Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR099C29729315640.0
Scas_717.6529629312531e-175
Kwal_26.767929629312011e-168
CAGL0K03289g29729311941e-166
KLLA0C14300g29629311821e-165
ABL056C29629311651e-162
Scas_254.21511486001e-78
ADL378W49475720.43
KLLA0E21692g34969710.48
YLR398C (SKI2)128779662.6
YCL063W (VAC17)42349627.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR099C
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR099C (YMR099C) [4057] chr13 complement(463933..464826) Member...   607   0.0  
Scas_717.65                                                           487   e-175
Kwal_26.7679                                                          467   e-168
CAGL0K03289g 300996..301889 highly similar to sp|Q03161 Saccharo...   464   e-166
KLLA0C14300g 1242952..1243842 similar to sp|Q03161 Saccharomyces...   459   e-165
ABL056C [536] [Homologous to ScYMR099C - SH] (294383..295273) [8...   453   e-162
Scas_254.2                                                            235   1e-78
ADL378W [1363] [Homologous to ScYBR126C (TPS1) - SH] complement(...    32   0.43 
KLLA0E21692g complement(1927687..1928736) highly similar to sp|P...    32   0.48 
YLR398C (SKI2) [3777] chr12 complement(915156..919019) Antiviral...    30   2.6  
YCL063W (VAC17) [485] chr3 (17290..18561) Protein required for v...    28   7.4  

>YMR099C (YMR099C) [4057] chr13 complement(463933..464826) Member of
           the aldose 1-epimerase family, which interconvert
           aldoses between their alpha- and beta-forms, has high
           similarity to uncharacterized C. albicans Orf6.1972p
           [894 bp, 297 aa]
          Length = 297

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60
           MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI
Sbjct: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120
           PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW
Sbjct: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120

Query: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180
           PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL
Sbjct: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180

Query: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240
           YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP
Sbjct: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240

Query: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293
           WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY
Sbjct: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293

>Scas_717.65
          Length = 296

 Score =  487 bits (1253), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 226/293 (77%), Positives = 257/293 (87%)

Query: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60
           MPI+  D EV+LTHP +  +SV ILKYGATVYSWK+   EQLWLSTAAKLDGSKPVRGGI
Sbjct: 1   MPIQNNDSEVILTHPKNSQSSVTILKYGATVYSWKINGVEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120
           PLVFPVFGKN TD  LSKLPQHGLARNSTWEFLGQ KE+PPT+QFGL  EIANPELTKLW
Sbjct: 61  PLVFPVFGKNETDPLLSKLPQHGLARNSTWEFLGQVKEDPPTIQFGLNKEIANPELTKLW 120

Query: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180
           P D+ L+LTVELG D+LKT+IEV+NTS+S+ELKFNWLFHTY RIEDIE TMVSNLAGM  
Sbjct: 121 PQDFQLVLTVELGVDFLKTSIEVDNTSNSEELKFNWLFHTYLRIEDIEDTMVSNLAGMNF 180

Query: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240
           YDQL+KES VDKHPVVTF+QETDVIY+NV+A+R IQ+V++G  IHTLKR NLPD VVWNP
Sbjct: 181 YDQLIKESMVDKHPVVTFHQETDVIYKNVNADRVIQVVNRGKPIHTLKRENLPDAVVWNP 240

Query: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293
           W++KS+GM DFEPK+GY+ M+C+EPGHVHDF+ LAPGKKWNA QLL K+ L Y
Sbjct: 241 WVKKSEGMGDFEPKSGYKNMVCVEPGHVHDFVVLAPGKKWNASQLLYKDALNY 293

>Kwal_26.7679
          Length = 296

 Score =  467 bits (1201), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 213/293 (72%), Positives = 251/293 (85%)

Query: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60
           M ++ET  EV+L HP +  T   ILKYGATV+SW L  EEQLWLS+AAK+DGSKPVRGGI
Sbjct: 1   MSVEETATEVILAHPDNSKTCAKILKYGATVFSWTLNGEEQLWLSSAAKMDGSKPVRGGI 60

Query: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120
           PLVFPVFGKN+ DE LSKLPQHGLARNSTWEFLGQ   NPPTVQFGL PE ANPELTKLW
Sbjct: 61  PLVFPVFGKNTDDELLSKLPQHGLARNSTWEFLGQVSANPPTVQFGLGPEFANPELTKLW 120

Query: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180
           P+DY L+LTVELGSD+LKT IEV NTSS KELKFNWLFHTY +I+DIE TMV+NL+G KL
Sbjct: 121 PLDYSLVLTVELGSDHLKTHIEVSNTSSDKELKFNWLFHTYLKIDDIEDTMVANLSGAKL 180

