Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR020W (FMS1)50850026030.0
Scas_709.5055247815850.0
Sklu_2411.949747613750.0
Kwal_26.821450247713530.0
CAGL0M07612g58157111111e-146
KLLA0E07744g53348310331e-135
ABR057W52048410141e-133
YNL297C (MON2)163665674.5
KLLA0E11363g69097648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR020W
         (500 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...  1007   0.0  
Scas_709.50                                                           615   0.0  
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      534   0.0  
Kwal_26.8214                                                          525   0.0  
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...   432   e-146
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...   402   e-135
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...   395   e-133
YNL297C (MON2) [4315] chr14 complement(71671..76581) Protein inv...    30   4.5  
KLLA0E11363g complement(1000253..1002325) some similarities with...    29   8.8  

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/500 (96%), Positives = 482/500 (96%)

Query: 1   MNTVSPXXXXXXXXXXXXXXXXXXSTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYD 60
           MNTVSP                  STLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYD
Sbjct: 1   MNTVSPAKKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYD 60

Query: 61  IGASWHHDTLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDN 120
           IGASWHHDTLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDN
Sbjct: 61  IGASWHHDTLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDN 120

Query: 121 EMSKFAELEFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWK 180
           EMSKFAELEFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWK
Sbjct: 121 EMSKFAELEFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWK 180

Query: 181 LLSAKDTYFGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCED 240
           LLSAKDTYFGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCED
Sbjct: 181 LLSAKDTYFGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCED 240

Query: 241 GTVYNADYVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFE 300
           GTVYNADYVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFE
Sbjct: 241 GTVYNADYVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFE 300

Query: 301 FEECCWSNESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFF 360
           FEECCWSNESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFF
Sbjct: 301 FEECCWSNESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFF 360

Query: 361 VNLSKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRP 420
           VNLSKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRP
Sbjct: 361 VNLSKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRP 420

Query: 421 IENIANANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEH 480
           IENIANANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEH
Sbjct: 421 IENIANANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEH 480

Query: 481 TIMDGAGCAYGAWESGRREA 500
           TIMDGAGCAYGAWESGRREA
Sbjct: 481 TIMDGAGCAYGAWESGRREA 500

>Scas_709.50
          Length = 552

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/478 (59%), Positives = 361/478 (75%), Gaps = 5/478 (1%)

Query: 25  STLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTLTNPLFLEEAQLSLN 84
           STL+ NGI++CLV+EARDR+GGRL TV GY+G KYD+GA WHHDTL NPLFLEEA+    
Sbjct: 68  STLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLEEAEAMKK 127

Query: 85  DGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQHLGVSDCSFFQL 144
           D + RFVF+D  FIYID++RGR+DHD ++ LE VD E+ KF  LEF+Q L V DCSF+ +
Sbjct: 128 DSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVKDCSFYHI 187

Query: 145 VMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFALNYDSV 204
           ++KYLLQRR FLT+DQI++  Q+ RYLELWHG  W  LSAKDTYF HQGRNA   N+DSV
Sbjct: 188 ILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFDSV 247

Query: 205 VQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADYVIITVPQSVLNLSVQ- 263
           V RI  +FP++W++L+ EVK+I R+  KNV +    G  Y   Y I+T+PQSVL LS+Q 
Sbjct: 248 VNRIGDTFPKDWIRLNTEVKAIERD-GKNVLIKLSSGEEYICQYTIVTIPQSVLQLSLQL 306

Query: 264 -PEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVTLANSTNE 322
             E N +GRI+F+PPL P IQ+AF KIHFG LGKV+FEF++C WSNESS+I TLA+S   
Sbjct: 307 PDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTLAHSQEN 366

Query: 323 FVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNLSKSTGVASFMMLMQAPLTN 382
           FVE VR AE  + L   L+   SQ   +  CW  PL F+NL+KS G  + +MLMQ+PL+N
Sbjct: 367 FVEDVRKAETWEGLIDNLKTPSSQLFEN--CWDFPLLFINLAKSIGRPTLIMLMQSPLSN 424

