length = 488

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 82/206 (39%), Gaps = 38/206 (18%)

Query: 177 WSTKFSRDGKFMATGSKDGKIRI--WKV-------IGS--PVERAELDSSAESNKEARAK 225
           W       G F+ +GS+D  +R+  W         IG   P+E  +      +N++A   
Sbjct: 281 WVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPT 340

Query: 226 SMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAP--VFH--PTP---------LR 272
              +++ +   ++ ++  F   A+              P  V H  P P         + 
Sbjct: 341 INYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIM 400

Query: 273 LYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCVEFHP-- 328
             K H   V D+   + N++ S S DKT++ W+ +    +K +  +H  FVTC++  P  
Sbjct: 401 TLKGHASWVKDLR-IRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDMDPDG 459

Query: 329 -TDD--------RFFISGCLDHKCRL 345
            T+D            +G LD KC +
Sbjct: 460 GTNDTGQQSLQREIMATGGLDSKCNI 485

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 61/140 (43%), Gaps = 16/140 (11%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
           S N  +LSAS DKT++ W     NS   F  H   +T  ++   DD   IS  +D   R+
Sbjct: 346 SDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADW--LDDDRLISTSMDGSVRV 403

Query: 346 WSILDDE-VSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLT---------- 394
           WS+  +  V         I   TLS ++ K+   GT +G V +   + L           
Sbjct: 404 WSVKQNALVGLSVVDGVPIFCGTLSSDKQKFA-TGTLDGEVSVYNVKKLLEVLDADEKPI 462

Query: 395 -PVSSFHVADRQTQEQNAHV 413
            PV    + D Q+ ++ ++V
Sbjct: 463 GPVRIPTIGDYQSTKEGSYV 482

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 95/231 (41%), Gaps = 28/231 (12%)

Query: 270 PLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHP 328
           P+  ++ H  +V  +++ ++N +++++S D T+K+W     +  + + H   V  V  HP
Sbjct: 67  PVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHP 126

Query: 329 TDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLS-PEEGKYTIIGTFNGYVHI 387
                 IS   D   R+W + +++ + +   +D +   +LS   +G   +     G  ++
Sbjct: 127 NQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYV 185

Query: 388 LMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFR-----------S 436
                 T  S+   A +  +   +++      S ++H    +     R           S
Sbjct: 186 WEMPNHTDASNLKPATK-FKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLES 244

Query: 437 QLD-------------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
            LD             +S  LV  S+D  +R++DL  R ++    G H G+
Sbjct: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGA 295

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVER 209
           S  F +D K+M T S+DG I++W +    V R
Sbjct: 80  SVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPR 111

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVE 325
           TPL   K H   VL + WS +   I + SMD T++LW  ++  SL   +  H  ++T + 
Sbjct: 175 TPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLS 234

Query: 326 FHP 328
           + P
Sbjct: 235 WEP 237

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 55/132 (41%), Gaps = 7/132 (5%)

Query: 218 SNKEARAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEH 277
           S ++A+A+++R  ++V+  N   E+  +  +               P+   T  +    H
Sbjct: 346 SPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNH 405

Query: 278 VQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFIS 336
           V    D       +I+SAS D ++KLW       + TF  H   V  V +  +D R  +S
Sbjct: 406 VAFSPD-----GRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWS-SDCRLLVS 459

Query: 337 GCLDHKCRLWSI 348
              D   ++W +
Sbjct: 460 CSKDTTLKVWDV 471

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVE 325
           TP+   K H   VL ++WS +   I + SMD T++LW P     L   +  H  ++T + 
Sbjct: 177 TPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLS 236

Query: 326 FHP 328
           + P
Sbjct: 237 WEP 239

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 88/224 (39%), Gaps = 36/224 (16%)

Query: 304 WHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLI 363
           WH   K +     H  +V CV   P D+ +F +G  D   R+W              DL 
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVW--------------DLA 144

Query: 364 TSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIR 423
           T        GK  +  T  G  HI+  R +   +        +Q++       E ++ +R
Sbjct: 145 T--------GKLKV--TLQG--HIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVR 192

Query: 424 --HGPRVTGLQAFRSQLDNSFRLVVTSN-DSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ 480
             HG  ++G+ +    L  S  L+V++  DS +R++D+  R  +  L G H G       
Sbjct: 193 DFHGT-LSGVHSV--DLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAG-HRGPINKVRC 248

Query: 481 LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLA 524
           L +    P +V+ S D  V  W L +          KR  + LA
Sbjct: 249 LPV---DPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLA 289

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 277 HVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFIHPDF--VTCVEFHPTDDRF 333
           H+  V DI  S ++ ++ SAS DK VK W  +R   ++ F H     V  V+ HP+ D  
Sbjct: 155 HIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDF-HGTLSGVHSVDLHPSLD-L 212

Query: 334 FISGCLDHKCRLWSI 348
            +S   D   R+W I
Sbjct: 213 IVSAGRDSVVRVWDI 227

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFIHPDF-VTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           I+S S D TVKLW       +KT  H    V  + F+PT+   F S C D   R W ++D
Sbjct: 255 IVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFS-FASACTD-DIRSWKLVD 312

Query: 351 DEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
            ++   ++ + L    TL+  +      G   G
Sbjct: 313 GQLLTNFNSEALGIVNTLACNQDGVLFAGGDTG 345

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 46/87 (52%), Gaps = 21/87 (24%)

Query: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGS------------SQHKAQLSIW 484
           LD S R +V+ SND  IRI+DL++RK L  L G H GS                 QL+ W
Sbjct: 47  LDISKRYLVSGSNDENIRIYDLQKRKELGTLLG-HQGSITNLRFSRGKDADGQDIQLNKW 105

Query: 485 HGQPIVVNSSDDHWVYGWRLKSSDREN 511
                ++++S+DH +  WR+K  D EN
Sbjct: 106 -----LLSASEDHKIIVWRVK--DWEN 125

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 289 NNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           N ++LSAS D  + +W      +  T   H   +   + HP++ R  +S   DH  RLW+
Sbjct: 103 NKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSN-RVAVSVSEDHSIRLWN 161

Query: 348 IL 349
           ++
Sbjct: 162 LM 163

>KLLA0E18139g 1608371..1609351 highly similar to sp|P36104
           Saccharomyces cerevisiae YKL018w singleton, start by
           similarity
          Length = 326

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 269 TPLRLYKEHVQDVLDINWSK-NNFILSASMDKTVKLWHPDRKNSLKTFIHPDFV-TCVEF 326
           T LR ++ H   V DI  S  ++  LSAS D++V+LW  D ++S    + P  V TC+ +
Sbjct: 103 TYLRYFQGHGALVSDIQMSPLDDTFLSASYDESVRLW--DLRSSKAQALIPSLVPTCIAY 160

Query: 327 HPTDDRFFISGCLDHKCRLWSI 348
            P+   F I    +H+  L+++
Sbjct: 161 DPSGLVFAIGNPENHEVGLYNV 182

>Sklu_2384.3 YKL018W, Contig c2384 6547-7533
          Length = 328

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 271 LRLYKEHVQDVLDINWSK-NNFILSASMDKTVKLWHPDRKNSLKTFIHPDFV-TCVEFHP 328
           LR +  H   V DI  S   +  LSAS D++V+LW  D + S    I P  V TC+ + P
Sbjct: 105 LRYFTGHGALVSDIEMSPLEDVFLSASYDESVRLW--DLRTSKAQAIVPSLVPTCIAYDP 162

Query: 329 TDDRFFISGCLDHKCRLWSI 348
           +   F I    +H+  L++I
Sbjct: 163 SGLVFAIGNPENHEIGLYNI 182

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCVEFHP 328
           L+ +   V D   +++S+N F L+AS DKT+KLW  D+   +KTF  IH D V       
Sbjct: 133 LQAHNASVWDAKVVSFSENKF-LTASADKTIKLWQNDK--VIKTFSGIHNDVVR--HLAV 187

Query: 329 TDDRFFISGCLDHKCRL 345
            DD  FIS   D   +L
Sbjct: 188 VDDGHFISCSNDGLIKL 204

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 61/158 (38%), Gaps = 35/158 (22%)

Query: 311 SLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD-EVSFE-YDCQDLITSVTL 368
           S+K   HP  VT  +FHP D +  ++   D   R+W I    E + E     D + SV  
Sbjct: 119 SIKASTHPAHVT--KFHPLDKQTLVTATDDRVVRVWDISHAYEPTLELLGASDYVRSVCF 176

Query: 369 SPEEGKYTIIGTFNGYV--HILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGP 426
            P      + G ++G V  H   TR   PV                       +++ HG 
Sbjct: 177 VPGAPHMVVSGCYDGVVRLHDTRTRSAQPV-----------------------TQLNHGM 213

Query: 427 RVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLL 464
            V  + A       S   +V+   S+ +++DL   KLL
Sbjct: 214 SVEDIVAI------SPTQLVSCGGSKFKVWDLTGNKLL 245

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 270 PLRLYKEHVQDVLDINWS--KNNFILSASMDKTVKLWHPDRKNSLKTF 315
           P+ +YKEH ++V   NW+  +    +S+S D  VKLW   R  SL T 
Sbjct: 96  PIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTM 143

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 427 RVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHG 486
           RV+ L +FR+  D S  + + S +  +  +DL ++  + VLKG H  +    +++S  +G
Sbjct: 338 RVSSL-SFRT--DGSAHMAIASTNGDLVFYDLNRKTRIHVLKGIHRDTYGGISKVSFLNG 394

Query: 487 QPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG 527
           Q IVV S  D+ +  +    S   ++ +   + P+ L   G
Sbjct: 395 QSIVVTSGGDNQLKEFAFDPSLSHSESETVVQPPRLLRSRG 435

>Kwal_33.15136
          Length = 473

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT 329
           L ++K+HV  V+D+++S   + I++ S DKT++++     +S + +         +   T
Sbjct: 293 LHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQVKYT 352

Query: 330 -DDRFFISGCLDHKCRLW 346
            D R+ +SG  D   R+W
Sbjct: 353 MDSRYIVSGSDDGNVRMW 370

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNK 220
           ++  K++ D +++ +GS DG +R+W+      +R+ + S+ E NK
Sbjct: 346 VFQVKYTMDSRYIVSGSDDGNVRMWR--AKAWDRSSVKSTREKNK 388

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 444 LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWR 503
           +V  S D  IRI+ ++     E+   +H+   QH  Q+        +V+ SDD  V  WR
Sbjct: 315 IVTGSYDKTIRIYQVKHGHSREI---YHTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMWR 371

Query: 504 LKSSDR 509
            K+ DR
Sbjct: 372 AKAWDR 377

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNK 220
           ++  KFS D K++ +GS DG +R+W+      ER+ + S+ E NK
Sbjct: 348 VFQAKFSMDSKYVMSGSDDGNVRLWR--AKAWERSNVKSTKELNK 390

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCV---EF 326
           L ++K+HV  V+D++ S     +++AS DKT++++ P  K   +   H   +  V   +F
Sbjct: 295 LNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIF-PINKGHSREIYHTKRMQHVFQAKF 353

Query: 327 HPTDDRFFISGCLDHKCRLW 346
              D ++ +SG  D   RLW
Sbjct: 354 -SMDSKYVMSGSDDGNVRLW 372

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 444 LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWR 503
           +V  S D  IRIF + +    E+   +H+   QH  Q         V++ SDD  V  WR
Sbjct: 317 VVTASYDKTIRIFPINKGHSREI---YHTKRMQHVFQAKFSMDSKYVMSGSDDGNVRLWR 373

Query: 504 LKSSDREN 511
            K+ +R N
Sbjct: 374 AKAWERSN 381

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 68/154 (44%), Gaps = 20/154 (12%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHP 328
           +R    H   V+ I ++ K N + S+SMD+++K WH     +LKT   H D V  ++   
Sbjct: 103 IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPK 162

Query: 329 TDDRFFISGCLDHKCRLWSILDDEV-----SFEYDCQDLITSVTLSP-------EEGKYT 376
            D     SG  D   R   I D E      +  YD +D I    + P         GK+ 
Sbjct: 163 FDSSILSSGSYDGLIR---IFDTESGHCLKTLTYD-KDWIAEDGVVPISTVKFSRNGKFL 218

Query: 377 IIGTFNGYVHIL-MTRGLTPVSSFHVADRQTQEQ 409
           ++ + +  V +   TRG T V +F    ++T+ +
Sbjct: 219 LVKSLDNVVKLWEYTRG-TVVRTFLWPHQETKAK 251

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAEL 212
           I + KFSR+GKF+   S D  +++W+     V R  L
Sbjct: 206 ISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFL 242

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 179 TKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAES 218
            KFSR+GKF+   S DG +++W  I   V R   D+S ES
Sbjct: 195 VKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGES 234

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 88/220 (40%), Gaps = 38/220 (17%)

Query: 272 RLYK--EHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFH 327
           RL+K   H   VL + +  K N + +AS+D+++K W       LKT   H D V  ++  
Sbjct: 88  RLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTP 147