Query: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240
           YDQ+L+ESYVD+ PVV+F++E D IYQ V  +R +Q++DKG QIHT+KR+NLPD VVWNP
Sbjct: 181 YDQMLQESYVDRQPVVSFHEELDRIYQQVPGDRLLQVIDKGRQIHTVKRHNLPDAVVWNP 240

Query: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293
           WI+KS+GM DFEPK+GY++M+C+EPG+VHDF+ L PG+ W AYQLL K+ELKY
Sbjct: 241 WIDKSKGMGDFEPKSGYKEMVCVEPGYVHDFVHLQPGQTWTAYQLLYKDELKY 293

>CAGL0K03289g 300996..301889 highly similar to sp|Q03161
           Saccharomyces cerevisiae YMR099c, start by similarity
          Length = 297

 Score =  464 bits (1194), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 216/293 (73%), Positives = 250/293 (85%), Gaps = 1/293 (0%)

Query: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60
           M I+ETD +VV+THP++  TSV ILKYGATV SWKL  EEQLWLSTAAKLDGSKPVRGGI
Sbjct: 1   MSIEETDSQVVITHPSNSNTSVTILKYGATVTSWKLNGEEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120
           PLVFPVFGKN +DE LSKLPQHG ARNSTWEFLGQ K NPPTVQFGL P+IAN EL KLW
Sbjct: 61  PLVFPVFGKNQSDELLSKLPQHGFARNSTWEFLGQVKSNPPTVQFGLNPKIANQELVKLW 120

Query: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180
           P+D+ LILT+ELG D+LKTAIEVEN +S + +KFNWLFHTY  IEDIE TMVSNL GMK+
Sbjct: 121 PLDFNLILTIELGEDFLKTAIEVEN-ASEENMKFNWLFHTYLHIEDIEDTMVSNLVGMKV 179

Query: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240
           YDQLLKES++DKHPVVTF+QETD IYQNV ++R IQ+V KG  +HT+KR NLPD VVWNP
Sbjct: 180 YDQLLKESFIDKHPVVTFHQETDSIYQNVDSDRLIQVVGKGKPLHTVKRENLPDAVVWNP 239

Query: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293
           W++KS GM DFEPK G++ M+C+EPGHV DF+ L PG+KW+A Q+L K+EL Y
Sbjct: 240 WVDKSAGMGDFEPKDGFKNMVCVEPGHVSDFVVLPPGQKWSAAQILSKQELNY 292

>KLLA0C14300g 1242952..1243842 similar to sp|Q03161 Saccharomyces
           cerevisiae YMR099c singleton, start by similarity
          Length = 296

 Score =  459 bits (1182), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 250/293 (85%)

Query: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60
           MPI+ET+ E++LTHP + +T   ILKYGATV+SW+LK EEQLWLSTAAKLDGSKPVRGGI
Sbjct: 1   MPIEETETEIILTHPNNSSTKARILKYGATVFSWELKGEEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120
           PLVFPVFGKN  DEHLSKLPQHGLARNS WEFLGQ K NPPT+Q GL PE AN ELT LW
Sbjct: 61  PLVFPVFGKNHDDEHLSKLPQHGLARNSVWEFLGQVKSNPPTIQLGLGPEFANEELTNLW 120

Query: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180
           P +Y L+L+VELG +YLKT IEV NTS+++ LKFNWLFHTY +I+DIE T+VSNL+  KL
Sbjct: 121 PFEYSLVLSVELGDEYLKTEIEVLNTSTTQNLKFNWLFHTYLKIDDIEDTLVSNLSSTKL 180

Query: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240
           YDQLLKESY+D+ PV++ ++E D IYQNV  +R IQ++DKG  IHTLKR+NLPDTVVWNP
Sbjct: 181 YDQLLKESYIDRQPVISVHEELDRIYQNVDEDRIIQVIDKGYPIHTLKRHNLPDTVVWNP 240

Query: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293
           W+EKS+GMADFEPK G++ M+C+EPGHVHDF+ LAPG+ W A Q+L K+ELK+
Sbjct: 241 WVEKSKGMADFEPKDGFKNMVCVEPGHVHDFVVLAPGENWVASQILYKDELKF 293

>ABL056C [536] [Homologous to ScYMR099C - SH] (294383..295273) [891
           bp, 296 aa]
          Length = 296

 Score =  453 bits (1165), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 242/293 (82%)

Query: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60
           M +   +KEV+L HP++E T+V IL YGAT+YSW +  EEQLWLS AAKLDGSKPVRGGI
Sbjct: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120
           PLVFPVFGKN+ DEH SKLPQHGLARNSTWEFLGQTKENPP VQFGL PE+AN ELT LW
Sbjct: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120

