Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR019W (STB4)94993346350.0
Scas_709.5175956115750.0
Sklu_2411.1168756514060.0
Kwal_26.820065256611161e-140
CAGL0G08844g847681402e-08
YIL130W964521331e-07
Sklu_1993.2823651322e-07
Kwal_23.4754812371303e-07
KLLA0F04609g916371303e-07
Scas_662.8906371303e-07
Scas_661.23741891269e-07
YGL013C (PDR1)1068791261e-06
AER370W801401251e-06
CAGL0F09229g835481251e-06
Scas_630.14701751251e-06
Kwal_26.7095838621251e-06
YJL206C758721241e-06
CAGL0I07755g1053731251e-06
Kwal_56.23058775941242e-06
Kwal_47.17506924421232e-06
Scas_702.71113391223e-06
AER183C879541213e-06
CAGL0F02519g832421214e-06
KLLA0A09119g1082561205e-06
Scas_663.12944631196e-06
CAGL0F07865g8441041196e-06
KLLA0C03201g650481187e-06
CAGL0F07909g1049781189e-06
Kwal_23.65375523571171e-05
KLLA0A04169g7751001171e-05
Sklu_2335.6940481171e-05
Scas_518.5919991152e-05
KLLA0A02585g370341132e-05
CAGL0A00451g1107421143e-05
ABL099W800781133e-05
Scas_542.8902301134e-05
KLLA0C19228g591441114e-05
Scas_638.141043441115e-05
Sklu_2082.18243996e-05
KLLA0F02750g1148831116e-05
Scas_637.7998531107e-05
KLLA0F19602g603921107e-05
YBR150C (TBS1)1094481107e-05
YER184C794451099e-05
KLLA0E02618g11091011091e-04
Kwal_56.22605865441091e-04
YKL038W (RGT1)1170621072e-04
YBR297W (MAL33)468331043e-04
Sklu_1622.2778451044e-04
YNR063W607361044e-04
CAGL0L03377g1209591044e-04
YOR363C (PIP2)996691034e-04
YOR380W (RDR1)546571035e-04
YDR034C (LYS14)790621026e-04
AGR061C612621026e-04
KLLA0F22880g1164661027e-04
KLLA0A03421g880591027e-04
KLLA0C18953g703571018e-04
YGR288W (MAL13)473751009e-04
CAGL0A00583g646521009e-04
KLLA0F09559g658671000.001
Scas_702.7d978421000.001
Scas_625.51141821000.001
KLLA0C14212g1040421000.001
CAGL0L01903g1287891000.001
KLLA0C17050g95567990.001
YOL089C (HAL9)103065990.001
AGL091W86676990.002
YBL005W (PDR3)97655990.002
Scas_669.863740980.002
KLLA0C10923g77583980.002
Kwal_47.1768185447980.002
CAGL0K11902g83153970.002
Scas_610.980997970.002
ADR199C94450970.002
ADR365W70185960.003
AFR096W85258960.003
CAGL0J07150g102269960.003
KLLA0D01452g144546960.003
YML076C (WAR1)94483960.003
Sklu_2064.292271960.004
YJL089W (SIP4)82994950.004
YKL015W (PUT3)97944950.004
YDR213W (UPC2)913101950.004
YLR228C (ECM22)81492950.004
CAGL0M12298g99485940.005
KLLA0E18194g86534940.005
Scas_556.6102282940.005
YOR337W (TEA1)75957940.006
Sklu_2384.683144940.006
Sklu_2434.1098356940.006
Kwal_23.312278883940.006
Kwal_23.351457931930.007
Kwal_14.91582253930.007
YAL051W (OAF1)106258930.007
KLLA0F14322g71746920.009
YPR196W47033920.009
Scas_679.2677590920.011
Scas_234.133739900.011
AFR081C48272910.011
ABL121C128546920.011
YPL248C (GAL4)88137910.012
AFR117C115244910.012
ADR403C97053910.013
AFL200W59652900.015
CAGL0B03421g135542910.015
Kwal_27.10232120946910.015
Sklu_2321.3906121900.015
CAGL0E05434g816101900.016
Kwal_26.680594451900.016
KLLA0F13904g57975900.017
KLLA0A03443g97558900.018
ACL096W83549890.019
YMR168C (CEP3)60877890.019
YFL052W46534890.020
Kwal_14.2619116745890.020
KLLA0F04213g76856890.023
KLLA0A01804g94571890.023
KLLA0F25630g100761890.023
CAGL0M03025g1254108890.024
AFR171W61265880.024
Sklu_2296.691958880.025
Scas_564.9*60970880.026
Kwal_23.642573553880.027
YOR162C (YRR1)81061880.028
Scas_696.44116477880.028
KLLA0D00396g36147870.029
Kwal_23.437069285880.031
AGL233C87240870.033
YMR280C (CAT8)143334880.033
Kwal_34.1575162870870.034
KLLA0A09251g68873870.035
KLLA0F22990g125398870.035
Kwal_26.673267652870.035
Kwal_55.2188488274870.035
YLR451W (LEU3)88682870.037
Scas_703.2989467870.041
Sklu_2023.365865860.042
Sklu_2207.453244860.044
YDR303C (RSC3)88541860.045
Sklu_2191.271846860.049
Kwal_26.701465460860.049
KLLA0D12672g86567860.053
Scas_449.163655850.053
CAGL0L03674g62951850.054
CAGL0L09691g82460860.054
AGL083W85647860.055
ADR405C80760850.061
Kwal_47.1693966977850.064
YHR056C (RSC30)88338850.068
Scas_699.793552850.071
YKR064W86336840.078
KLLA0D05038g67359840.085
CAGL0H00396g94065840.086
Sklu_2376.692231840.090
YJL103C61829830.090
AAL175W88364840.091
ACR028C60133830.094
Scas_715.3111590840.098
Scas_573.4147862840.10
Scas_711.1850953830.11
YOR172W (YRM1)78679830.11
CAGL0L04400g98732830.11
Kwal_33.1393479760830.12
YKL222C70561820.12
Kwal_8.58063853820.13
KLLA0D10153g65540820.15
Scas_688.1776956820.16
CAGL0D02904g88794820.16
CAGL0F07755g61128810.18
Kwal_47.1756562841810.18
CAGL0C01199g92246810.19
CAGL0K05841g137230810.19
YLR256W (HAP1)150232810.19
YBR240C (THI2)45050800.19
YLR098C (CHA4)64895810.19
Kwal_27.968884141810.20
YML099C (ARG81)88053810.21
Scas_626.683941810.21
Scas_711.3193247810.21
Kwal_14.77866582800.21
CAGL0L04576g86555800.22
AGL361C69671800.26
Kwal_56.2456675567800.26
AFL033W38242790.26
YDR421W (ARO80)95041800.29
KLLA0E14036g67864790.30
KLLA0C08657g72250790.31
YHR178W (STB5)74349790.31
Scas_680.2573846790.34
CAGL0M05907g89136790.35
YLR278C134161790.35
CAGL0D03850g83438790.37
Scas_674.12*90939780.38
Scas_526.3110976790.39
KLLA0A06039g65739780.40
Scas_721.9486976780.44
Scas_597.2540128780.45
YLR266C (PDR8)70147780.45
CAGL0G09757g142380780.50
Scas_709.65*65196770.50
KLLA0D09977g63450770.51
KLLA0D10593g92562770.51
Scas_588.1183536770.53
AAL057C80941770.62
AFL160C64840760.65
KLLA0C04620g126967770.65
Scas_691.3290665760.66
KLLA0F02387g72760760.69
KLLA0B04422g35376750.73
KLLA0F18084g86046760.78
AGL099C74748760.79
KLLA0B04620g91964760.80
Scas_720.5889067760.80
ACR107W38432750.83
Sklu_2330.280969750.85
Scas_717.3390458750.87
Sklu_2301.151745750.87
Kwal_26.810997040750.89
CAGL0I02552g100541750.90
Sklu_2397.884841751.1
CAGL0H01507g79441741.1
Scas_700.4040733741.2
Sklu_1973.177741741.2
CAGL0H06875g70234741.3
Scas_659.1075728741.3
YDR207C (UME6)83636731.6
KLLA0F20680g78753731.6
KLLA0D11286g67880731.6
KLLA0D10197g85644731.7
Kwal_14.163645659721.9
Kwal_23.290588152722.0
AGR369W105166722.3
KLLA0E20405g113885722.3
Kwal_55.2067425258702.3
YLR014C (PPR1)90452722.3
ACL058W81730722.4
YCR106W (RDS1)83240722.5
CAGL0M11440g57593712.6
Kwal_47.1723394837712.7
KLLA0F10373g34836702.7
Kwal_14.163144343703.0
KLLA0F10417g50731703.1
Sklu_1373.260837703.2
Kwal_23.652959836703.2
AFL031W51760703.6
ACL195C10937653.6
ADR404C87555703.6
Scas_590.2117237703.7
Scas_710.1043733694.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR019W
         (933 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...  1790   0.0  
Scas_709.51                                                           611   0.0  
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement     546   0.0  
Kwal_26.8200                                                          434   e-140
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    59   2e-08