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEV-----SFEYDCQDLITSVTLSP-------EEGKY 375
             D     SG  D   R   I D E      +  YD +D  T   + P         GK+
Sbjct: 148 DCDATILSSGSYDGLIR---IFDTESGHCLKTLTYD-KDWQTDDGVVPISQVKFSRNGKF 203

Query: 376 TIIGTFNGYVHIL-MTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAF 434
            ++ + +G V +    RG   V +F  A  +              S++++   +  L   
Sbjct: 204 LLVRSLDGVVKLWDFIRGCV-VRTFKDASGE--------------SRMKYSCGMDFLYPD 248

Query: 435 RSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
               D    +VV   D  I +++ + + + + LKG H  S
Sbjct: 249 SEAAD--VMVVVGGEDGNICVWNAQSKAVAQTLKGQHEDS 286

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNK 220
           ++  KF+ D K++ +GS DG +R+W+      ER+ + ++ E NK
Sbjct: 348 VFQVKFTMDSKYIVSGSDDGNVRLWR--AKAWERSHVKTTKEKNK 390

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCVEFH 327
           L ++K+HV  V+D+++S     I++ S DKT+++++    +S + +       V  V+F 
Sbjct: 295 LHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQVKF- 353

Query: 328 PTDDRFFISGCLDHKCRLW 346
             D ++ +SG  D   RLW
Sbjct: 354 TMDSKYIVSGSDDGNVRLW 372

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 101/267 (37%), Gaps = 60/267 (22%)

Query: 288 KNNFILSASMDKTVKLW--HPDRKNS----------------LKTFIHPDFVTCVEFHPT 329
           K++F+LS   DKT+KLW  + D  NS                LKTF        ++ H  
Sbjct: 128 KDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSIDHHRR 187

Query: 330 DDRFFISGCLDHKCRLWSI------------LDDE--VSFEYDCQDLITSVTLSPEEGKY 375
           +  F   G    + +LW +            +D+   V F  + +D++ S         Y
Sbjct: 188 NPNFVTGGA---QIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLY 244

Query: 376 TII--GTFNGYVHILMTRGLT--PVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGL 431
            +         V  + T  L   P+  F+ A    ++ NA+       S+         L
Sbjct: 245 DLRTNSPTQKVVQRMRTNALCWNPMEPFNFA-IANEDHNAYYYDMRNMSR--------AL 295

Query: 432 QAFRSQ----LDNSF-----RLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLS 482
             F+      +D  F      +V  S D  IRIF+L+     EV   +H+   QH  Q+ 
Sbjct: 296 HVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREV---YHTKRMQHVFQVK 352

Query: 483 IWHGQPIVVNSSDDHWVYGWRLKSSDR 509
                  +V+ SDD  V  WR K+ +R
Sbjct: 353 FTMDSKYIVSGSDDGNVRLWRAKAWER 379

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRK 309
           +  +  H Q ++ + W  N+ ++SASMD +VKLW   +K
Sbjct: 394 IHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKK 432

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           S+   + SA+ D T+++WH    NS+  F +    T V     ++   IS  +D   +LW
Sbjct: 369 SETKLLASAADDNTIRVWHGGNGNSIHCF-YGHTQTIVSLKWVNNDMLISASMDGSVKLW 427

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 75/184 (40%), Gaps = 29/184 (15%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVI-GSPVERAELDSSAES--NKEARAKSMRIKQQ 232
           I S K+++DG  + +   +    +W VI G+ ++  EL  +  S  N E  +    +   
Sbjct: 264 IVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFELKETGGSSINAENHSGDGSLGVD 323

Query: 233 VSSLNN-------PKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDIN 285
           V  +++       PK   F+   T               + H  P+         VL+ N
Sbjct: 324 VEWVDDDKFVIPGPKGAIFVYQITEKTPTGKL-------IGHHGPIS--------VLEFN 368

Query: 286 WSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCR 344
              N  +LSAS D T+++WH    NS   F  H   +    +   DD+  IS  +D   R
Sbjct: 369 -DTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASW-VGDDK-VISCSMDGSVR 425

Query: 345 LWSI 348
           LWS+
Sbjct: 426 LWSL 429

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 270 PLRLYKE-HVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVE 325
           PL++  + H + +L ++W K++   +LS+  D T  LW+P+    L  +    ++    +
Sbjct: 241 PLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILWNPEEAQKLTQYPTRGNWCFKTK 300

Query: 326 FHPTDDRFFISGCLDHKCRLWSI------LD-DEVSFE 356
           F P     F S   D+K ++ ++      LD DE +F+
Sbjct: 301 FAPEAPDLFASASFDNKIQVQTLQNLANKLDLDETAFK 338

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEF-HP 328
           L ++K+HV  V+D+++S   + I++ S DK+++++  +  +S + +         +  + 
Sbjct: 298 LNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYS 357

Query: 329 TDDRFFISGCLDHKCRLW 346
            D ++ ISG  D   RLW
Sbjct: 358 MDSKYIISGSDDGNVRLW 375

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNK 220
           ++  K+S D K++ +GS DG +R+W+      ER+ + ++ E NK
Sbjct: 351 VFQVKYSMDSKYIISGSDDGNVRLWR--SKAWERSNVKTTREKNK 393

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 92/262 (35%), Gaps = 51/262 (19%)

Query: 290 NFILSASMDKTVKLWHPD-----RKNS------------LKTFIHPDFVTCVEFHPTDDR 332
           NF+LS S DKTVKLW  +      KNS            ++TF        ++ H  +  
Sbjct: 134 NFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENST 193

Query: 333 FFISGCLDHKCRLWSI--LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMT 390
           F   G    K  LW +  L       +   D ITS+  +  E         +  + +   
Sbjct: 194 FATGGA---KIHLWDVNRLKPVSDLSWGA-DNITSLKFNQNETDILASTGSDNSIVLYDL 249

Query: 391 RGLTPVSSFHVADRQTQEQNA----------HVMVTETDSKIRHGPR--VTGLQAFRSQ- 437
           R  +P         QT   NA           V   E  +   +  R     L  F+   
Sbjct: 250 RTNSPTQKI----VQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHV 305

Query: 438 ---LDNSF-----RLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPI 489
              +D  F      +V  S D  IRI+        E+   +H+   QH  Q+        
Sbjct: 306 SAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREI---YHTKRMQHVFQVKYSMDSKY 362

Query: 490 VVNSSDDHWVYGWRLKSSDREN 511
           +++ SDD  V  WR K+ +R N
Sbjct: 363 IISGSDDGNVRLWRSKAWERSN 384

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 79/190 (41%), Gaps = 23/190 (12%)

Query: 288 KNNFILSASMDKTVKLWHPDRKN-SLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           + N+I++ + DK + ++  DR+   L+   H   V  +++    D   +SG  D   R+W
Sbjct: 376 EGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKY--AGDEILVSGSTDRTVRIW 433

Query: 347 SILDDEVSFEYDCQDLITSVTLSPEEG--KYTIIGTFNGYVHILMTRGLTPVSSFHVADR 404
           ++   + +  +             E G  KY + G+ +  +H+           + + D 
Sbjct: 434 NVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHV-----------WKLPDP 482

Query: 405 QTQEQNAHVMVTETDSKIRHGPRVTG-----LQAFRSQLDNSFRLVVTSNDSRIRIFDLE 459
            + + N + M     + I   P   G     + + R+   +   +V  S D  + ++D+ 
Sbjct: 483 NSPDYNPNAM--RQFNSIEDNPFFVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIA 540

Query: 460 QRKLLEVLKG 469
           + KLL VL G
Sbjct: 541 KMKLLYVLTG 550

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 269 TPLRLYKE-HVQDVLDINWSKN--NFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCV 324
            PL++  + H + VL ++W K   N +LS+  D T  LW+P   + L  F    ++V   
Sbjct: 241 VPLKVLSQGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPRGNWVFKS 300

Query: 325 EFHPTDDRFFISGCLDHKC 343
           +F P     F S   D K 
Sbjct: 301 KFAPEAPDLFASASFDSKI 319

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 6/117 (5%)

Query: 270 PLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFH 327
           PL     H   +  + ++K+N  +LSAS D T+K+W     ++   F  H   ++    H
Sbjct: 332 PLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSA--H 389

Query: 328 PTDDRFFISGCLDHKCRLWSILDDEVSFEYDC-QDLITSVTLSPEEGKYTIIGTFNG 383
             +D   IS   D   ++WSI  + +  E     + I   +LSP+    T +GT  G
Sbjct: 390 WINDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLSPDRNWLT-VGTLQG 445

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 271 LRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLW--HPDRKNSLKTF-IHPDFVTCVEF 326
           + + +EH QDV  + W  +  +L S+S D TV++W  + D    +     H   V   +F
Sbjct: 146 ISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF 205

Query: 327 HPTDDRF-FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGK---YTIIGTFN 382
             T+  F   SG  D   R+W  + D+   E D Q+ +    L P+  K   Y +   FN
Sbjct: 206 DKTEGVFRLCSGSDDSTVRVWKYMGDD---EDDQQEWVCEAIL-PDVHKRQVYNVAWGFN 261

Query: 383 GYVHILMTRGLTPV 396
           G +  +   G+  V
Sbjct: 262 GLIASVGADGVLAV 275

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI----HPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           I++    KT+ LW P   N+   +     H   VTCV F P  D F +S   DH  ++W 
Sbjct: 29  IVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSD-FMVSASEDHHVKIWK 87

Query: 348 ILD 350
             D
Sbjct: 88  FTD 90

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT 329
           L ++K+HV  V+D+++S   + +++ S DKT++++     +S + +         +   T
Sbjct: 291 LHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVKYT 350

Query: 330 -DDRFFISGCLDHKCRLW 346
            D ++ +SG  D   RLW
Sbjct: 351 MDSKYIVSGSDDGNVRLW 368

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNK 220
           I+  K++ D K++ +GS DG +R+W+      ER+   S+ E NK
Sbjct: 344 IFQVKYTMDSKYIVSGSDDGNVRLWR--AKAWERSNAKSTREKNK 386

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 444 LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWR 503
           +V  S D  IRI+ ++     E+   +H+   QH  Q+        +V+ SDD  V  WR
Sbjct: 313 VVTGSYDKTIRIYQVKHGHSREI---YHTKRMQHIFQVKYTMDSKYIVSGSDDGNVRLWR 369

Query: 504 LKSSDREN 511
            K+ +R N
Sbjct: 370 AKAWERSN 377

>Scas_700.27*
          Length = 433

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           I+S S D T++LW      S+K    H   V  + FHPT+  F +S C  +  R W + +
Sbjct: 263 IVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTE--FSMSSCSANDIRSWKLPE 320

Query: 351 DEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYV 385
             +   ++   L    TLS  +      G+ NG +
Sbjct: 321 GGLLTNFNSDGLGIINTLSINQDDVLFAGSDNGML 355

>Scas_720.45
          Length = 755

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 323 CVEFHPTDDRFFISGCLDHKCRLWSI 348
           CV F+P D   F SGCLD   ++WS+
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWSL 27

>Kwal_55.21450
          Length = 503

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 271 LRLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT 329
           LR Y+ H + V  I++ S+ +  LS S D+ +K+W  +       + +     C EF P+
Sbjct: 247 LRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPS 306

Query: 330 DDRFFISGCLDHKCRLWSI 348
           +   FI G  + + R + +
Sbjct: 307 NSNEFIVGLSNSEIRHYDL 325

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 44/109 (40%), Gaps = 25/109 (22%)

Query: 361 DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS 420
           D I +V  SP+ GKY + G  +  + +  T  L PV      DR+ +             
Sbjct: 256 DEILTVAASPD-GKYVVTGGRDKKLIVWSTESLAPVKVIPTKDRRGE------------- 301

Query: 421 KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
                  V GL AFR   D   +L     D +IR F + Q   LEVL G
Sbjct: 302 -------VLGL-AFRRNTD---QLYAACADYKIRTFAINQFSQLEVLYG 339

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 55/144 (38%), Gaps = 5/144 (3%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWH-PDRKNSLKTFIHPDFVTCVEFHPT 329
           + ++K H   V D+ +  N  IL+AS D T  LW  P  K   +   H   V  +   P 
Sbjct: 170 VSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPA 229

Query: 330 D----DRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYV 385
                D  F SG  D    LW          +   D   S      +G   I G+ +G  
Sbjct: 230 GTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIA 289

Query: 386 HILMTRGLTPVSSFHVADRQTQEQ 409
            +   R    +SS+ ++ +  Q+Q
Sbjct: 290 RLFDLRSDCELSSYSLSQKVQQQQ 313

>Scas_720.83d
          Length = 915

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 272 RLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKN----SLKTFIHPDFVTCVEF 326
           R++  H QD+L + WS ++ FI+S S D T ++W  D +     S+    H D+V    F
Sbjct: 140 RVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFF 199

Query: 327 HPTDDRFF 334
               ++ +
Sbjct: 200 SADQEKIY 207

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 271 LRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTFIHPDFV--TCVEFH 327
           L  ++EH   V  + ++K   +L S+S+D TV+ W   R  + +TF   + +   C+   
Sbjct: 378 LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVD 437