Query: 383 HIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRPIENIANANKPVLRNIIVSNWTR 442
           +IESI  DK++++ FFQPVL+K+M  L S  VI+G+      A  N P+L+N++V+NW  
Sbjct: 425 YIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNLLVTNWNN 484

Query: 443 DPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAGCAYGAWESGRREA 500
           DPYSRGAYSACF GDD ++M++AMSNGQDSRIRFAGEHTIMDGAG  +G+WESGRRE 
Sbjct: 485 DPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRREG 542

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/476 (53%), Positives = 334/476 (70%), Gaps = 6/476 (1%)

Query: 25  STLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTLTNPLFLEEAQLSLN 84
           S L+      C+VLE+RDR+GGRL TV GY GRKYD+GASWHHDTL N LFLEE QL   
Sbjct: 21  SDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHHDTLMNGLFLEELQLPEQ 80

Query: 85  DGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQHLGVSDCSFFQL 144
           + RT FVFDDD+ I   E   R+DHD +L+LE++  E+ +F EL+F + L V D S+FQ+
Sbjct: 81  E-RTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIELQFFESLDVKDISYFQI 139

Query: 145 VMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFALNYDSV 204
           ++KYL QRR FL+++Q+++LPQL RYLELWHG+DWK LS K  +  HQGRNA  L+Y S+
Sbjct: 140 ILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYAHIDHQGRNAMVLHYSSI 199

Query: 205 VQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADYVIITVPQSVLNLSVQP 264
           V+R+A SFP+ WLKLS EV  + RE  K      E+   Y  DYV++TVPQS+L LS+  
Sbjct: 200 VKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFEE--TYVCDYVVVTVPQSILELSLHK 257

Query: 265 EKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVTLANSTNEFV 324
           E    GRIEF PPL   I ++F K+H+G LGKV+FEF++CCWS E +KI+++  +   F 
Sbjct: 258 EAR-TGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWSTERAKILSMGKTPEGFA 316

Query: 325 EIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNLSKSTGVASFMMLMQAPLTNHI 384
             VRNA +   L   L++ D+        W  PL+FVNL+K+TGV SF+MLMQ PLT ++
Sbjct: 317 RKVRNATDFCALVKELDK-DTSYELGNDPWDFPLYFVNLAKTTGVPSFVMLMQEPLTGYV 375

Query: 385 ESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRPIENIANANKPVLRNIIVSNWTRDP 444
           ES+ EDK  ++ +F+P+L  + K L S+  I       + A  N P+L+N+  +NWTR+P
Sbjct: 376 ESL-EDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENVPILKNVFTTNWTREP 434

Query: 445 YSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAGCAYGAWESGRREA 500
           YS GAYSACFP DDP+D ++A+  GQDS IRFAGEHT+MDGAGC YGAWESG+REA
Sbjct: 435 YSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCVYGAWESGKREA 490

>Kwal_26.8214
          Length = 502

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/477 (51%), Positives = 335/477 (70%), Gaps = 5/477 (1%)

Query: 25  STLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTLTNPLFLEEAQLSLN 84
           S LH+ G   C+V+EARDR+GGRL TV+GY+GRKYD+GASWHHDTL N LFLEE  L   
Sbjct: 20  SVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWHHDTLVNGLFLEEMGLPRE 79

Query: 85  DGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQHLGVSDCSFFQL 144
           + RT FVFDDD+ +  D+ RGRVD+D ++ LEI+  E+SK+ +L++ + L V D ++FQ 
Sbjct: 80  E-RTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYTQLQYFEDLEVEDVNYFQT 138

Query: 145 VMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFALNYDSV 204
           +MKYL +RR+ LT+DQI+YLPQL R++ELWHG+DWK  S+K     HQGRNAF LN+ ++
Sbjct: 139 IMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGLEIAHQGRNAFVLNFGNI 198