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    56   1e-07
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         55   2e-07
Kwal_23.4754                                                           55   3e-07
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    55   3e-07
Scas_662.8                                                             55   3e-07
Scas_661.23                                                            53   9e-07
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    53   1e-06
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    53   1e-06
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    53   1e-06
Scas_630.14                                                            53   1e-06
Kwal_26.7095                                                           53   1e-06
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    52   1e-06
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    53   1e-06
Kwal_56.23058                                                          52   2e-06
Kwal_47.17506                                                          52   2e-06
Scas_702.7                                                             52   3e-06
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    51   3e-06
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    51   4e-06
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    51   5e-06
Scas_663.12                                                            50   6e-06
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    50   6e-06
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    50   7e-06
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    50   9e-06
Kwal_23.6537                                                           50   1e-05
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    50   1e-05
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          50   1e-05
Scas_518.5                                                             49   2e-05
KLLA0A02585g complement(226562..227674) some similarities with c...    48   2e-05
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    49   3e-05
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    48   3e-05
Scas_542.8                                                             48   4e-05
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    47   4e-05
Scas_638.14                                                            47   5e-05
Sklu_2082.1 YER184C, Contig c2082 2025-2273                            43   6e-05
KLLA0F02750g complement(250368..253814) some similarities with s...    47   6e-05
Scas_637.7                                                             47   7e-05
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    47   7e-05
YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein wit...    47   7e-05
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    47   9e-05
KLLA0E02618g 244696..248025 no similarity, hypothetical start          47   1e-04
Kwal_56.22605                                                          47   1e-04
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    46   2e-04
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    45   3e-04
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            45   4e-04
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    45   4e-04
CAGL0L03377g complement(382932..386561) some similarities with s...    45   4e-04
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    44   4e-04
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    44   5e-04
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    44   6e-04
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    44   6e-04
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    44   7e-04
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    44   7e-04
KLLA0C18953g 1682246..1684357 weakly similar to sp|P36598|Q9UTJ9...    44   8e-04
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    43   9e-04
CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomy...    43   9e-04
KLLA0F09559g complement(876719..878695) some similarities with s...    43   0.001
Scas_702.7d                                                            43   0.001
Scas_625.5                                                             43   0.001
KLLA0C14212g complement(1229219..1232341) some similarities with...    43   0.001
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    43   0.001
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    43   0.001
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    43   0.001
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    43   0.002
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    43   0.002
Scas_669.8                                                             42   0.002
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    42   0.002
Kwal_47.17681                                                          42   0.002
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    42   0.002
Scas_610.9                                                             42   0.002
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    42   0.002
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    42   0.003
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    42   0.003
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    42   0.003
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    42   0.003
YML076C (WAR1) [3893] chr13 complement(112513..115347) Transcrip...    42   0.003
Sklu_2064.2 , Contig c2064 873-3641                                    42   0.004
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    41   0.004
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    41   0.004
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    41   0.004
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    41   0.004
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    41   0.005
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    41   0.005
Scas_556.6                                                             41   0.005
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    41   0.006
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          41   0.006
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         41   0.006
Kwal_23.3122                                                           41   0.006
Kwal_23.3514                                                           40   0.007