Query: 328 PTDDRFFISGCLDH-KCRLWSI 348
           P+ +    +G LD+    +WS+
Sbjct: 438 PSGE-VVCAGSLDNFDIHVWSV 458

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVI 203
           S  +S DG  + T ++DGKI++W V+
Sbjct: 348 SLTYSPDGSRVVTAAEDGKIKVWDVV 373

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVE 325
           TP+   K H   VL ++WS +   I + SMD T++LW  ++   +   +  H  ++T + 
Sbjct: 177 TPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLS 236

Query: 326 FHP 328
           + P
Sbjct: 237 WEP 239

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 83/236 (35%), Gaps = 60/236 (25%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-- 348
           + SAS D T+K+W   R+  L T   H   V+C+++         SG  D   R W +  
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKW--GGQGVLYSGSHDKTIRAWDMNL 308

Query: 349 -------------------LDDEVSFEYDCQDLITSVTLSPEEGK------YTIIGTFNG 383
                              L  + +      D  +    +PEE +      Y  I   NG
Sbjct: 309 GGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNG 368

Query: 384 YVHILMTRG--------LTPVSSFHVADRQTQEQ-----------NAHVMVTETDSKIR- 423
            V  LM             P+ S     R T  Q             H++    D+ I+ 
Sbjct: 369 EVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKL 428

Query: 424 -HGPRVTGLQAFRSQLDNSFR---------LVVTSNDSRIRIFDLEQRKLLEVLKG 469
            +G     +  FR  + + ++         LV  S D+ ++++D++ +KL   L G
Sbjct: 429 WNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPG 484

>Kwal_26.8776
          Length = 433

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 277 HVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFIHPDF--VTCVEFHPTDDRF 333
           HV  V  +  S+ +  + SAS DK VK W  +R  +++ + H  F  V  V+ HPT D  
Sbjct: 163 HVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDY-HGHFSGVNTVDVHPTLD-L 220

Query: 334 FISGCLDHKCRLWSI 348
             S   D   RLW I
Sbjct: 221 IASAGRDAVVRLWDI 235

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 67/189 (35%), Gaps = 32/189 (16%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLN 237
           + K+S  G +M +G  DG I+IW+   + V+  ELD         R  +  I+    S N
Sbjct: 129 TMKYSHAGDWMISGDADGTIKIWQPNFNMVK--ELD---------RIHTEGIRDVAFSNN 177

Query: 238 NPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKN-NFILSAS 296
           + K     D                         R+   H  DV   +W      I+S S
Sbjct: 178 DSKFVTCSDDNILKIWNFSNGQQE----------RVLSGHHWDVRSCDWHPELGLIVSGS 227

Query: 297 MDKTVKLWHPDRKNSLKTFIH-PDFVTCVEFHPTDDRFFISGCLDHKCRLWSI------- 348
            D  VKLW P     + T +     V    F PT      +   D  CR++ +       
Sbjct: 228 KDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNEL 287

Query: 349 --LDDEVSF 355
             + DEV F
Sbjct: 288 MCVRDEVDF 296

>Scas_719.30
          Length = 940

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 433 AFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVN 492
           +FR+   + F     S D  +  +DL++R  + VLK  H        +++  +GQPI+V 
Sbjct: 256 SFRTDGSSHFCAGTASGD--LVFYDLDRRSRIHVLKNIHREQYGGVTKVTFLNGQPIIVT 313

Query: 493 SSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSG 527
           S  D+ +  +    S  ++D +   + P+ L   G
Sbjct: 314 SGGDNSLKEYVFDPSLSQDDSETVVQPPRFLRSRG 348

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 18/152 (11%)

Query: 267 HPTPLRLYK--EHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVT 322
           H T  RL++   H   VL + + SK N + SASMD+++K+W       LKT   H + V 
Sbjct: 84  HITYGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVV 143

Query: 323 CVEFHPTDDRFFISGCLDHKCRLWSILDDEV--SFEYDCQDL--------ITSVTLSPEE 372
            ++    D     SG  D   R++         +  YD +D         I+ V  S   
Sbjct: 144 SIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYD-KDWKSENGVVPISQVKFS-VN 201

Query: 373 GKYTIIGTFNGYVHIL-MTRGLTPVSSFHVAD 403
           GKY ++ + +G + I    RG + V +F + D
Sbjct: 202 GKYLLVKSLDGVLKIWDFIRG-SVVRTFKICD 232

>Kwal_26.7570
          Length = 218

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 267 HPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCV 324
           +  P+R ++ H   V D   + +  + LSAS DKTV+LW       ++ F+ H   V  V
Sbjct: 54  YGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSV 113

Query: 325 EFHPTDDRF---FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTL----SPEEGKYTI 377
               T DR     +S   D   ++W+ L + +       D ++ V +    SPE+   T+
Sbjct: 114 ----TIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNESPEDETVTV 169

Query: 378 IGT-FNGYVHILMTRGLTPVSSF 399
           I    +  V +  T  + P + F
Sbjct: 170 ISAGMDKVVKVCSTNTMKPNTRF 192

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 269 TPLR-LYKEHVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCV 324
           TPL+ L + H + +L ++W   +   +LS+  D TV LW+P+    L  F    ++    
Sbjct: 247 TPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPARGNWCFKT 306

Query: 325 EFHPTDDRFFISGCLDHKCRLWSI 348
           +F P     F     D+K  + ++
Sbjct: 307 KFAPEAPDLFACASFDNKIEVQTL 330

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 107/245 (43%), Gaps = 37/245 (15%)

Query: 283 DINWSKNNFILSASMDK-TVKLWHPDRK----NSLKTFI-HPDFVTCVEFHPTDDRFFIS 336
           D++WS NN I++ ++D  +++L+  +      NS+  F  H   V  V+F+   D    S
Sbjct: 67  DLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLAS 126

Query: 337 GCLDHKCRLWSILDDEVSFEYDCQDLITSVT-LSPEEGKYTI-----IGTFNGYVHILMT 390
           G  + +  +W +          C +  ++ T L+P +   ++     +       H+  +
Sbjct: 127 GGNNGEIFIWDM--------NKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFAS 178

Query: 391 RGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTS-- 448
            G +  +S  + D + +++  H+  T  +S I+       L        NS R+   +  
Sbjct: 179 AGSSNFAS--IWDLKAKKEVIHLSYTSPNSGIKQ-----QLSVVEWHPKNSTRVATATGS 231

Query: 449 -NDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSI-WHGQP--IVVNSSDDHWVYGWRL 504
            ND  I I+DL  R     L+  + G    K  LS+ W  Q   ++++S  D+ V  W  
Sbjct: 232 DNDPSILIWDL--RNANTPLQTLNQG--HQKGILSLDWCHQDEHLLLSSGRDNTVLLWNP 287

Query: 505 KSSDR 509
           +S+++
Sbjct: 288 ESAEQ 292

>Scas_695.15
          Length = 327

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 96/238 (40%), Gaps = 34/238 (14%)

Query: 268 PTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEF 326
           P  +  ++ H  +V  +++ ++N +++++S D T+K+W     +  + + H   V  V  
Sbjct: 85  PNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 144

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSV-TLS-PEEGKYTIIGTFNGY 384
           HP      IS   D   ++W + +++ + +    D  TS+ +LS   +G   +     G 
Sbjct: 145 HPNQGE-LISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGD 203

Query: 385 VHILM------TRGLTPVSSF-----------------HVADRQTQEQNAHVMVTETDSK 421
            ++           L P++ F                 H+A            V ET+  
Sbjct: 204 CYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDD 263

Query: 422 IRHGPRVTGLQAFRSQLDNSFR-----LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGS 474
                 + G Q  R   D +F      LV  S+D  +R++DL  R+++    G H G+
Sbjct: 264 FNLETTLDGHQ--RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 319

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVIGSPVER 209
           S  F +D K+M T S+DG I++W V    V R
Sbjct: 100 SVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPR 131

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 277 HVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFF 334
           H+  V DI  SK + ++ SAS DK VK W  ++   ++ +  H   V  V+ HPT +   
Sbjct: 171 HIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIA 230

Query: 335 ISGCLDHKCRLWSI 348
            +G  D   RLW I
Sbjct: 231 TAG-RDSVVRLWDI 243

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 70/185 (37%), Gaps = 31/185 (16%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           ++S S D TV+LW      +LK    H   V  +  HP +  F IS       R W + +
Sbjct: 271 VVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGE--FSISSACTDDIRSWKLPE 328

Query: 351 DEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQN 410
            ++   +  +      TLS  +      G+ NG            V SF+  D +T  + 
Sbjct: 329 GQLLTNFQSEKTGIINTLSINQDDVLFAGSDNG------------VLSFY--DYKTGHKY 374

Query: 411 AHVMVTETDSKIRHGPRVTGLQAFRSQLDNSF-----RLVVTSNDSRIRIFDLEQRKLLE 465
             +  TE             L++ R  L ++F     RL+   +D  I+I+  +Q    E
Sbjct: 375 QQLDTTEIPG---------SLESERGILTSTFDQTGLRLITGESDKSIKIWKQDQDATPE 425

Query: 466 VLKGF 470
              G 
Sbjct: 426 TYTGL 430

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 21/87 (24%)

Query: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGS------------SQHKAQLSIW 484
           LD S R +V+ SND  IRI+DL++RK L  L   H+GS               K Q + W
Sbjct: 47  LDISRRYLVSGSNDEHIRIYDLQKRKELGTLLN-HNGSITSLRFSRATTDKDGKQQGNKW 105

Query: 485 HGQPIVVNSSDDHWVYGWRLKSSDREN 511
                ++++S+DH +  WR+K  D EN
Sbjct: 106 -----LLSASEDHTIIIWRVK--DWEN 125

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 289 NNFILSASMDKTVKLWH-PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           N ++LSAS D T+ +W   D +N  K   H   +  ++ HP++    +S   DH  RLW+
Sbjct: 103 NKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSE--DHSIRLWN 160

Query: 348 IL 349
           ++
Sbjct: 161 LM 162

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 12/70 (17%)

Query: 288 KNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCV---------EFHPTDDR-FFI 335
           + + + S S D+T+K W  +  N +KT+  IH +F+ C+         +F P+  R   +
Sbjct: 396 RGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQREILV 455

Query: 336 SGCLDHKCRL 345
           SG +D+K ++
Sbjct: 456 SGDMDNKVKI 465

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 6/63 (9%)

Query: 286 WSKNNFIL--SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHK 342
           W K+N +L  S+S D TVK+W  +    L++F  H ++V  ++     D + +SG LD  
Sbjct: 230 WQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVL---DEYILSGSLDST 286

Query: 343 CRL 345
            RL
Sbjct: 287 LRL 289

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 15/87 (17%)

Query: 280 DVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEF----HPTD----- 330
           +V++ NW +  F+L+AS D T+K W     N  K    P  V   E+    H  D     
Sbjct: 438 NVMNRNWPE--FLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAIS 495

Query: 331 ----DRFFISGCLDHKCRLWSILDDEV 353
               D  F +   D  C++W++   EV
Sbjct: 496 MSPNDSIFATASYDKTCKIWNVDTGEV 522

>Scas_652.16
          Length = 345

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 52/250 (20%), Positives = 96/250 (38%), Gaps = 49/250 (19%)

Query: 78  LKYSNNGNATDSFMRLKEHLQ----RGNTLNSNLRVNEFYPFNSIDTEQF-----ENYLR 128
           LK +  GN  D+ +R+ E L+    R  TL S ++V    P N + ++         +  
Sbjct: 126 LKLACIGN--DATLRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSP 183

Query: 129 EPKYIKMLKRRKNLKQFR--RLFLAQELMAYEGXXXXXXXXXXXXXXXAIWSTKFSRDGK 186
           E   +  L +    ++ +  +L++  +L  ++G                 W+    R   
Sbjct: 184 EKLVVSTLDQASIYQRGKDGKLYIVAKLNGHKGLIRDIS-----------WAPSIGRWYH 232

Query: 187 FMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQFLD 246
            +ATG KDGK+RI++++    + +  D+  +S  +       I +        KEK  L 
Sbjct: 233 LIATGCKDGKLRIFRLVEKLSDNSSKDAINDSYDDEDVDMEDIAEN-------KEKSLLG 285

Query: 247 SATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWH 305
           S+                      L  + +H  ++  ++W+    IL SA  D  V+LW 
Sbjct: 286 SSVSVEL-----------------LSEHDDHNAEIWSVSWNLTGTILSSAGDDGKVRLWK 328

Query: 306 PDRKNSLKTF 315
               N  K  
Sbjct: 329 STYSNEFKCM 338

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 3/37 (8%)

Query: 274 YKEHVQDVLDINWSKNNF---ILSASMDKTVKLWHPD 307
           +K H   ++ ++W+   +   I+SAS DKTVKLW  D
Sbjct: 54  WKAHDSSIVSVDWASPEYGRIIVSASYDKTVKLWEED 90

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 311 SLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD-EVSFEY-DCQDLITSVTL 368
           S+    HP  VT  +FH  D++   +   D   RLW I +  E   E     D + +++ 
Sbjct: 119 SINASTHPTHVT--KFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSF 176

Query: 369 SPEEGKYTIIGTFNGYVHILMTR--GLTPVSSFH 400
            P        G+++G + +  TR  G TP+ S +
Sbjct: 177 IPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLN 210