Query: 205 VQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADYVIITVPQSVLNLSVQP 264
            QR+A + PQ W +L  EV+ + +E  K V V+   G   + DYVI+T+PQS+L  S+QP
Sbjct: 199 AQRVASTIPQEWFELETEVREVKKEGEK-VLVSTSKGETISCDYVIVTIPQSILAHSLQP 257

Query: 265 EKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVTLANSTNEFV 324
           E   +GRIEF PPL   I+ + +  HFG LGKV+FEFE CCWS E S+ + L     +  
Sbjct: 258 EPR-KGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSKERSRALALGKPIVDLT 316

Query: 325 EIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNLSKSTGVASFMMLMQAPLTNHI 384
             +R A +L +L   L+ +    + +   W  PL FVNL+K T + SF+MLM  PLT +I
Sbjct: 317 SKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTDIPSFIMLMPNPLTEYI 376

Query: 385 ESIREDKERLFSFFQPVLNKIMKCLDS-EDVIDGMRPIENIANANKPVLRNIIVSNWTRD 443
           ESI+ DKE+L+ FF+P+L++++      E +I          +  KPVL+NI+ ++WT D
Sbjct: 377 ESIK-DKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEKKPVLKNILTTSWTGD 435

Query: 444 PYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAGCAYGAWESGRREA 500
            Y+ GAYSAC+PGDDP+++V+A+SN Q SRIRFAGEHTIMDGAGC YGAWESG+REA
Sbjct: 436 DYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGCVYGAWESGKREA 492

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score =  432 bits (1111), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 241/571 (42%), Positives = 334/571 (58%), Gaps = 113/571 (19%)

Query: 25  STLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTLTNPLFLEEAQLSLN 84
           S L Q+G + CLV+E+RDR+GGRL TVTGY G +YD+GASWHHDTLTN LF EE QL+  
Sbjct: 21  SVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAV 79

Query: 85  DGR-----------------------------------TRFVFDDDNFIYIDEERGRVDH 109
           DG                                      FVFDDD+ + +D+ RG +  
Sbjct: 80  DGADSTPQMFSGGATHCSASSASSASSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSL-- 137

Query: 110 DKELLLEIVDNEMSKFAELEFHQ---------------HLGV--SDCSFFQLVMKYLLQR 152
             ++ + ++ +E+ KF EL FH                H G   +D   F +++ YL QR
Sbjct: 138 -GDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQR 196

Query: 153 RQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFALNYDSVVQRIAQSF 212
             FLT+DQ+ Y  Q  RY+ELWHG+ W  LS++D++FGHQGRNAF +NYD++  RI    
Sbjct: 197 APFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQI 256

Query: 213 PQNW--LKLSCEVKSITREPSKNVTVNCEDGTVYNAD-------------------YVII 251
                 ++L+  V  I      + TV+    +   A+                   YVI+
Sbjct: 257 RTELGTVQLNSTVTKI-ENAGAHTTVSYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIV 315

Query: 252 TVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWSNESS 311
           T+PQS+L+          G +EF+PPL P I  A  K+HFG+LGKV+FEFEECCW   ++
Sbjct: 316 TIPQSLLS---------EGAVEFKPPLVPQISAALQKMHFGSLGKVVFEFEECCWDLHTA 366

Query: 312 KIVTLANSTN----EFVEIVR--------NAENLDELDSMLER---EDSQKHTSVTCWSQ 356
           KIV +A++      EF  ++R         A+ L  L   +++   +D+ +H    CW+Q
Sbjct: 367 KIVAVAHAAADTRAEFTALLRKESREKNYTAQRLQALVQDVKQLLGDDAVRHD---CWNQ 423

Query: 357 PLFFVNLSKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMK-CLDSEDVI 415
           PL FVN++K+TGV S MMLM  PLT++IES+  D  +++ FF+PVL++IM  C     +I
Sbjct: 424 PLLFVNMAKTTGVPSLMMLMAPPLTHYIESLH-DSHQVYEFFKPVLSQIMSVCNAPGHII 482