Kwal_14.915                                                            40   0.007
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    40   0.007
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    40   0.009
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    40   0.009
Scas_679.26                                                            40   0.011
Scas_234.1                                                             39   0.011
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    40   0.011
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    40   0.011
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    40   0.012
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    40   0.012
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    40   0.013
AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH] complement(...    39   0.015
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    40   0.015
Kwal_27.10232                                                          40   0.015
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           39   0.015
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    39   0.016
Kwal_26.6805                                                           39   0.016
KLLA0F13904g complement(1287758..1289497) some similarities with...    39   0.017
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    39   0.018
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    39   0.019
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    39   0.019
YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong...    39   0.020
Kwal_14.2619                                                           39   0.020
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    39   0.023
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    39   0.023
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    39   0.023
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    39   0.024
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    39   0.024
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       39   0.025
Scas_564.9*                                                            39   0.026
Kwal_23.6425                                                           39   0.027
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    39   0.028
Scas_696.44                                                            39   0.028
KLLA0D00396g complement(36277..37362) some similarities with ca|...    38   0.029
Kwal_23.4370                                                           39   0.031
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    38   0.033
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    39   0.033
Kwal_34.15751                                                          38   0.034
KLLA0A09251g 808253..810319 some similarities with sp|P38699 Sac...    38   0.035
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    38   0.035
Kwal_26.6732                                                           38   0.035
Kwal_55.21884                                                          38   0.035
YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription fac...    38   0.037
Scas_703.29                                                            38   0.041
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         38   0.042
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         38   0.044
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    38   0.045
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         38   0.049
Kwal_26.7014                                                           38   0.049
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    38   0.053
Scas_449.1                                                             37   0.053
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    37   0.054
CAGL0L09691g complement(1039799..1042273) some similarities with...    38   0.054
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    38   0.055
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    37   0.061
Kwal_47.16939                                                          37   0.064
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    37   0.068
Scas_699.7                                                             37   0.071
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    37   0.078
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    37   0.085
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    37   0.086
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              37   0.090
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    37   0.090
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...    37   0.091
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    37   0.094
Scas_715.3                                                             37   0.098
Scas_573.4                                                             37   0.10 
Scas_711.18                                                            37   0.11 
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    37   0.11 
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    37   0.11 
Kwal_33.13934                                                          37   0.12 
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    36   0.12 
Kwal_8.580                                                             36   0.13 
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    36   0.15 
Scas_688.17                                                            36   0.16 
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    36   0.16 
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    36   0.18 
Kwal_47.17565                                                          36   0.18 
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    36   0.19 
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    36   0.19 
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    36   0.19 
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    35   0.19 
YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-fing...    36   0.19 
Kwal_27.9688                                                           36   0.20 
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...    36   0.21 
Scas_626.6                                                             36   0.21 
Scas_711.31                                                            36   0.21 
Kwal_14.778                                                            35   0.21 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    35   0.22 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    35   0.26 