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 95/242 (39%), Gaps = 49/242 (20%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD---------------EVSFEYDCQD 361
           HP+  T ++F P      +SG  DH  ++W    D                + F  DCQ 
Sbjct: 161 HPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQS 220

Query: 362 LITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAH-VMVTETDS 420
            ++S      +    I  T  G V   +    TP      AD +++  N H  +V  ++S
Sbjct: 221 FLSSSF----DRSVKIWDTETGKVKTRLHLNSTP------ADVESRPTNPHEFIVGLSNS 270

Query: 421 KIRH-GPRVTGLQAFRSQLDNSF-------------RLVVTSNDSRIRIFDLEQRKLLEV 466
           KI H   RV+  Q      D+               + + +S D  +RI++ +    ++ 
Sbjct: 271 KILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQ 330

Query: 467 LKGFHSGSSQHKAQ-LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLAR 525
           +    S ++QH    L++   Q      S D+ +Y + LK   + +    PK+  KG + 
Sbjct: 331 I----SDTAQHSMPFLNVHPSQNYFCAQSMDNRIYSFSLKPKYKRH----PKKIFKGHSS 382

Query: 526 SG 527
           +G
Sbjct: 383 AG 384

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 25/111 (22%)

Query: 361 DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS 420
           D I +V  SP+ GKY + G  +  + +  T  L+PV      DR+ +             
Sbjct: 237 DEILTVAASPD-GKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGE------------- 282

Query: 421 KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFH 471
                  V  L AFR    NS +L  +  D +IR + + Q   LE+L G H
Sbjct: 283 -------VLSL-AFRK---NSDQLYASCADFKIRTYSINQFSQLEILYGHH 322

>Scas_512.3
          Length = 534

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 70/179 (39%), Gaps = 29/179 (16%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVS 234
           AI   KF+  G  +A+   DG+I +WK               E N E  A         S
Sbjct: 69  AINVVKFNSPGTILASAGDDGQILLWK----------QQDVNEQNGETAAPVD------S 112

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSK-NNFIL 293
           S+  P    F D                AP            +  ++ D++WS  + +++
Sbjct: 113 SVPKPFGSTFEDDEENNKESWFVWKRLRAP----------GSNSSEIYDLDWSPCDRYVV 162

Query: 294 SASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDD 351
           S SMD +++++  +    L T+  H  +V  V + P ++ F +S   D    ++ I+ D
Sbjct: 163 SGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNE-FILSQSADRSVNIYQIIWD 220

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 277 HVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFF 334
           HV  V D+  S ++ ++ S S DKTVK W  ++   ++ +  H   V  V  HPT D   
Sbjct: 181 HVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIA 240

Query: 335 ISGCLDHKCRLWSI 348
            +G  D   +LW +
Sbjct: 241 TAG-RDSVIKLWDM 253

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%)

Query: 304 WHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           WH   K S     H  +V CV   P D+ +FI+G  D   ++W +
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDL 169

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 302 KLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           +L+ P  K       H DF+TC++F         +G LDH  ++W +
Sbjct: 382 QLYEPGTKIGSIMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDL 428

>Kwal_23.6324
          Length = 514

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 269 TPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCVE 325
           TP+   K H   VL + W  +   I + SMD T++LW  ++  S    +  H  ++T + 
Sbjct: 176 TPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLT 235

Query: 326 FHP 328
           + P
Sbjct: 236 WEP 238

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 7/140 (5%)

Query: 218 SNKEARAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEH 277
           S +EARAK+++  ++++  N   E+  + ++               P+   T  +    H
Sbjct: 347 SPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNH 406

Query: 278 VQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFIS 336
           V    D       +I+SAS D ++KLW       + TF  H   V  V +  +D R  +S
Sbjct: 407 VAFSPD-----GRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWS-SDCRLLVS 460

Query: 337 GCLDHKCRLWSILDDEVSFE 356
              D   ++W +   ++S +
Sbjct: 461 CSKDTTLKVWDVRTKKLSVD 480

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 20/146 (13%)

Query: 271 LRLYKEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHP 328
           L  +  H   V+ + ++ K N + ++SMD+++K+W     + +KT   H + V  V+   
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPM 148

Query: 329 TDDRFFISGCLDHKCRLWSILDDEV-----SFEYDCQDL--------ITSVTLSPEEGKY 375
            D     SG  D   R   I D E      +  YD +D         I+ V  S E  +Y
Sbjct: 149 NDSSILSSGSYDGLIR---IFDAETGHCLKTLTYD-KDWKRENGVVPISQVKFS-ENARY 203

Query: 376 TIIGTFNGYVHILMTRGLTPVSSFHV 401
            ++ + +G V I    G   V +F V
Sbjct: 204 LLVKSLDGVVKIWDCIGGCVVRTFQV 229

>AER035W [2540] [Homologous to ScYOL087C - SH]
           complement(699524..702544) [3021 bp, 1006 aa]
          Length = 1006

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 51/134 (38%), Gaps = 36/134 (26%)

Query: 333 FFISGCLDHKCRLWSILDDE--VSFEYD------CQDLITSVTLSPEEGKYTIIGTFNGY 384
            F +G LD K + W +   E  V FEYD         +     LSP+E    +IG  NG 
Sbjct: 147 LFATGGLDKKVKFWELQGREARVLFEYDNAQPQETGSVYALCALSPQE---VVIGDNNGD 203

Query: 385 VHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRL 444
           + I+                    +  HV+     S +R              LD   RL
Sbjct: 204 LKIISA---------------VTGELVHVVSGAHGSNVR----------LAQLLDQGRRL 238

Query: 445 VVTSNDSRIRIFDL 458
           + TS+D  ++++D+
Sbjct: 239 ITTSSDGAVKLWDV 252

>Kwal_55.22067
          Length = 451

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 44/111 (39%), Gaps = 5/111 (4%)

Query: 277 HVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFIHPDF-VTCVEFHPTDDRFF 334
           H  DV   +W      I S S D  VKLW P     + T +     +   +F PT     
Sbjct: 208 HHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNML 267

Query: 335 ISGCLDHKCRLWSILDD--EVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
                D  CR++ I  +  E++   D  D + S+T  P       +G ++G
Sbjct: 268 AVISKDKSCRIFDIRQNMKELAVYRDESDYM-SLTWHPINESMFTVGCYDG 317

>Kwal_34.15818
          Length = 349

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 86/221 (38%), Gaps = 38/221 (17%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV----------IGSPVERAELDSSAESNKEARAK 225
           IWS    +  ++  TGS D  I++WKV            +PV R +   S +        
Sbjct: 55  IWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNVFTWKTKTPVRRVQFSPSGDKILAVLDG 114

Query: 226 SMRIKQQVSSLN---NPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVL 282
            M     V+      +P+ K  +D +                   PT   L +E  +   
Sbjct: 115 VMGYPGSVTVYTVRRDPETKDIVDISE-----------------EPTFNILTREGFEIAA 157

Query: 283 DINWSKNN-FILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFFISGCLD 340
              WS N+ +I++   D  V  +       + +  +H   V+ ++F P D  +FI+   D
Sbjct: 158 VAAWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSP-DGTYFITSSRD 216

Query: 341 HKCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIG 379
              +L      EV  ++E DC   + S  ++P + ++ I+G
Sbjct: 217 SAAKLVDTETLEVLKTYETDCP--LNSACITPLK-QFVILG 254

>Scas_658.1
          Length = 442

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 69/171 (40%), Gaps = 28/171 (16%)

Query: 290 NFILSASMDKTVKLW-HPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           N +LS   D  VK+W    ++N L+ +  H   +  ++F+  D   FIS   DH  ++W 
Sbjct: 163 NLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFN-DDGTNFISSSFDHTIKIWD 221

Query: 348 ILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQ 407
               +V  +   +     V   P      I+G  N  ++   TR                
Sbjct: 222 TEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDTR---------------- 265

Query: 408 EQNAHVMVTETDSKIR-HGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFD 457
                  ++E D +++ +   ++ + A +   D S + + +S D  +RI+D
Sbjct: 266 -------ISENDGRVQVYDHHMSSILALKFFPDGS-KFISSSEDKTVRIWD 308

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 54/134 (40%), Gaps = 6/134 (4%)

Query: 272 RLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPT 329
           R+   H  DV   +W      I+S S D  +KLW P     + T +     +   +F PT
Sbjct: 201 RVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPT 260

Query: 330 DDRFFISGCLDHKCRLWSILDD--EVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYV-H 386
                     D  C+++ I  +  E+    D  D + S+T  P       +G ++G + H
Sbjct: 261 KGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYM-SLTWHPINESIFTVGCYDGSLKH 319

Query: 387 ILMTRGLTPVSSFH 400
             + +     +SFH
Sbjct: 320 FDLLQDTGSSNSFH 333

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKN--SLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCR 344
           +K N +   + DK+ K++   R+N   LK+F        + +HP ++  F  GC D   +
Sbjct: 260 TKGNLLAVVAKDKSCKIFD-IRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLK 318

Query: 345 LWSILDDEVS------FEYDCQDLITSVTLSP 370
            + +L D  S        Y     ITS++ +P
Sbjct: 319 HFDLLQDTGSSNSFHDIPYAHDKCITSLSYNP 350

>Scas_465.4
          Length = 1002

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           +I S S D+++KLW+      L T + H   +  ++F   D +  IS   D+ CR+W IL
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQL-ISVSEDNTCRVWDIL 251

Query: 350 DDE 352
            DE
Sbjct: 252 QDE 254

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 272 RLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPD--RKNSLKTFI--HPDFVTCVEF 326
           R++  H QD+  + WS+++ FIL+ S D + K+W  D   KN   T    H D+V    F
Sbjct: 140 RVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFF 199

Query: 327 HPTDDRFF 334
               ++ +
Sbjct: 200 SHDQEKIY 207

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 271 LRLYKEHVQDVLDINWSK-NNFILSASMDKTVKLWHPDRKNSLKTFIHPDFV--TCVEFH 327
           L  ++EH   V  + ++K    + S+S+D TV+ W   R  + +TF   + +   C+   
Sbjct: 380 LATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD 439

Query: 328 PTDDRFFISGCLDH-KCRLWSI 348
           P+ +    +G LD+    +WS+
Sbjct: 440 PSGE-VVCAGSLDNFDIHVWSV 460

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 275 KEHVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDR 332
           K H   V D+  S ++ ++ S S DKTVK W  ++  +++ +  H   V  V+ HPT D 
Sbjct: 155 KAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDV 214

Query: 333 FFISGCLDHKCRLWSI 348
              +G  D   ++W I
Sbjct: 215 VVTAG-RDSVVKVWDI 229

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFIHPD-FVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           ++S+S+D +++LW      S+K   H    V  +  HP++   F S C +   R W +  
Sbjct: 257 VISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFS-FASACTN-DIRSWLLPK 314

Query: 351 DEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
            E+   +  QDL    T+S  +      G+ NG
Sbjct: 315 GELLTNFVSQDLDVINTVSINQDDVLFAGSDNG 347

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 66/171 (38%), Gaps = 30/171 (17%)

Query: 184 DGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQ 243
           D ++ ATGS D  I+IW +           +S +     +A  M ++    S  +P    
Sbjct: 127 DNEWFATGSNDKTIKIWNL-----------ASGKLKVTLKAHDMTVRDLAISNRHPYMFS 175

Query: 244 FLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDV--LDINWSKNNFILSASMDKTV 301
             +  T                   T +R Y  H+  V  +DI+    + +++A  D  V
Sbjct: 176 VSEDKTVKCWDLEKN----------TAIRNYHGHLSGVHTVDIH-PTVDVVVTAGRDSVV 224

Query: 302 KLWHPDRKNSLKTFIHPDF---VTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           K+W  D +  L     P     +T V   P D +  IS  +D   RLW ++
Sbjct: 225 KVW--DIRTRLPVMTLPGHKGPITKVRCLPVDPQ-VISSSVDASIRLWDLV 272

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 67/171 (39%), Gaps = 16/171 (9%)

Query: 187 FMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEKQFLD 246
            +A GS D  + IW        R + D S E+   A  +    + +V S+    +  +L 
Sbjct: 70  VLAAGSFDTTVSIWG-------RDDDDYSGETELLAVIEGH--ENEVKSVAWSHDGAYLA 120

Query: 247 SATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWH 305
           + +             +  F    +   +EH QDV  I W  +  +L S+S D TV++W 
Sbjct: 121 TCSRDKSVWIWEADELSEEFECNSV--LQEHSQDVKHIVWHASRLLLASSSYDDTVRIWA 178

Query: 306 P---DRKNSLKTFIHPDFVTCVEFHPTDDRF-FISGCLDHKCRLWSILDDE 352
               D + +     H   V C +F   +      SG  D   R+W  L D+
Sbjct: 179 EQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDD 229

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 271 LRLYKEHVQDVLDINWSKNNF-ILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPT 329
           LR Y  H + +   ++S +N    S+S DKTVK+W  +  + +          C+ FHP 
Sbjct: 211 LRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQ 270