Query: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180
           P DY L+LTVELG ++LKT IEV NTS+S+ L+FNWLFHTY +I+D+E TMVSNL   K 
Sbjct: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180

Query: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240
           YDQLLK SYVD+ PVV F++E D IYQ V+ +R IQIVDKG  IH++ R NLPD VVWNP
Sbjct: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240

Query: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKY 293
           WIEKS  M DF+PK GYQ+MICIEPGHVHDF++L PG+KW+ YQLL K+ LKY
Sbjct: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTLKY 293

>Scas_254.2
          Length = 151

 Score =  235 bits (600), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 102/148 (68%), Positives = 128/148 (86%)

Query: 146 TSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKLYDQLLKESYVDKHPVVTFNQETDVI 205
           TS+S++LKFNWLFHTY +I+DIE TMVSNL G KLYDQ+LKE+YVDK PVV+F++E D I
Sbjct: 1   TSNSQQLKFNWLFHTYLKIDDIEDTMVSNLVGSKLYDQMLKETYVDKQPVVSFHEELDRI 60

Query: 206 YQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNPWIEKSQGMADFEPKTGYQQMICIEP 265
           YQ V  +R +Q+VDKG  +HT+KR+NLPD VVWNPW+EKS+GM DFEPK+GY+ M+C+EP
Sbjct: 61  YQQVEDDRLVQVVDKGHPVHTVKRHNLPDAVVWNPWVEKSKGMGDFEPKSGYKNMVCVEP 120

Query: 266 GHVHDFISLAPGKKWNAYQLLCKEELKY 293
           GHVHDF+ L PG+KWNAYQLL K+EL +
Sbjct: 121 GHVHDFVVLQPGEKWNAYQLLYKDELNF 148

>ADL378W [1363] [Homologous to ScYBR126C (TPS1) - SH]
           complement(45883..47367) [1485 bp, 494 aa]
          Length = 494

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 18/75 (24%)

Query: 119 LWPMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYF-----------RIEDI 167
           +W  DY L+L  EL  +Y+ TA       + + +K  W  HT F           R E +
Sbjct: 159 VWVHDYHLMLLPELLRNYIATA-------NLQNVKLGWFLHTPFPSSEIYRILPVRQEIL 211

Query: 168 EGTMVSNLAGMKLYD 182
            G +  +L G   YD
Sbjct: 212 RGVLSCDLLGFHTYD 226

>KLLA0E21692g complement(1927687..1928736) highly similar to
           sp|P29509 Saccharomyces cerevisiae YDR353w TRR1
           thioredoxin reductase (NADPH), start by similarity
          Length = 349

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 18  ETTSVHILKYGATVYSWKLKSEEQLW---LSTAAKLDGSKPVRGGIPLVFPVFGKNSTDE 74
           ETT   IL  GA+     L  EE  W   +S  A  DG+ P+    PL   + G +S  E
Sbjct: 140 ETTDAIILSTGASAKRLHLPGEETYWQQGISACAVCDGAVPIFRNKPLAV-IGGGDSACE 198

Query: 75  HLSKLPQHG 83
               L ++G
Sbjct: 199 EAQFLTKYG 207

>YLR398C (SKI2) [3777] chr12 complement(915156..919019) Antiviral
            protein and probable helicase with role in repression of
            translational utilization of mRNA that lacks poly(A)+
            tail, part of a system to protect cells from
            double-stranded RNA (dsRNA) viruses [3864 bp, 1287 aa]
          Length = 1287

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 160  TYFRIEDIEGTMVSNLAGMKLYDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVD 219
            T F +E++  T +  +   K    L K    D   +  FN ET+ I    + + AI I  
Sbjct: 968  TDFYMEEVPVTAIEVITKRKFAAPLGKVIKKDVAALNEFNAETNNILDGKTLKEAINIEK 1027

Query: 220  KGVQIHT--LKRYNLPDTV 236
            +G++IH   L R N+ D +
Sbjct: 1028 QGLKIHQILLDRTNIRDEI 1046

>YCL063W (VAC17) [485] chr3 (17290..18561) Protein required for
           vacuolar segregation, functions as a Myo2p receptor at
           the vacuole [1272 bp, 423 aa]
          Length = 423

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 204 VIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWN-PWIEKSQGMADF 251
           +I  N+S    + +  KG +   L+RYN  ++++ N P   KS  +  F
Sbjct: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSF 289

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,457,468
Number of extensions: 450658
Number of successful extensions: 1015
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1013
Number of HSP's successfully gapped: 14
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)