Kwal_56.24566                                                          35   0.26 
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    35   0.26 
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    35   0.29 
KLLA0E14036g complement(1239566..1241602) some similarities with...    35   0.30 
KLLA0C08657g 757100..759268 some similarities with ca|CA3551|IPF...    35   0.31 
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    35   0.31 
Scas_680.25                                                            35   0.34 
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    35   0.35 
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    35   0.35 
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    35   0.37 
Scas_674.12*                                                           35   0.38 
Scas_526.3                                                             35   0.39 
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    35   0.40 
Scas_721.94                                                            35   0.44 
Scas_597.2                                                             35   0.45 
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    35   0.45 
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    35   0.50 
Scas_709.65*                                                           34   0.50 
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    34   0.51 
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    34   0.51 
Scas_588.11                                                            34   0.53 
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    34   0.62 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    34   0.65 
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    34   0.65 
Scas_691.32                                                            34   0.66 
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    34   0.69 
KLLA0B04422g 394524..395585 similar to sp|P25335 Saccharomyces c...    33   0.73 
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    34   0.78 
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    34   0.79 
KLLA0B04620g complement(413129..415888) some similarities with s...    34   0.80 
Scas_720.58                                                            34   0.80 
ACR107W [1154] [Homologous to ScYPL133C - SH] complement(544402....    33   0.83 
Sklu_2330.2 YML076C, Contig c2330 2931-5360                            33   0.85 
Scas_717.33                                                            33   0.87 
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                33   0.87 
Kwal_26.8109                                                           33   0.89 
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    33   0.90 
Sklu_2397.8 YML099C, Contig c2397 9784-12330                           33   1.1  
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    33   1.1  
Scas_700.40                                                            33   1.2  
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          33   1.2  
CAGL0H06875g complement(682518..684626) some similarities with s...    33   1.3  
Scas_659.10                                                            33   1.3  
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    33   1.6  
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    33   1.6  
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    33   1.6  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    33   1.7  
Kwal_14.1636                                                           32   1.9  
Kwal_23.2905                                                           32   2.0  
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    32   2.3  
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    32   2.3  
Kwal_55.20674                                                          32   2.3  
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    32   2.3  
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    32   2.4  
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    32   2.5  
CAGL0M11440g complement(1125748..1127475) similar to sp|P43634 S...    32   2.6  
Kwal_47.17233                                                          32   2.7  
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    32   2.7  
Kwal_14.1631                                                           32   3.0  
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...    32   3.1  
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            32   3.2  
Kwal_23.6529                                                           32   3.2  
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    32   3.6  
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    30   3.6  
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    32   3.6  
Scas_590.2                                                             32   3.7  
Scas_710.10                                                            31   4.2  
Kwal_27.10852                                                          32   4.3  
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    31   4.4  
KLLA0E19701g complement(1739869..1741914) some similarities with...    31   4.7  
YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with simil...    31   4.9  
KLLA0F10835g 997512..999782 no similarity, hypothetical start          31   5.6  
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         31   5.7  
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    31   6.5  
Kwal_47.16862                                                          31   6.5  
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    31   6.6  
KLLA0F00572g complement(42710..44503) some similarities with ca|...    31   6.9  
Kwal_26.7448                                                           31   7.1  
KLLA0D00484g 44879..47893 no similarity, hypothetical start            31   7.1  
Kwal_47.18089                                                          30   7.6  
Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement         30   7.7  
Kwal_55.20722                                                          30   7.9  
Scas_596.4                                                             30   8.6  
Kwal_14.819                                                            30   9.8  
Kwal_26.8662                                                           30   9.9  