Query: 330 DDRFFISGCLDHKCR 344
           +    + G  D K R
Sbjct: 271 NKEQLLVGFSDSKIR 285

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTD-DRFFISGCLDHKCRLWSIL 349
            LS+S+D  +K+W       L+TFI H   V   +F   D  R F+S   D   +LW   
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVN--DFAMVDRGRNFVSASSDGSLKLWECS 230

Query: 350 DDEVSFEYDCQDLITSVTLSPEEG 373
                F  +  D I  ++L+  +G
Sbjct: 231 TSACVFTLNSNDGINCISLANYQG 254

>Kwal_14.906
          Length = 328

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 271 LRLYKEHVQDVLDINWSK-NNFILSASMDKTVKLWHPDRKNSLKTFIHPDFV-TCVEFHP 328
           LR +  H   V DI  S  N+  LSAS D++V+LW  D + S    I P  V  C+ + P
Sbjct: 105 LRYFTGHGALVSDIEMSPLNDTFLSASYDESVRLW--DMRASKAQAIVPSLVPACIAYDP 162

Query: 329 TDDRF 333
           +   F
Sbjct: 163 SGLVF 167

>Scas_685.11
          Length = 384

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 287 SKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
           S N ++LSAS D  + +W      +  T   H   +  V+ HP+ +R  IS   DH  RL
Sbjct: 102 SNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPS-NRVAISVSEDHSIRL 160

Query: 346 WSIL 349
           W+++
Sbjct: 161 WNLM 164

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 12/83 (14%)

Query: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGS------SQHKAQLSIWHG--QP 488
           LD S R +V+ SND  IRI+DL++RK L  L   H GS      S+ K +     G    
Sbjct: 47  LDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLA-HQGSITNLKFSKSKTENGDGEGSNNK 105

Query: 489 IVVNSSDDHWVYGWRLKSSDREN 511
            ++++S+D+ +  WR+K  D EN
Sbjct: 106 WLLSASEDNKIIIWRVK--DWEN 126

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 93/224 (41%), Gaps = 47/224 (20%)

Query: 273 LYKEHVQDV--LDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPT 329
           L K H +D+  LD +        + S+D +VK+W   +K  + T   H   ++C++    
Sbjct: 392 LPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQI--- 448

Query: 330 DDRF--FISGCLDHKCRLWSI---LDDEVS----------FEYDCQ-DLITSVTLSPEEG 373
            D++   I+G  D   +LW I   + DE S          + +D   D IT+++    +G
Sbjct: 449 -DQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISF---DG 504

Query: 374 KYTIIGTFNGYVH--------ILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHG 425
              + G+ +  V            T  ++  +    + R    +N+ ++  E        
Sbjct: 505 DNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEP------- 557

Query: 426 PRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
           P +  LQ F +       L   + D  +R++DL   K++ +L+G
Sbjct: 558 PAIGALQCFDAA------LATGTKDGIVRLWDLRSGKVVRMLEG 595

>Kwal_27.10785
          Length = 367

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 56/151 (37%), Gaps = 26/151 (17%)

Query: 319 DFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSF--EYDCQDLITSVTLSPEEGKYT 376
           D ++ + F P  D  F     D K R+W +   +     EY  Q  + +   S +  K  
Sbjct: 36  DSISDIAFSPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTDGTKIA 95

Query: 377 IIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRS 436
             G  N             V  F V+  Q+Q+  AH    ++   ++ GP          
Sbjct: 96  SGGCDNA------------VMVFDVSSGQSQQVGAHDAAVKSLRFVQCGP---------- 133

Query: 437 QLDNSFRLVVTSNDSRIRIFDLEQRKLLEVL 467
              N+  LV  S D  I+ +DL Q + +  L
Sbjct: 134 --SNTECLVTGSWDKTIKYWDLRQPQPVSTL 162

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 287 SKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCR 344
           SKN+ ++LSAS D  + +W      ++ T   H   V  V+ HPT+ R  IS   DH  R
Sbjct: 170 SKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTN-RIAISVSDDHSIR 228

Query: 345 LWSIL 349
           LW+++
Sbjct: 229 LWNLM 233

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 444 LVVTSNDSRIRIFDLEQRKLL----------EVLKGFHSGSSQHKAQLSIW-HGQPIVVN 492
           LV  SND  IRI+DL++RK L            L+  H  SS   A +S        +++
Sbjct: 119 LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLS 178

Query: 493 SSDDHWVYGWRLK 505
           +S+DH +  WR+K
Sbjct: 179 ASEDHKIMVWRVK 191

>Scas_720.95
          Length = 515

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 73/196 (37%), Gaps = 29/196 (14%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYT 376
           H   + C  F P      ++G  D+  R+W           DC       T +P   K T
Sbjct: 142 HGSTILCSAFAPNTSSRMVTGAGDNTARIW-----------DCD------TQTP---KAT 181

Query: 377 IIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRS 436
           + G FN  + +        +++  + D   +  ++       D+   H   +T L     
Sbjct: 182 LTGHFNWVLCVSYCPNGEVIATGSM-DNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPI 240

Query: 437 QL---DNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNS 493
            L     S RL   S D  IRI+D+ +R  L  + G  +  S  K     W GQ I+ + 
Sbjct: 241 HLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIK-----WSGQGIIYSG 295

Query: 494 SDDHWVYGWRLKSSDR 509
           S D  V  W + +  +
Sbjct: 296 SHDKTVRVWDMNADGK 311

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 46/125 (36%), Gaps = 15/125 (12%)

Query: 181 FSRDGKFMATGSKDGKIRIWKVI-GSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNP 239
           +  +G+ +ATGS D  IR+W    G P+         ++ +        +  +   L  P
Sbjct: 194 YCPNGEVIATGSMDNTIRLWDSKDGKPL--------GDALRGHLKWITSLAWEPIHLVKP 245

Query: 240 KEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDK 299
            E   L SA+               ++          H   V  I WS    I S S DK
Sbjct: 246 GESPRLASASKDGTIRIWDITRRVCLY------TMSGHTNSVSCIKWSGQGIIYSGSHDK 299

Query: 300 TVKLW 304
           TV++W
Sbjct: 300 TVRVW 304

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           + SAS D T+++W   R+  L T   H + V+C+++  +      SG  D   R+W +
Sbjct: 251 LASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKW--SGQGIIYSGSHDKTVRVWDM 306

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 79/198 (39%), Gaps = 33/198 (16%)

Query: 317 HPDFVTCVEFHPTDD------RFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSP 370
           HP +  C  F P  +      R F SG  D+K R+W + + E   + +  D ++S+T   
Sbjct: 15  HPIYSLC--FQPLSETNQNTRRLFTSGG-DNKIRVWQLNESENDGKIETIDFLSSLT--- 68

Query: 371 EEGKYTIIGTFNGYVHILMTRG-----------LTPVSSFHVADRQTQEQNAHVMVTETD 419
           +  +   +  FN     L T G            T V  F V D + Q+      V +  
Sbjct: 69  QHEQAVNVCRFNKQGDTLATAGDDGLLLLWKKNETMVKEFGVDDDEFQDFKESWAVWK-- 126

Query: 420 SKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKA 479
            ++R G          S       + + S D+ +R+F+++Q K++      H     H  
Sbjct: 127 -RLRSGSASNAEIYDISWNPQGTCIAIASLDNTVRVFNVDQGKVVG-----HITEHNHYV 180

Query: 480 QLSIW--HGQPIVVNSSD 495
           Q  +W   G+ IV  S+D
Sbjct: 181 QGIVWDPQGEFIVSQSAD 198

>Kwal_14.884
          Length = 395

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 20/91 (21%)

Query: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGS---------------SQHKAQL 481
           LD S R +V+ SND  IRI+DL++RK L  L   H GS               ++    L
Sbjct: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLS-HQGSITALKFSKGTKIEDKNEDDTGL 105

Query: 482 SIWHGQ-PIVVNSSDDHWVYGWRLKSSDREN 511
           +   G    ++++SDDH +  WR+K  D EN
Sbjct: 106 TTGRGNSKWLISASDDHNLVIWRVK--DWEN 134

>YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protein
           containing three WD domains (WD-40 repeats), which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.3370p
           [1170 bp, 389 aa]
          Length = 389

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 312 LKTFI--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352
           L++ I  H D VTC++FHP+D    +SG  D    ++ +  DE
Sbjct: 140 LRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

>Kwal_56.24163
          Length = 729

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILD 350
           ILS S D T+K+W+ +     KT  +  +   C+  HPT  R +I+   D+   + S+ +
Sbjct: 100 ILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIATHPTGKRNYIASGFDNGFTVLSLGN 159

Query: 351 DEVSFEYD 358
           DE     D
Sbjct: 160 DEPKLSLD 167

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 324 VEFHPTDDRFFISGCLDHKCRLWSI 348
           V F+P D   F S CLDH  ++WS+
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSL 27

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           +++++S D+TVK+W    K+ + T   H   V+   FHP+     +SG  D   ++W
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPS-LPIILSGSEDGTLKVW 112

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 64/152 (42%), Gaps = 8/152 (5%)

Query: 220 KEARAKSMRIKQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQ 279
           KEAR K+++  ++V+  N   E+  + ++               P+   T  +    HV 
Sbjct: 352 KEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVA 411

Query: 280 DVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGC 338
              D       +I+SAS D ++KLW       L TF  H   V  V +  +D R  +S  
Sbjct: 412 FSPD-----GKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAW-SSDCRLLVSCS 465

Query: 339 LDHKCRLWSILDDEVSFEYDC-QDLITSVTLS 369
            D   ++W +   ++S +    QD + +V  S
Sbjct: 466 KDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWS 497

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 75/207 (36%), Gaps = 29/207 (14%)

Query: 306 PDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITS 365
           P  ++S     H   + C  F P      ++G  D+  R+W           DC      
Sbjct: 133 PITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIW-----------DCDTQTPK 181

Query: 366 VTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHG 425
           VTL+     + +  +++    ++ T  +         D   +  +A       D+   H 
Sbjct: 182 VTLNGHR-NWVLCVSWSADGEVIATGSM---------DNTIRLWDAESGKPLGDALRGHS 231

Query: 426 PRVTGLQAFRSQL---DNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLS 482
             +T L      L    +  RL   S D  IRI+D  +R  L  L G  +  S  K    
Sbjct: 232 KWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVK---- 287

Query: 483 IWHGQPIVVNSSDDHWVYGWRLKSSDR 509
            W G+ I+ + S D  V  W +K + +
Sbjct: 288 -WGGEGILYSGSHDKTVRAWDMKQNGK 313

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 292 ILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           + SAS D T+++W   R+  L T   H + V+CV++    +    SG  D   R W +
Sbjct: 253 LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKW--GGEGILYSGSHDKTVRAWDM 308

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 17/138 (12%)

Query: 293 LSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI--- 348
           L+AS DKT+KLW  D    L T+ +H D V  +   P D   F S   D   ++ ++   
Sbjct: 161 LTASADKTIKLW--DGARDLATYNVHTDVVRHLALAP-DGHHFASCSNDGSVKVHTLDGK 217

Query: 349 ----LDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADR 404
                D   SF Y  + L     +S  E K   +   +G+V  ++    T + S  V   
Sbjct: 218 TVRTFDGHESFVYCVKYLPDGGLVSCGEDKTVRVWDMSGHVRQVIRLCATSLWSLDVL-- 275

Query: 405 QTQEQNAHVMVTETDSKI 422
                N  ++V  +D KI
Sbjct: 276 ----PNGDIVVGGSDGKI 289

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 81/189 (42%), Gaps = 21/189 (11%)

Query: 288 KNNFILSASMDKTVKLWHPDRKNSLKTFI-----HPDFVTCVEFHPTDDRFFISGCLDHK 342
           +NN+I++ + DK + ++  D +N L  F+     H   V  ++F   D +  +SG  D  
Sbjct: 269 ENNYIITGADDKKINVY--DAENDL--FLLELNGHEGGVWALKF--VDGKILVSGSTDRS 322

Query: 343 CRLWSILDDEVSFEYDCQDLITSVTLSPEEG--KYTIIGTFNGYVHILMTRGLTPVSSFH 400
            R+W+I   + +  +             E G  KY + G+ +  +H+     L P+    
Sbjct: 323 VRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW---KLPPMKEL- 378

Query: 401 VADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQ 460
             D+ +QE   +    E    +  G     + + R+   +   ++  S D  + ++D+  
Sbjct: 379 --DKGSQEPIFYRTPEENPYFV--GVLRGHMSSVRTVSGHGRIVISGSYDHNLMVWDIIS 434

Query: 461 RKLLEVLKG 469
            KLL +L G
Sbjct: 435 MKLLYILTG 443

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKV 202
            +W+ KF  DGK + +GS D  +RIW +
Sbjct: 302 GVWALKFV-DGKILVSGSTDRSVRIWNI 328

>CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021
           Saccharomyces cerevisiae YDR030c RAD28, hypothetical
           start
          Length = 522

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFE-YDCQDLITSV 366
           H   +TC+ ++  D+  F++G  DH  +LW    D  SFE   C +  T V
Sbjct: 191 HTYGITCLAWYGPDNGIFLTGSNDHAVKLW----DTASFEAVKCYNFDTRV 237