Query: 416 DGMRPIENIA--NAN----KPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNG 469
           +G+     +A  +AN     P+LRN+IV++WT DPYS+GAYSAC+ GDD +DM +AMSNG
Sbjct: 483 NGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALDMFLAMSNG 542

Query: 470 QDSRIRFAGEHTIMDGAGCAYGAWESGRREA 500
           Q SR+RFAGEHTI+DGAGCAYGAWESG REA
Sbjct: 543 QSSRVRFAGEHTILDGAGCAYGAWESGEREA 573

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score =  402 bits (1033), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/483 (45%), Positives = 313/483 (64%), Gaps = 21/483 (4%)

Query: 25  STLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTLTNPLFLEEAQLSLN 84
           S L ++GI+  + +E+RDRVGGRL T  G  G KYDIG SWHHDTL+N LF+EE  L  +
Sbjct: 52  SDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHDTLSNGLFMEEMSLPES 110

Query: 85  DGRTRFVFDD-DNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQHLGVSDCSFFQ 143
           + R  FVFDD D    +D++ G ++ D+   LE +  E  K+ E+ ++  L V D S+FQ
Sbjct: 111 E-RAGFVFDDEDRACLVDKKLGVLEVDQ---LECLAYEFEKWVEMRYYDSLDVEDVSYFQ 166

Query: 144 LVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFALNYDS 203
           L +++   R++FLT++Q+ +LPQL RY+ELWHG+DW  LS K +   H GRNA  L+YD 
Sbjct: 167 LCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDK 226

Query: 204 VVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADYVIITVPQSVLNLSVQ 263
           ++ RI+    ++ + LS  V  I +  +    VN + G  Y  DY I+TVPQSVL +S +
Sbjct: 227 ILARISNPV-KDKIHLSESVNLIKKLSNGKYQVNTDKGK-YLCDYCIVTVPQSVLAISCE 284

Query: 264 PEKN-----LRGRIEFQPPLKPVIQDAF-DKIHFGALGKVIFEFEECCWSNESSKIVTLA 317
            E+N      + RI F+PPL   I +A   K  FG+LGKVIFEF+   WS  S +I+T+ 
Sbjct: 285 QEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVH 344

Query: 318 NSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNLSKSTGVASFMMLMQ 377
               +FVE +R+A++L  L   +E++  + H     W  P  F+NL+K T  ASF+ L+Q
Sbjct: 345 EQPTDFVESIRSAKDLKTLLKDIEQKLPRSHED--SWKNPTCFLNLAKHTDTASFVALIQ 402

Query: 378 APLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRPIENIANANKPVLRNIIV 437
            P+T +IE++  ++     FF+PVLNK++  L S D I  +   + +  +  P+L+NI+ 
Sbjct: 403 QPVTEYIETLTTEEVE--EFFRPVLNKLLNSLGSSDYISDLN--DEVKESKTPILKNILT 458

Query: 438 SNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAGCAYGAWESGR 497
           SNW+ DP+S GAYSAC PGDDP+D+V+A++ GQ   +RFAGEHTIMDGAGCAYGAWESG+
Sbjct: 459 SNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEHTIMDGAGCAYGAWESGK 517

Query: 498 REA 500
           REA
Sbjct: 518 REA 520

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score =  395 bits (1014), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 202/484 (41%), Positives = 295/484 (60%), Gaps = 18/484 (3%)

Query: 25  STLHQNGIQDCLVLEARDRVGGRLQTVTG--YQGRKYDIGASWHHDTLTNPLFLEEAQLS 82
           + LH  GI+ C+VLEAR R GGRL  V    + GR+YD+GASWHHDTL+N LF EE +L 
Sbjct: 26  AELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASWHHDTLSNELFAEELRLP 85

Query: 83  LNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQHLGVSDCSFF 142
             + R  +VFDD   + +     R+D D  L+LE +  E+  + E ++ + L   D  FF
Sbjct: 86  EAE-RAGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYIEEQYFESLEARDMPFF 144

Query: 143 QLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTYFGHQGRNAFALNYD 202
           +LVM YL +RR  LT+DQI+ LP   R+ E WH +DWKLLSAK +   + GRNAF LNYD
Sbjct: 145 ELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKLSEVENNGRNAFVLNYD 204

Query: 203 SVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADYVIITVPQSVLNLSV 262
            +++R+    P+ W++L   V  I R     V +   DG  Y +   I+TVPQSVL LS+
Sbjct: 205 KLLRRVESGVPREWIRLGTRVTKIERV-RDTVHITTADGACYVSKCAIVTVPQSVLELSL 263

Query: 263 QPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVTLANSTNE 322
           +PE+ + GRIEF+PPL   I  AF++ H+ +LGK+ FEF++C W  +  ++   A   ++
Sbjct: 264 KPER-VPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDTQRPRVAIAAKVPDD 322

Query: 323 FVEIVRNAENLDELDSMLEREDSQKHTSVT--CWSQPLFFVNLSKSTGVASFMMLMQAPL 380
           F   VR A++L EL   L    +Q    +   C+  P  F N+    G+ + +   Q PL
Sbjct: 323 FSAQVRKAQDLQEL---LRSASAQTEVKLGQDCFDFPQEFQNMVALAGIPTLIAFTQTPL 379

Query: 381 TNHIESIREDKERLFSFFQPVLNKIMKCLDSEDV----IDGMRPIENIANANKPVLRNII 436
           T H+E  R  K+ +  +F+P +   ++ L S++     +   +P ++  +   P+L+N+I
Sbjct: 380 TEHVE--RLSKQEIVDYFKPAIVVALRALGSKEECLFDLGNTQPQDD--SHPGPILKNVI 435

Query: 437 VSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAGCAYGAWESG 496
            + W++D YSRG+Y+     DD + + VA++NGQDSRIRFAGEHT+M+G GC YGAWESG
Sbjct: 436 FNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNGCTYGAWESG 495

Query: 497 RREA 500
           RREA
Sbjct: 496 RREA 499

>YNL297C (MON2) [4315] chr14 complement(71671..76581) Protein involved
            in vacuolar morphology and trafficking, has low
            similarity to uncharacterized C. albicans orf6.6051 [4911
            bp, 1636 aa]
          Length = 1636

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 190  GHQGRNAFALNYDSVVQRIA--QSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNAD 247
             +  +NA  LNY ++++ I   +  P + LK  CE+ +       +++ N    T Y+  
Sbjct: 1138 SNNTKNAVILNYQTLLKEIITIEDVPSDILKKCCEIFTDYNITYSDLSTNASSKTEYDCI 1197

Query: 248  YVIIT 252
            Y +IT
Sbjct: 1198 YELIT 1202

>KLLA0E11363g complement(1000253..1002325) some similarities with
           sp|P38259 Saccharomyces cerevisiae YBR100w questionable
           ORF singleton, hypothetical start
          Length = 690

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 11/97 (11%)

Query: 335 ELDSMLEREDSQKHTSVTCWSQPLFFVNLSKSTGVASFMMLMQAPLTNHIESIREDKERL 394
           E DS++   D     + T   +PLF  + S+ST V+S  + ++ P   H+E  + DK + 
Sbjct: 288 EHDSIVIESDEDDDITNTRQEKPLFVQHSSQSTPVSSNKLALRQP--RHVEDEKIDKVKP 345

Query: 395 FSFFQPVLNK-----IMKCLDSEDVIDGMRPIENIAN 426
               +P  ++     + KCL + +    MR + N  N
Sbjct: 346 MVNARPFTDQEYSEMVKKCLGTSE----MRKLYNECN 378

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,218,280
Number of extensions: 724024
Number of successful extensions: 1940
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1960
Number of HSP's successfully gapped: 16
Length of query: 500
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 394
Effective length of database: 12,926,601
Effective search space: 5093080794
Effective search space used: 5093080794
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)