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 1790 bits (4635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 873/933 (93%), Positives = 873/933 (93%)

Query: 1   MSINHEIYYILVFEHRSVAIKXXXXXXXXXQFFLARSRQIDRTWAHTNRKERFREMTAIG 60
           MSINHEIYYILVFEHRSVAIK         QFFLARSRQIDRTWAHTNRKERFREMTAIG
Sbjct: 1   MSINHEIYYILVFEHRSVAIKLIIVVIVLLQFFLARSRQIDRTWAHTNRKERFREMTAIG 60

Query: 61  NTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKAT 120
           NTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKAT
Sbjct: 61  NTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKAT 120

Query: 121 NRKRRRRQVASAVRDVSKTYAETSESFPRDLLSKSNIIINAXXXXXXXXXXXXXXXXXXX 180
           NRKRRRRQVASAVRDVSKTYAETSESFPRDLLSKSNIIINA                   
Sbjct: 121 NRKRRRRQVASAVRDVSKTYAETSESFPRDLLSKSNIIINAPSDGVSSSASNSPNPNSHY 180

Query: 181 XXXXXTLPFMSGRPNHTFHXXXXXXXXXXXXXFPEDHMAKLLLQLSSKLGNTTKESSIRT 240
                TLPFMSGRPNHTFH             FPEDHMAKLLLQLSSKLGNTTKESSIRT
Sbjct: 181 HHISSTLPFMSGRPNHTFHSGSNLNGENNNNSFPEDHMAKLLLQLSSKLGNTTKESSIRT 240

Query: 241 TRTNASDVNANPTVVNMKNSQEDCDTNHRSAICDSAEALHXXXXXXXXXXXXXXQITNTV 300
           TRTNASDVNANPTVVNMKNSQEDCDTNHRSAICDSAEALH              QITNTV
Sbjct: 241 TRTNASDVNANPTVVNMKNSQEDCDTNHRSAICDSAEALHNNNINSKENKIINSQITNTV 300

Query: 301 NDHFESPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNL 360
           NDHFESPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNL
Sbjct: 301 NDHFESPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNL 360

Query: 361 SGGHYLKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATF 420
           SGGHYLKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATF
Sbjct: 361 SGGHYLKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATF 420

Query: 421 WQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFE 480
           WQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFE
Sbjct: 421 WQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFE 480

Query: 481 EKSILIKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALS 540
           EKSILIKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALS
Sbjct: 481 EKSILIKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALS 540

Query: 541 QAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMC 600
           QAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMC
Sbjct: 541 QAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMC 600

Query: 601 EQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWY 660
           EQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWY
Sbjct: 601 EQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWY 660

Query: 661 DTFIVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYVVD 720
           DTFIVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYVVD
Sbjct: 661 DTFIVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYVVD 720

Query: 721 TELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKAIMQ 780
           TELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKAIMQ
Sbjct: 721 TELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKAIMQ 780

Query: 781 SCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDDTPN 840
           SCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDDTPN
Sbjct: 781 SCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDDTPN 840

Query: 841 RNKFEQFKKVGDNDADVEVDAGEREENADERQENPHNNSKRVPLATRSHNTTNFDGSIAI 900
           RNKFEQFKKVGDNDADVEVDAGEREENADERQENPHNNSKRVPLATRSHNTTNFDGSIAI
Sbjct: 841 RNKFEQFKKVGDNDADVEVDAGEREENADERQENPHNNSKRVPLATRSHNTTNFDGSIAI 900

Query: 901 SPESAVANLGTDTGLPSDVLDTVSKIGNSPNVF 933
           SPESAVANLGTDTGLPSDVLDTVSKIGNSPNVF
Sbjct: 901 SPESAVANLGTDTGLPSDVLDTVSKIGNSPNVF 933

>Scas_709.51
          Length = 759

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/561 (51%), Positives = 386/561 (68%), Gaps = 32/561 (5%)

Query: 306 SPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNLSGGHY 365
           SPWQ+FS DKYRFHRRYQN+LP   G S+L  L PQ I+   L+ PR+QNY WN+SGGHY
Sbjct: 146 SPWQSFSYDKYRFHRRYQNVLPNKFGKSLLSALPPQLIQENNLETPRIQNYAWNMSGGHY 205

Query: 366 LKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATFWQQYN 425
           LK++   +  E N      FF+FD+P+HLS + KLL +YF +IN  + IIHE  FW Q+N
Sbjct: 206 LKFE---QMHENN--SSLLFFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEMFWNQFN 260

Query: 426 NKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITF-EEKSI 484
           N FL+QGKQNN SA LFTSMLYL+L+ ++RF EG             +SL+  F  ++  
Sbjct: 261 NGFLQQGKQNNKSAKLFTSMLYLVLTISIRFYEG----------LPASSLDQLFTPQEQE 310

Query: 485 LIKKPSI---EENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALSQ 541
           L+ +  I   EE +F +AY I++ LTFEWESFELIQSWLLI FY RTCYRQ +CWNALS+
Sbjct: 311 LVHRQRILRNEEYMFGHAYSIVSKLTFEWESFELIQSWLLIAFYLRTCYRQISCWNALSR 370

Query: 542 AVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMCE 601
           A+NMCNGMSLYLN+FPE+HSTYDE KAWHCFW CFIMDKLISFQ+GR YQLS+P + M +
Sbjct: 371 AINMCNGMSLYLNRFPEVHSTYDEVKAWHCFWSCFIMDKLISFQLGRLYQLSMPVTNMNQ 430