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 313 KTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEY-----DCQDLITSVT 367
           K   HP ++T +   P  +  F+SG  +   +LW I ++   FE      +C+ L+T++ 
Sbjct: 469 KNLTHPYWITSLHAIPYSN-VFVSGSWNGSLKLWKISENLREFEILAELPNCRGLVTNIQ 527

Query: 368 LSPEEGKY 375
            + E GKY
Sbjct: 528 -AVESGKY 534

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 25/109 (22%)

Query: 361 DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS 420
           D I +V  SP+ GKY + G  +  + +  T  L+PV      DR+ +             
Sbjct: 239 DEILTVAASPD-GKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGE------------- 284

Query: 421 KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469
                  V  L AFR    NS +L  +  D ++R + + Q   LEVL G
Sbjct: 285 -------VLSL-AFRK---NSDQLFASCADYKVRTYAINQFSQLEVLYG 322

>Kwal_23.5351
          Length = 474

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 76/219 (34%), Gaps = 64/219 (29%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQ-QVS 234
           I    +S D + +ATG  D  ++IW            +  A+S+ EA    +R  + +VS
Sbjct: 228 IGGVAWSSDSQLLATGGADNLVKIW------------NPQAQSHSEASRVVLRGHEARVS 275

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILS 294
            +                             FHP+                   + F+ S
Sbjct: 276 KVK----------------------------FHPS-------------------DRFVAS 288

Query: 295 ASMDKTVKLWHPDRKNSLK-TFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEV 353
           AS D T +LW  +R+  L+    H   V C++F   D     S  LD    +W +     
Sbjct: 289 ASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQ-CDGSLLCSAGLDSVGHVWDMRTGRS 347

Query: 354 SFEYDCQDL-ITSVTLSPEEGKYTIIGTFNGYVHILMTR 391
               +     I  V+ SP  G +   G+ +G V +   R
Sbjct: 348 LMVLEGHAKPIYGVSWSP-NGHHVATGSGDGTVQVWDIR 385

>Kwal_26.8628
          Length = 422

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 55/146 (37%), Gaps = 5/146 (3%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHP- 328
           + ++K H   V  + + +NN I++AS D T  LW   +   +  F  H   V  +   P 
Sbjct: 168 VSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALPPP 227

Query: 329 ---TDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYV 385
              T    F SG  D    +W       +  +   +   S       G   + G  +G  
Sbjct: 228 HAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDGVA 287

Query: 386 HILMTRGLTPVSSFHVADRQTQEQNA 411
            +   R    V+S+ ++    Q+ N+
Sbjct: 288 RMFDMRSDCAVASYSLSQNLQQQANS 313

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 271 LRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTFIHPDFV--TCVEFH 327
           L  ++EH   V  + ++K   +L SAS+D TV+ W   R  + + F   + V  TC+   
Sbjct: 376 LATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVE 435

Query: 328 PTDDRFFISGCLDHKCRLWSI 348
           P+ +             +WS+
Sbjct: 436 PSGEVVSAGSTDSFDVFVWSV 456

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 272 RLYKEHVQDVLDINWSKNN-FILSASMDKTVKLW--HPDRKNSLKTFI--HPDFVTCVEF 326
           R++  H QD+    WS ++ F+L+ S D T ++W  + + K  + T +  H D+V    F
Sbjct: 140 RVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYF 199

Query: 327 HPTDDRFF 334
           + T ++ +
Sbjct: 200 NSTQEKIY 207

>KLLA0E07766g 699154..700626 some similarities with sp|P40463
           Saccharomyces cerevisiae YIL135c singleton, hypothetical
           start
          Length = 490

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 64  LKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDTEQF 123
           +    T+TN+++D    S N ++T   MR     Q G+ L +  RV  FY +  + +++ 
Sbjct: 144 MALGRTRTNSSSDAATLSGNNSSTTRLMRTNSASQ-GSGLETRPRVLRFYSYADMISDEN 202

Query: 124 ENYLREPKYIKML 136
            +Y R P   + L
Sbjct: 203 SSYPRRPSITQSL 215

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           H D +TC++F P       +G +DH  +LW
Sbjct: 403 HDDAITCLDFDPHFSTLCTAGYMDHIVKLW 432

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 50/123 (40%), Gaps = 30/123 (24%)

Query: 352 EVSFEYDC-----QDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQT 406
           E  FEY+       D I +V  SP+ GKY + G  +  + +  T  L PV      DR+ 
Sbjct: 219 EGKFEYENVTEGHYDEILTVAASPD-GKYVVSGGRDRKLIVWSTESLAPVKIIPTKDRRG 277

Query: 407 QEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEV 466
           +                    V GL AF+    NS +L     D +IR + + Q   LE+
Sbjct: 278 E--------------------VLGL-AFKK---NSDQLFAACADYKIRTYAINQFSQLEI 313

Query: 467 LKG 469
           L G
Sbjct: 314 LYG 316

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 10/81 (12%)

Query: 438 LDNSFRLVVT-SNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQP------IV 490
           LD S R +V+ SND  IRI+DL++RK L  L   H GS  +     +   +P       +
Sbjct: 47  LDISKRYLVSGSNDEHIRIYDLQKRKELGTLLA-HQGSITNLKFSKVSDQEPKSTSGKWL 105

Query: 491 VNSSDDHWVYGWRLKSSDREN 511
           +++S+D+ +  WR+K  D EN
Sbjct: 106 LSASEDNKIIVWRVK--DWEN 124

>Kwal_27.12239
          Length = 316

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 288 KNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPTDDRFFISGCLDHKCRLW 346
           K N + S SMD+++K+W       L+T   H + V  ++  P D     SG  D   R++
Sbjct: 110 KGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIF 169

Query: 347 SILDDE----VSFEYDCQDLITSVTLS----PEEGKYTIIGTFNGYVHI 387
                     ++++ D Q     V +S       GKY ++ + +G + I
Sbjct: 170 DTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILKI 218

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 179 TKFSRDGKFMATGSKDGKIRIWKVIGSPVER 209
            KFSR+GK++   S DG ++IW  +   V R
Sbjct: 198 VKFSRNGKYLLVKSLDGILKIWDFVRGKVVR 228

>Scas_718.6*
          Length = 546

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 21/28 (75%)

Query: 277 HVQDVLDINWSKNNFILSASMDKTVKLW 304
           H Q ++ ++W  ++ ++SASMD +V++W
Sbjct: 411 HSQSIISLSWINDDLVISASMDGSVRIW 438

>Kwal_33.13515
          Length = 398

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 317 HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           H   +TC++  P D+RF ++G LD  C  W +
Sbjct: 235 HTGAITCMKLDP-DNRFLVAGSLDTICSFWDL 265

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 185 GKFMATGSKDGKIRIWKVI-GSPVERAEL 212
           G ++ATGS DG +RIW+++ G  V R +L
Sbjct: 448 GIWLATGSDDGSVRIWEILTGREVYRVQL 476

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 273 LYKEHVQDVLDINWSKNN--FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPT 329
           L  EH+   + I W KNN   I S S D+TVK+W      SLKTF  H  +V  ++    
Sbjct: 250 LGHEHIVSAVKI-WQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSID---V 305

Query: 330 DDRFFISGCLDHKCRL 345
              + ISG  D   RL
Sbjct: 306 LGDYIISGSHDTTLRL 321

>Scas_721.7
          Length = 325

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 15/124 (12%)

Query: 277 HVQDVLDINWS-KNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHPT-DDRF 333
           H   V+ + ++   N + ++SMD+++K+W       LKT   H + V  +   P  D   
Sbjct: 97  HTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSV 156

Query: 334 FISGCLDHKCRLWSILDDEV--SFEYDCQDL--------ITSVTLSPEEGKYTIIGTFNG 383
             SG  D   RL+         +  YD +D         I+ V  SP  GK+ ++ +F+G
Sbjct: 157 LASGSFDGLIRLFDTRTGHCLKTLTYD-KDWKSDDGVVPISQVRFSP-NGKFLLVSSFDG 214

Query: 384 YVHI 387
            V I
Sbjct: 215 IVKI 218

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 179 TKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAES 218
            +FS +GKF+   S DG ++IW  +   V R    S  ES
Sbjct: 198 VRFSPNGKFLLVSSFDGIVKIWDCVRGYVVRTFKPSDGES 237

>Kwal_56.23207
          Length = 933

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 65/154 (42%), Gaps = 33/154 (21%)

Query: 317 HPDFVTCVEF-HPTDDRF--FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEE- 372
           H D+V CV F   TDD    F +  LD K ++W + D       +C  L T     P E 
Sbjct: 110 HDDYVKCVAFLGRTDDSSVKFATCGLDMKIKIWLLKDSR-----NCTLLHTFDNHQPLET 164

Query: 373 -GKYTIIGTFNGYVHILMTRG-----LTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGP 426
              Y ++    G +   +  G     L  +SS       T +Q A +    T+ K+ H  
Sbjct: 165 GSLYALVAITGGSLPFDLIAGDNNGNLILISS------STGKQYAVISAHATNIKLIH-- 216

Query: 427 RVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQ 460
                      +DN  +++ TS+D  ++++DL++
Sbjct: 217 ----------LMDNDTKILSTSSDGMLKLWDLQK 240

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 69/188 (36%), Gaps = 56/188 (29%)

Query: 270 PLRLYKEHVQDVLDINWSKNNF-ILSASMDKTVKLWHP---------------------- 306
           P+R  K H   + D+ WS+++  +LS+S D  + +W P                      
Sbjct: 78  PVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAIS 137

Query: 307 --------------------DRKNSLKTFI------HPDFVTCVEFHPTDDRFFISGCLD 340
                                R N ++  +      H  +++  EF   D+R  ++   D
Sbjct: 138 PSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEF--LDERTILTASGD 195

Query: 341 HKCRLWSILDDEVSFEY-DCQDLITSVTLSPEE-GKYT---IIGTFNGYVHILMTRGLTP 395
             C +W I   +   E+ D    + ++ L P   G+Y    I G  +GY ++   R    
Sbjct: 196 MTCAMWDIPKSKRVTEFIDHLGDVLTMDLPPANTGRYGHNFITGGSDGYAYLWDVRQPNS 255

Query: 396 VSSFHVAD 403
             SF ++D
Sbjct: 256 AQSFFISD 263

>Kwal_33.15591
          Length = 714

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 275 KEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCVEFHPTDD 331
           K H   V D+    +  F ++AS D T+KLW  ++   LKTF  +H D +  ++   + +
Sbjct: 140 KGHTASVWDVKMLPEVGFYMTASADGTIKLWEGEK--VLKTFTGLHTDVIRHIDIDASGE 197

Query: 332 RF 333
           +F
Sbjct: 198 KF 199

>Scas_631.17
          Length = 474

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 68/181 (37%), Gaps = 29/181 (16%)

Query: 291 FILSASMDKTVKLWHPDRKNSLK-TFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSIL 349
           F+ SAS D T +LW  + +  L+    H   V  + F   D     SG LD+   +W + 
Sbjct: 289 FVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQ-NDGALLCSGGLDNAAIVWDVR 347

Query: 350 DDEVSFEYDCQDL-ITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQE 408
             +           I SV  SP +G +   G  +G ++I   R                 
Sbjct: 348 TGKSIMNLQGHAKPIYSVDWSP-DGYHIATGGGDGVINIWDIR----------------- 389

Query: 409 QNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLK 468
                  TET   + H   VTG+   R Q      LV    D +IRI+  +    ++ L+
Sbjct: 390 -----KTTETTRLLAHNNIVTGV---RFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLE 441

Query: 469 G 469
           G
Sbjct: 442 G 442

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           I+S  +S DG  +ATG  DG I IW +
Sbjct: 362 IYSVDWSPDGYHIATGGGDGVINIWDI 388

>KLLA0A01650g complement(146030..147235) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin (WD-40) repeat family singleton,
           start by similarity
          Length = 401

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIW 200
           ++S  F+  G+++A+   DGKIRIW
Sbjct: 298 VFSVSFNSTGEYLASAGYDGKIRIW 322

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 272 RLYKEHVQDVLDINWSKNN-FILSASMDKTVKLW 304
           R++  H  D+  + WSK++ FI+S S D T ++W
Sbjct: 140 RIHAGHFSDITSLTWSKDSRFIISTSKDLTARIW 173

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 271 LRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTF 315
           L  + EH   V  + ++K   +L SAS+D TVK W   R  + +TF
Sbjct: 376 LATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTF 421

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 177 WSTKFSRDGKFMATGSKDGKIRIWKV 202
           W+  F R  + +ATGSKDG++RI+++
Sbjct: 220 WAPSFGRWHQLIATGSKDGRVRIFQL 245

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWK 201
           +WS  ++  G  +++   DGK+R+WK
Sbjct: 286 VWSVSWNLTGTILSSSGDDGKVRLWK 311

>Kwal_47.19083
          Length = 324

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           +++  F+  G+++AT   DGKIR+W V
Sbjct: 221 VFNVSFNSTGEYLATCGYDGKIRVWDV 247

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 16/82 (19%)

Query: 280 DVLDINWSKNNFILSASMDKTVKLWH-PDRKNSLKT--FI----------HPDFVTCVEF 326
           +V++ N+ K  +I++AS D TVK W  P  KN L    FI          H   +  +  
Sbjct: 446 NVMEKNYPK--YIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISM 503