Query: 602 QMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWYD 661
             N           D WFH+ET Q+  LS IV  F K++AQ+L++ E++QLR ++ +W D
Sbjct: 431 PTN----------PDTWFHDETIQLFQLSKIVMDFQKKEAQELDIQESLQLRGEMDKWLD 480

Query: 662 TFIVGSQTNAYDD---NYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYV 718
            F+   + N+        +  YQ+QPF++YLDIR+TFE+R LFCLI P S  +  S  + 
Sbjct: 481 NFMKSQEDNSSSSLLFTNQPLYQLQPFLSYLDIRVTFELRYLFCLINPPSYTSPLSYTFP 540

Query: 719 VDTELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKAI 778
           +D   LI HCQ++++ L  I   + FFVPWWLNLSQLF++ L+ ++ +HAGI       I
Sbjct: 541 IDIPSLIKHCQLSLDLLTGINSKDFFFVPWWLNLSQLFSIGLVSVVLIHAGIETVAMTTI 600

Query: 779 MQSCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDDT 838
           +    ++W++LE + PKN P MLP+CLWC++MLN M CIRL  S  +  + +G   GD++
Sbjct: 601 LDKSMKLWQSLETASPKNPPVMLPQCLWCIRMLNQMCCIRLSLSQSKFASIVGEHGGDNS 660

Query: 839 PNRNKFEQFKKVGDNDADVEV 859
            N+NKF QF KVG+N+ + ++
Sbjct: 661 HNKNKFSQFGKVGENEDETDI 681

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 54/89 (60%), Gaps = 8/89 (8%)

Query: 64  DALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRK 123
           +A+D +   S E  K R+RVQ+AC +CK+RKVKCDGN PCLNC K + +C Y+  ++N  
Sbjct: 14  NAMDNT---SPERKKQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYN-NSSNTT 69

Query: 124 RRRRQVASAVRDVSKTYAETSESFPRDLL 152
           ++      A  D     AE+S   P +LL
Sbjct: 70  KKEPNDPPADIDA----AESSTMSPPNLL 94

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/565 (49%), Positives = 364/565 (64%), Gaps = 39/565 (6%)

Query: 306 SPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNLSGGHY 365
           SPWQTFSLDKYRFHRRYQN+LPYYLG S+++ L PQTI++  LK PRVQNYGWN+SGGHY
Sbjct: 118 SPWQTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHY 177

Query: 366 LKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATFWQQYN 425
           LK   D               +FDDPV L ++NKLLR+YFD +NPVFSI+HE  F QQ+N
Sbjct: 178 LKNGSD---------SSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFN 228

Query: 426 NKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFEEKSIL 485
             FL   K+ NSS  LF SMLYLIL+T+LRF EG+   Q     +S   L+  F+  S  
Sbjct: 229 TGFL--NKRRNSS-KLFISMLYLILATSLRFYEGY--SQSQPVAFSQHQLDWLFKTNS-- 281

Query: 486 IKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALSQAVNM 545
               S+EE LF +A+ I++ L+FEWESFELIQSWLLI FY RTC+RQT+CWNAL  A+ M
Sbjct: 282 ----SLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRM 337

Query: 546 CNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMCEQMNL 605
           C GM+LYLN+FP+ H+ Y+E+K  +CFW CFIMDK+ISFQMGR+  LSLPA +M      
Sbjct: 338 CKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPD-- 395

Query: 606 VKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWYDTFIV 665
                  +  D WFHEET QM  LS+I++   KRD +DL++NE   L+ +L  W+  F  
Sbjct: 396 -------RNPDGWFHEETIQMYRLSLIISDCQKRDGEDLSVNEVQILKQRLTNWFRFFT- 447

Query: 666 GSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYVVDTELLI 725
                     +   Y  Q   TYLDI LT  +R LF LI P    +      ++D   L+
Sbjct: 448 ---------PHETLYSKQVLFTYLDISLTLGIRGLFQLINPPVITDVTPPALLLDLSSLL 498

Query: 726 SHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKAIMQSCQEI 785
           ++ +  +++L  + +SN  F+PWWLNLS LF V++ CI  LHAG+ + Q +++++    I
Sbjct: 499 ANSRTFLDSLETVEKSNELFIPWWLNLSLLFAVSVSCITVLHAGLKLQQAQSLLRQSFSI 558

Query: 786 WRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDDTPNRNKFE 845
           W +L     KN P M  ECLWCLKMLNHM C+RL+ S   L    G DHGD + N+N+F 
Sbjct: 559 WNSLVSLHAKNPPEMAKECLWCLKMLNHMSCLRLQTSMQNLRQIFGIDHGDSSLNKNRFA 618

Query: 846 QFKKVGDNDADVEVDAGEREENADE 870
           QF K GDN+ D +V+ G+ + +  +
Sbjct: 619 QFGKAGDNEEDNDVELGQEDAHTKD 643

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 1/49 (2%)

Query: 73  SKENG-KGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKAT 120
            K+NG K RLRV+KACE+CKKRK+KCDG+ PC +C+K+  +C Y F  T
Sbjct: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDT 61

>Kwal_26.8200
          Length = 652

 Score =  434 bits (1116), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/566 (39%), Positives = 332/566 (58%), Gaps = 37/566 (6%)

Query: 306 SPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNLSGGHY 365
           SPWQ +SL KYRFHRR+ N++PYYLG ++   L P  +    L+ PR+Q YGWN+SGGHY
Sbjct: 81  SPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRKHALRAPRLQYYGWNMSGGHY 140

Query: 366 LKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATFWQQYN 425
           LK  G   +   + R  S  +DF   +   ++ KL  ++F  +N   SI+HE  FWQQ+ 
Sbjct: 141 LKL-GSSATHFHDTR--SWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFR 197

Query: 426 NKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFEEKSIL 485
           +  L  G +   + +LF ++L L++   LRF +    G  G    +  ++ +T +E + +
Sbjct: 198 SGLLNPGPKLGPT-DLFEAILNLMVVIALRFTD---TGATGDDRAAKNTV-LTKDEVTWI 252

Query: 486 IKK--PSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALSQAV 543
             +  P +E+ LF++AY ++  L+FEWESFELIQ+WLLIT Y RTC+RQ +CW ALS+AV
Sbjct: 253 DAQHHPRLEDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAV 312

Query: 544 NMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMCEQM 603
            MCNGMSL+L+KFPE  + YDE +A +C+W  F++D+L+SFQ GRF +L++P  EM    
Sbjct: 313 QMCNGMSLFLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPELAMPGPEMVSPD 372

Query: 604 NLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWYDTF 663
                       D W   E+  +  L++++T+  KR  QDL + ET  + +QL QW+   
Sbjct: 373 ---------VAPDSWLSSESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWF--- 420

Query: 664 IVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCL------IAPSSTANNKSLEY 717
                 NA   +Y +    Q F+TYLD+R+  E+R L+ L      I P    +   L  
Sbjct: 421 ----HENAPSLDYNHLCARQVFLTYLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPL-- 474

Query: 718 VVDTELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKA 777
             +   LI      + +   I     FF PWWLNLS LFT ++IC+  +  G+ + + + 
Sbjct: 475 --NATSLIDLVSQILGHFESIVEEGKFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARV 532

Query: 778 IMQSCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDD 837
           +++   +IW  +E ++P N P M  ECLWCLKMLNHMFC RL+  A +LE+++G DH DD
Sbjct: 533 LLEKSFKIWHYIEDARPPNPPEMAAECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDD 592

Query: 838 TPNRNKFEQFKKVGDNDADVEVDAGE 863
           + N NKF QF KV +  +D    A E
Sbjct: 593 SVNDNKFRQFGKV-ERGSDANSSAPE 617

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 6/68 (8%)

Query: 70  TAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQV 129
           T   ++ GK R +V +AC+ C+K+KVKCDGN PC++C+ +  EC Y     N   +R Q 
Sbjct: 4   TVPHRQEGKRR-KVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTY-----NHPLKRLQS 57

Query: 130 ASAVRDVS 137
            S    VS
Sbjct: 58  RSGSGSVS 65

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region, putative transcription
           factor [2895 bp, 964 aa]
          Length = 964

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 71  AASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNR 122
           A   E    R RV +AC+ C+K+KVKCDG  PC++C+ +  EC Y  K T R
Sbjct: 5   AQQGEQSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYK-KPTKR 55

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 75  ENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134
           E    R RV +AC+ C+K+KVKCDG  PC++C+ +  EC Y+ + T R          VR
Sbjct: 3   EPQSKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN-QPTKRGGSCAPQTITVR 61

Query: 135 DVSKT 139
             +KT
Sbjct: 62  KPAKT 66

>Kwal_23.4754
          Length = 812

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (75%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           R RV +AC+ C+K+KVKCDG  PC++C+ +  EC Y+
Sbjct: 8   RRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 44

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (75%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           R RV +AC+ C+K+KVKCDG  PC++C+ +  EC Y+
Sbjct: 7   RRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTYN 43

>Scas_662.8
          Length = 906

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (75%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           R RV +AC+ C+K+KVKCDG  PC++C+ +  EC Y+
Sbjct: 30  RRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 66

>Scas_661.23
          Length = 741

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 60  GNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
            N+ +  D+ T A K N   R   +  C  CK+R++KCD   P C  C++  +EC Y  K
Sbjct: 105 SNSTNLPDSDTNAKKTNIVKRKYSRNGCAECKRRRMKCDETKPICWQCARLSRECVYIVK 164

Query: 119 ATNRKRRRRQVA-SAVRDVSKTYAETSES 146
           + N+KR+ +    SA +   K   E S S
Sbjct: 165 SGNKKRKSKSAGESAEKRCKKPMKEDSSS 193