Query: 327 HPTDDRFFISGCLDHKCRLWSI 348
            P +D  F +   D  C+LW++
Sbjct: 504 AP-NDSIFATASYDKTCKLWNV 524

>Scas_649.10
          Length = 806

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 185 GKFMATGSKDGKIRIWKVI-GSPVERAELDSSAESNKE 221
           G ++ATGS DG +R+W+++ G  V +  L    E N +
Sbjct: 449 GLWLATGSDDGTVRVWEILTGREVYKVSLIDDTEENSD 486

>Kwal_26.8953
          Length = 458

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 267 HPTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI--HPDFVTCV 324
           H T ++  K H   V DI   + NFI+S S D++V++W  +   +++     H  F  C+
Sbjct: 374 HFTLVKTLKGHSSWVRDIR-VRGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANCI 432

Query: 325 --EFHPTDDRFFISGCLDHK 342
             +    + +  +SG  D K
Sbjct: 433 DTDCGGLNRQLLVSGGADGK 452

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 14/88 (15%)

Query: 311 SLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYD-------CQDLI 363
           S++   HP  VT  +FH  D++  ++   D   RLW     +VS  Y+         D +
Sbjct: 119 SIQASSHPTHVT--KFHDQDNKTLVTANDDRVVRLW-----DVSHAYEPTLQLTGASDYV 171

Query: 364 TSVTLSPEEGKYTIIGTFNGYVHILMTR 391
            SV   P        G+++G V +   R
Sbjct: 172 RSVCFVPNAPHMVATGSYDGVVRLYDIR 199

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 79/199 (39%), Gaps = 35/199 (17%)

Query: 277 HVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI---HPDFVTCVEFHPTDD-R 332
           H   V  + ++    ++S S D+TV++W  D K    T +   H   V C++     + +
Sbjct: 421 HDGGVWALKYAHGGILVSGSTDRTVRVW--DIKKGCCTHVFKGHNSTVRCLDIVEYKNIK 478

Query: 333 FFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRG 392
           + ++G  D+   +W +  +    ++  +     V  +PEE  Y  +G   G         
Sbjct: 479 YIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPY-FVGVLRG--------- 528

Query: 393 LTPVSSFHVADRQTQEQNAHVMVTETDSK---IRHGPRVTGLQAFRSQLDNSF------- 442
                  H+A  +T   + +++V+ +      +    ++  L       D  +       
Sbjct: 529 -------HMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHE 581

Query: 443 --RLVVTSNDSRIRIFDLE 459
             R +  S D+ IRI+DLE
Sbjct: 582 RKRCISASMDTTIRIWDLE 600

>Kwal_23.5035
          Length = 744

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 33/74 (44%), Gaps = 2/74 (2%)

Query: 277 HVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEF-HPTDDRFF 334
           H   V  + +  +  ++S S D++V++W+         F  H   V C++       +F 
Sbjct: 409 HDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFI 468

Query: 335 ISGCLDHKCRLWSI 348
           ++G  DH   +W +
Sbjct: 469 VTGSRDHTLHVWKL 482

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 444 LVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWR 503
           LV  S D  +R+++++  K   V KG H+ S+     +   +G+  +V  S DH ++ W+
Sbjct: 424 LVSGSTDRSVRVWNIKSGKCTHVFKG-HT-STVRCLDIVEHNGKKFIVTGSRDHTLHVWK 481

Query: 504 LKSSDREN 511
           L + + E+
Sbjct: 482 LPNCNAED 489

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 54/125 (43%), Gaps = 14/125 (11%)

Query: 291 FILSASMDKTVKLWHPDRKNSLKTFI------HPDFVTCVEFHPTDDRFFISGCLDHKCR 344
            + SA ++    ++   ++N +   +      H  +++ +EF  TD+   ++   D  C 
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEF--TDNAHILTASGDMTCA 205

Query: 345 LWSILDDEVSFEY-DCQDLITSVTLSPEEGKYTIIGTF-----NGYVHILMTRGLTPVSS 398
           LW I   +   EY D    + ++ +  E        TF     +GY +I  +R  + V S
Sbjct: 206 LWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQS 265

Query: 399 FHVAD 403
           F+V D
Sbjct: 266 FYVND 270

>Scas_558.3
          Length = 725

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 271 LRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTF--IHPDFVTCVE 325
           L  ++  V D   I+  +N FI +AS D+TVKLW  ++   LKTF  IH D +  +E
Sbjct: 137 LEGHQASVWDAKIISVEENTFI-TASADRTVKLWKENKL--LKTFSGIHSDVIRNIE 190

>Scas_684.7
          Length = 511

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 14/87 (16%)

Query: 280 DVLDINWSKNNFILSASMDK--TVKLWH-----PDRKNSLKTFIHPDF----VTCVEFHP 328
           DV  I+WS+    L AS D   T  +W      P+   S++     DF    +T + F+P
Sbjct: 368 DVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFNP 427

Query: 329 TDDRFFISGCLDHKCRLWSI---LDDE 352
            D+     G  D+   LW +    DDE
Sbjct: 428 LDESIIAVGSEDNTVTLWDLSVEADDE 454

>Scas_595.3*
          Length = 555

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 29/108 (26%)

Query: 315 FIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWS---ILD------DEVSFE--------- 356
           F   D +TCV F P D +F I G  D +  L+    I+D      DEV  E         
Sbjct: 240 FSKGDLITCVSFSPRDTKFVI-GTKDGRILLFDQDLIIDNYEKYEDEVFLEPIFTYKNTA 298

Query: 357 ---YDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHV 401
                C + ++       +G+  I+G   G+++I+  R     +S+H+
Sbjct: 299 SKGLGCIEWLS-------DGESLIVGDETGFINIINIRSTLDPNSYHL 339

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 56/142 (39%), Gaps = 35/142 (24%)

Query: 177 WSTKFSRDGKFMATGSKDGKIRIWKVIGSPVER--AELDSSAESNKEARAKSMRIKQQVS 234
           W+    R    +ATG KDG++RI++V  SP +     L  S + N E +     IKQ+ +
Sbjct: 220 WAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQG----IKQRQN 275

Query: 235 SLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILS 294
             N   E + L                            + +H  +V  ++W+    ILS
Sbjct: 276 --NTDLEVELLSE--------------------------HDDHKGEVWSVSWNLTGTILS 307

Query: 295 AS-MDKTVKLWHPDRKNSLKTF 315
           ++  D  V+LW     N  K  
Sbjct: 308 STGEDGKVRLWKSTYSNEYKCM 329

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWK 201
           +WS  ++  G  +++  +DGK+R+WK
Sbjct: 294 VWSVSWNLTGTILSSTGEDGKVRLWK 319

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 274 YKEHVQDVLDINWSKNNF---ILSASMDKTVKLWHPD 307
           ++ H   ++ ++W+   +   I SAS DKT+K+W  D
Sbjct: 51  WRAHDSSIVSLDWASPEYGRIIASASYDKTIKIWEED 87

>Kwal_33.14971
          Length = 818

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 185 GKFMATGSKDGKIRIWKVI-GSPVERAEL 212
           G ++ATGS DG +RIW+++ G  V + +L
Sbjct: 464 GLWLATGSDDGSVRIWEILTGREVYKVQL 492

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 274 YKEHVQDVLDINWSKNNF---ILSASMDKTVKLWHPD 307
           +K H   ++ ++W+   F   I S S DKT+KLW  D
Sbjct: 51  WKAHDSSIVSLDWAAPEFGRIIASVSYDKTIKLWEED 87

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 177 WSTKFSRDGKFMATGSKDGKIRIWKV 202
           W+    R  + +ATG KDGK+RI+KV
Sbjct: 220 WAPSVGRWYQLIATGCKDGKLRIFKV 245

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           +WS  ++  G  +++   DGKIR+WK 
Sbjct: 302 VWSVSWNLTGTILSSTGDDGKIRLWKA 328

>Kwal_47.17572
          Length = 434

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 2/42 (4%)

Query: 175 AIWSTKFSRDGKFMATGSKDGKIRIWKVI--GSPVERAELDS 214
           +I S  +S++G+++ T S+D  +++W +   G P+ +A  DS
Sbjct: 75  SIQSIAWSKNGRYLLTSSRDWTVKVWDLSMPGEPMRQAVFDS 116

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 277 HVQDVLDINWSKNN-FILSASMDKTVKLW 304
           HV+ +  I WSKN  ++L++S D TVK+W
Sbjct: 72  HVRSIQSIAWSKNGRYLLTSSRDWTVKVW 100

>Scas_603.5
          Length = 589

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 74/191 (38%), Gaps = 44/191 (23%)

Query: 316 IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI-LDDEVSFEYDCQDLITSVT---LSPE 371
           ++ D VTC++F  +    + +G  +   ++W +  +D+V    D  D I SVT   L P 
Sbjct: 292 VYTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQV---MDLDDHIASVTCMQLHP- 347

Query: 372 EGKYTIIGTFNGYVHILMTRGLTPVSSF---------------HVAD-RQTQEQNAHVMV 415
           + K  I G+ +  +  L   GL P +S                H A+       N +++ 
Sbjct: 348 DSKTLITGSKDATLK-LWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLS 406

Query: 416 TETDSKIRHGPRVTG--LQAFRSQLDNS-----------------FRLVVTSNDSRIRIF 456
              D  IR     TG  +Q   + L ++                   L   S D  IR++
Sbjct: 407 ASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLW 466

Query: 457 DLEQRKLLEVL 467
           DL   K++  L
Sbjct: 467 DLRSGKVVRTL 477

>Kwal_33.13148
          Length = 673

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 181 FSRDGKFMATGSKDGKIRIW 200
           F  D K +A+GS+DGKI IW
Sbjct: 592 FGYDNKLIASGSEDGKIYIW 611

>KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces
           cerevisiae YBR195c MSI1 chromatin assembly complex,
           subunit p50, start by similarity
          Length = 417

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 37/193 (19%), Positives = 80/193 (41%), Gaps = 26/193 (13%)

Query: 275 KEHVQD---VLDINWSKNNFILSASMDKT-----VKLWHPDRKNSLKTFIHPDFVTCVEF 326
           +E V D   V D++W  N+  + AS  ++     + +    + ++L    H D +  +EF
Sbjct: 230 RESVMDANGVNDVSWMVNHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEF 289

Query: 327 HPTDDRFFISGCLDHKCRLWSILDDEV---SFEYDCQDLITSVTLSPEEGKYTIIGTFNG 383
           +  +D    +G    + ++W I D +     +E+  QD I+++  +P+  +  I+ T + 
Sbjct: 290 NYKNDMILCTGDSQGQLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQ--ILATAD- 346

Query: 384 YVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFR 443
                   GL  +         +  +N  ++         HG  + G+        + + 
Sbjct: 347 -----QQSGLVKIWDASGEQEDSNAENNMLLFV-------HGGHMLGVNDISWSQHDPWT 394

Query: 444 LVVTSNDSRIRIF 456
           +   SND+ I I+
Sbjct: 395 MCSVSNDNSIHIW 407

>ACR162C [1209] [Homologous to ScYPL126W (NAN1) - SH]
           (637642..640224) [2583 bp, 860 aa]
          Length = 860

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 294 SASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRL 345
           ++S    V +++PD    L TF H ++++C+ ++   D  FI    D  C+L
Sbjct: 715 TSSYRSRVLIFNPDLSERLGTFEHDEYISCISWNNDTDFIFI----DTNCKL 762

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 68/161 (42%), Gaps = 24/161 (14%)

Query: 275 KEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSL-KTF--IHPDFV--TCVEFHPT 329
           K H   V D     +  +L+AS D TVKLW   +  +L KTF  +H D V   C+     
Sbjct: 135 KGHSASVWDAKLLNDGSVLTASADTTVKLW---KNGTLAKTFDKLHSDVVRNICI---LD 188

Query: 330 DDRFFISGCLDHKCRL----WSILDDEV---SFEYDCQDLITSVTLSPEEGKYTIIGTFN 382
           D + F+S   D   +L      IL + +   SF Y  + L +   +S  E +   I   +
Sbjct: 189 DGKHFVSCSNDGTLKLSNLEGGILHEFIGHESFVYAVKQLPSGDIVSCGEDRTVRIWNMD 248

Query: 383 GYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIR 423
           G +  ++T    P  S    D      N  ++V  +D  IR
Sbjct: 249 GTIKQVIT---LPAISIWTVDVLP---NGDIVVGSSDKIIR 283

>ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887)
           [1212 bp, 403 aa]
          Length = 403

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 312 LKTFI--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348
           L+ F+  H D VT V+FHPTD    +SG  D    ++ +
Sbjct: 139 LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177

>YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine protein
            kinase involved in vacuolar protein sorting [4365 bp,
            1454 aa]
          Length = 1454

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 74/178 (41%), Gaps = 30/178 (16%)

Query: 317  HPDFVTCVEFHPTDDRFFISGCLDHKCRLWS---ILDDEV---SFEYDCQDLITSVTLSP 370
             P+ +T     P +  + I+G      ++W+   I+  EV   S  YDC   +T +T+ P
Sbjct: 1079 EPNSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDCSSTVTQITMIP 1138

Query: 371  EEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIR-----HG 425
                + +  + +G + +L              +   QE     +  E   KI        
Sbjct: 1139 NFDAFAV-SSKDGQIIVLK------------VNHYQQESEVKFLNCECIRKINLKNFGKN 1185

Query: 426  PRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSI 483
                 ++AF ++ + S  LV  +N SR+ IFD+   + L++++     S +H A  SI
Sbjct: 1186 EYAVRMRAFVNE-EKSL-LVALTNLSRVIIFDIRTLERLQIIE----NSPRHGAVSSI 1237

>Kwal_23.6240
          Length = 913

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKVI 203
           +  +S DG  + T S+DGKI+IW V+
Sbjct: 346 AVTYSPDGSRVVTASEDGKIKIWDVV 371

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 271 LRLYKEHVQDVLDINWSKNNFIL-SASMDKTVKLWHPDRKNSLKTFIHPDFV--TCVEFH 327
           L  ++EH   V  + ++K   +L SAS+D TV+ W   R  + +TF   + +   C+   
Sbjct: 376 LVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAAD 435

Query: 328 PTDDRFFISGCLDHKCRLWSI 348
           P+ +             +WS+
Sbjct: 436 PSGEVVCAGSVDSFAVHVWSV 456

>YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.8054p
           [1785 bp, 594 aa]
          Length = 594

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKV 202
           S  FS  G  +A G++ GK+R+WK+
Sbjct: 567 SVAFSPSGGLLAVGNEQGKVRLWKL 591

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 185 GKFMATGSKDGKIRIWKVI-GSPVERAELDSSAESN 219
           G ++ATGS DG +R+W+++ G  V +  + ++ E+N
Sbjct: 438 GLWLATGSDDGTVRVWEILTGREVYQVTILNAEENN 473

>YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein with
           possible role in ribosome biogenesis, has similarity to
           mouse Bop1 growth suppressor, has five WD (WD-40)
           domains [2424 bp, 807 aa]
          Length = 807

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 185 GKFMATGSKDGKIRIWKVI-GSPVERAEL 212
           G ++ATGS DG +R+W+++ G  V R  L
Sbjct: 449 GLWLATGSDDGTVRVWEILTGREVYRTTL 477

>AEL153W [2353] [Homologous to ScYJL069C - SH]
           complement(343247..344950) [1704 bp, 567 aa]
          Length = 567

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKV 202
           S  FS  G+ +A G++ GK+R+W++
Sbjct: 539 SVAFSTHGEMLAVGNEQGKVRLWRL 563

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 59/143 (41%), Gaps = 18/143 (12%)

Query: 290 NFILSASMDKTVKLWHP-DRKNSLKTFI-HPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           N   +A  D  V L+   D  N L     H D VT +EF P +D    S   D +  +W 
Sbjct: 283 NLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWD 342

Query: 348 ILDDEVSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQ 407
           +   E+  E   QD I       E+G   ++    G+   +    + P  ++ VA   + 
Sbjct: 343 L--QEIGAE-QTQDEI-------EDGPPEVLMIHAGHKTSINDIAVNPNINWLVA---SA 389

Query: 408 EQNAHVMVTETDSKIRHGPRVTG 430
           E++  V + +  S I   PR+ G
Sbjct: 390 EEDNIVQIWKCSSNI---PRIGG 409

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 63/180 (35%), Gaps = 31/180 (17%)

Query: 180 KFSRDGKFMATGSKDGKIRIWKVIGS------PVERAELDSSAESNKEARAKSMRIKQQV 233
           ++SRD K + + S+DG + +W  +        P++   + + A S   A A S  +    
Sbjct: 92  RWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCALSPSGALAASAGLNNNC 151

Query: 234 SSLNNPKEKQFLDSATX---------------XXXXXXXXXXXXAPVFHPTP----LRLY 274
           +    P+      + T                                   P    +R Y
Sbjct: 152 TIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDIPKAKRVREY 211

Query: 275 KEHVQDVLDI-----NWSKNNFILSASMDKTVKLWHPDRKNSLKTF-IHPDFVTCVEFHP 328
            +H+ DVL I     N SKNN   S   D    +W     ++++ F I      C++F P
Sbjct: 212 SDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDSNCLKFFP 271

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 58/153 (37%), Gaps = 35/153 (22%)

Query: 177 WSTKFSRDGKFMATGSKDGKIRIWKVIG----------SPVERAELDSSAESNKEARAKS 226
           W +       ++ +GS DG +R + + G           P+      SS         ++
Sbjct: 105 WVSSLDVGSNYIYSGSYDGIVRTYNLSGKVEKQYSGHSGPIRAVHYISSTRLVSAGNDRT 164

Query: 227 MRI-KQQVSSLNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDIN 285
           +R+ K +   L +  E++  D  T                     L + + H   V+ I+
Sbjct: 165 LRLWKTKNDDLKSIDEEEIEDGKT---------------------LAILEGHKAPVVSID 203

Query: 286 WSKNNFILSASMDKTVKLWHPDRKNSLKTFIHP 318
            SK+  ILSAS D TV LW  + K    T I P
Sbjct: 204 VSKDR-ILSASCDNTVSLWSTNYKE--MTVIDP 233

>Scas_692.29
          Length = 456

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 52/129 (40%), Gaps = 4/129 (3%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSS 235
           I S   S+D K + T S DG IR W + G    + +   S  S      K +   + VS+
Sbjct: 106 ISSIDVSQDKKAIITASYDGVIRTWNLSG----KVQKQYSGHSGPIRAVKFISDTRLVSA 161

Query: 236 LNNPKEKQFLDSATXXXXXXXXXXXXXAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSA 295
            N+   + +                  A +     L + + H   V+ ++ S  + ILS+
Sbjct: 162 GNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSS 221

Query: 296 SMDKTVKLW 304
           S D ++ LW
Sbjct: 222 SYDNSIGLW 230

>CAGL0L09757g complement(1046898..1047878) highly similar to
           sp|P36104 Saccharomyces cerevisiae YKL018w, start by
           similarity
          Length = 326

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 271 LRLYKEHVQDVLDINWSK-NNFILSASMDKTVKLWHPDRKNSLKTFIHPDFV-TCVEFHP 328
           LR +  H   V DI  S  N+  LSAS D++V++W  D + S    I P  V  C+ + P
Sbjct: 105 LRYFVGHGALVSDIQMSPINDSFLSASYDESVRVW--DLRTSKAQAIIPTVVPNCIAYDP 162

Query: 329 TDDRF 333
           +   F
Sbjct: 163 SGLVF 167

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 79/210 (37%), Gaps = 43/210 (20%)

Query: 267 HPTPLRLYKEHVQDVLDINWSKN-NFILSASMDKTVKLWH-PDRKNSLKTFIHPDFVTCV 324
           H    +  K H  +V  + + K  + ++SAS D  V++W+ P  +       H D V C+
Sbjct: 45  HHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREG-----HMDEVECI 99

Query: 325 EF----------HPTDDRFFISGCLDHKCRLWSILDDEVSF--EYDCQDLITSVTLSPEE 372
           +                   + GC D    +WS ++D+     E+  Q  +  + LS  E
Sbjct: 100 QVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHE 159

Query: 373 GKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQ 432
            + T           ++  G T V+ F           + V  +E  SK+    ++ G +
Sbjct: 160 IEKT---------QFILAIGGTNVNVFIY---------SLVSNSEGVSKLEFATKLEGHE 201

Query: 433 ------AFRSQLDNSFRLVVTSNDSRIRIF 456
                  FR  +   + L   S D  IR++
Sbjct: 202 DWIKSLVFRETVPGDYLLASGSQDRYIRLW 231

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 3/88 (3%)

Query: 265 VFHPTPLRLYKEHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKT-FIHPDFVT 322
           +F  T +     H   +  +N S N  ++ S S D++++LW  +    L   + H   + 
Sbjct: 166 LFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIW 225

Query: 323 CVEFHPTDDRFFISGCLDHKCRLWSILD 350
            + F   D +  IS   D  CR+W+I++
Sbjct: 226 NLMFFDNDSKL-ISVSEDCTCRVWNIIE 252

>Kwal_33.15475
          Length = 783

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 71/185 (38%), Gaps = 38/185 (20%)

Query: 292 ILSASMDKTVKLWHPDRKNSLK-----TF----IHPDFVTCVEFHPTD-DRFFISGCLDH 341
           +LS S D+   +W   +KNS       TF     H   +   ++ PT+    F++   D 
Sbjct: 613 LLSVSRDRQWAVW---KKNSATNEFELTFKNEKAHTRIIWDCDWAPTEFGHVFVTASRDK 669

Query: 342 KCRLWSILDDEVSFE----YDCQDLITSVTLSP--EEGKYTII-GTFNGYVHILMTRGLT 394
             + W + +D   +E          +T++++ P    GK  +  G  NG + +       
Sbjct: 670 HIKAWKLSEDGQQYEQQHALKLAVPVTAISVFPGLHNGKLLVAAGLENGNIQVFTY---- 725

Query: 395 PVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIR 454
                          N     +E D++     RV+ L+   +Q      L VTS D  IR
Sbjct: 726 --------------DNQFRCYSEIDTRFTPADRVSRLRWSSNQEKGRILLAVTSADHSIR 771

Query: 455 IFDLE 459
           +F +E
Sbjct: 772 VFSME 776

>CAGL0G01628g complement(151262..152392) similar to sp|P53962
           Saccharomyces cerevisiae YNL035c, hypothetical start
          Length = 376

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 312 LKTFI--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352
           +++F+  H D +T + FHP D    +SG  D    ++ +L+ E
Sbjct: 133 VRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPE 175

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSS 235
           ++S  F+  G+F+A+   D K+R+W V     ER    + +  + E     +   +Q +S
Sbjct: 200 VFSLSFNSTGEFLASCGYDSKVRVWDV--KLKERVSTLNISAGDIEIEEDILLRDEQGNS 257

Query: 236 LNNP 239
           L NP
Sbjct: 258 LKNP 261

>Kwal_14.1611
          Length = 334

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWK 201
           +WS  ++  G  +++   DGK+R+WK
Sbjct: 291 VWSVSWNLTGTILSSAGDDGKVRLWK 316

>KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces
           cerevisiae YJL069c singleton, start by similarity
          Length = 566

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKV 202
           S  FS  G+ +A G++ GK+R+W++
Sbjct: 539 SVAFSPQGEMLAVGNEQGKVRLWRL 563

>Scas_646.14
          Length = 755

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 331 DRFFISGCLDHKCRLWSILDDEV 353
           D F I GC D + R+WS+  D+V
Sbjct: 175 DSFVIGGCSDGRIRVWSVQKDDV 197

>Kwal_56.23035
          Length = 424

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 316 IHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDC 359
           +H   +T V+++  D+  F +G  DHK ++W     EV+   D 
Sbjct: 140 MHAFSITSVQWYGADNGLFFTGSNDHKVKVWDTNAFEVASTIDV 183

>Kwal_27.11550
          Length = 407

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 301 VKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352
           +K WH   ++ + +  H D +T ++FHPTD    +SG  D    ++ +   E
Sbjct: 132 MKAWHQPLRSLVDS--HHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPE 181

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 45/117 (38%), Gaps = 3/117 (2%)

Query: 272 RLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTFIH-PDFVTCVEFHPT 329
           R+   H  DV   +W  K   I+S S D  +KLW P    ++ T +     V   +F PT
Sbjct: 199 RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPT 258

Query: 330 DDRFFISGCLDHKCRLWSILDDEVSFEYDCQDL-ITSVTLSPEEGKYTIIGTFNGYV 385
                     D   +++ +       +    D+   S++  P       +G +NG +
Sbjct: 259 QGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAI 315

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 289 NNFILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWS 347
           N  I S S D++++LW  +    L   + H   +  ++F   D+   +S   D  CR+W+
Sbjct: 191 NKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENL-VSVSEDCTCRVWN 249

Query: 348 ILDDEVS 354
           I+ +++S
Sbjct: 250 IIPNDIS 256

>Kwal_0.49
          Length = 584

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKV 202
           S  FS  G+ +A G++ GK+R+W++
Sbjct: 556 SVAFSPRGEMLAAGNEQGKVRLWRL 580

>Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement
          Length = 576

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 178 STKFSRDGKFMATGSKDGKIRIWKV 202
           S  FS  G+ +A G++ GK+R+W++
Sbjct: 549 SVAFSPRGEMLAVGNEQGKVRLWRL 573

>Scas_712.34
          Length = 399

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 176 IWSTKFSRDGKFMATGSKDGKIRIWKV 202
           +++  F+  G+F+AT   D K+R+W V
Sbjct: 296 VFALSFNSTGEFLATSGYDSKVRVWDV 322

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,169,358
Number of extensions: 1065035
Number of successful extensions: 5958
Number of sequences better than 10.0: 277
Number of HSP's gapped: 5822
Number of HSP's successfully gapped: 492
Length of query: 820
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 710
Effective length of database: 12,788,129
Effective search space: 9079571590
Effective search space used: 9079571590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)