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
           transcription factor, in conjunction with Pdr3p
           regulates the expression of a network of genes involved
           in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 64  DALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRK 123
           D+ + ST  S +  K R +V KAC+ C+KRK+KC+G  PC +C  +  EC +        
Sbjct: 23  DSSNFSTGFSGKIRKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFS------- 75

Query: 124 RRRRQVASAVRDVSKTYAE 142
              RQ  + ++++ KT  E
Sbjct: 76  --TRQGGARIKNLHKTSLE 92

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
           complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 29/40 (72%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           G  R RV +AC+ C+K+KVKCD  +PC++C+ +  EC Y+
Sbjct: 8   GLKRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTYN 47

>CAGL0F09229g complement(908186..910693) weakly similar to sp|P39961
           Saccharomyces cerevisiae YER184c, hypothetical start
          Length = 835

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 72  ASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKA 119
           A K    G+ RV +AC++C+KRKVKCDG+ PC +C      C Y+  A
Sbjct: 6   AKKAKLAGKDRVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIYNGVA 53

>Scas_630.14
          Length = 701

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQ-KECRYDFKATNRKR- 124
           T  A SK+  + R RV K+C +C+ RK KCD   P C +C  H  KECRYD +  + KR 
Sbjct: 7   TKAAKSKDGIRKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTISDKRV 66

Query: 125 RRRQVASAVRDVSKT 139
              ++A+AV  +S +
Sbjct: 67  PVSELANAVPRISDS 81

>Kwal_26.7095
          Length = 838

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 67  DTSTAASK--ENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRK 123
           +T +A+S+  E  K R+R    C  CKKRK+KCD   P C  CSK + EC YDF+     
Sbjct: 8   NTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDG 67

Query: 124 RR 125
           RR
Sbjct: 68  RR 69

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
           with weak similarity to Put3p and other transcription
           factors, has a Zn[2]-Cys[6] fungal-type binuclear
           cluster domain in the N-terminal region [2277 bp, 758
           aa]
          Length = 758

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 71  AASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVA 130
           A + E    + R  +AC  C+KRKV+C GN PC  C  +  EC+YD    N     R+V+
Sbjct: 31  AGTNELKPTKGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKYDRPPRNSSVFDREVS 90

Query: 131 SAVRDVSKTYAE 142
               D S  YA+
Sbjct: 91  ----DDSSLYAQ 98

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP----CLNCSKHQKECRYDFKATNRKRRRRQVASAV 133
           K + R  KACE C+KRK KCD  +P    C NCSK   +C +  + T +KR+     + V
Sbjct: 169 KEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDCIFITEPTKKKRKSSSEGTKV 228

Query: 134 RDVSKTYAETSES 146
               K  A+T+ +
Sbjct: 229 NKSPKPAAKTNST 241

>Kwal_56.23058
          Length = 775

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 5/94 (5%)

Query: 69  STAASKENGK--GRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRR 125
           +T++S  +GK   R   +  C  CK+R++KCD   P C  C++  +EC Y  +  NRKRR
Sbjct: 129 ATSSSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNRECVYVIRTKNRKRR 188

Query: 126 RRQVASAVRDVSKTYAETSESFPRDLLSKSNIII 159
            +   ++ +D SK      +S  + +L ++N ++
Sbjct: 189 PKSTDNS-KDTSKPGQRVQKS-EKGILPRTNTVV 220

>Kwal_47.17506
          Length = 924

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKA 119
           K R +V +AC  C++RK+KC G  PCLNC  ++ EC Y   +
Sbjct: 10  KKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTYSIPS 51

>Scas_702.7
          Length = 1113

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 27/39 (69%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           + R +V KAC  C++RK+KC G  PC NC+ +Q EC +D
Sbjct: 28  RPRKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFD 66

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAV 133
           R RV KAC++C+ +K++C+G  PC+NC K    C Y    T+  +RR+   + V
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTY----THVIKRRQAAPTRV 123

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
           Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRK 123
           R+ +AC+LCKKRK KC G NPC +C K   +C Y   A++ K
Sbjct: 31  RLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYREIASHDK 72

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASA 132
           GK R +V +AC+ C+K+K+KC G  PC +C  +  EC Y        + +++ A +
Sbjct: 45  GKPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYSHAPYGVAKGKKKTAKS 100

>Scas_663.12
          Length = 944

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 73  SKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVAS 131
           S+   K R R+   C+ C++ KVKCD   P C  CSKH  EC YD    +  R   + A+
Sbjct: 26  SQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLECVYDVTKQHAPRNPNKAAT 85

Query: 132 AVR 134
             R
Sbjct: 86  MAR 88

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, start by
           similarity
          Length = 844

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 41  DRTWAHTNRKERFREMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGN 100
           D +   + ++E+  E+  IG    +  TST   K + K +      C+ CK+R+VKCD  
Sbjct: 13  DVSKPQSRKREKIIELVDIGGKKVST-TSTGKRKFHNKSK----NGCDHCKRRRVKCDEG 67

Query: 101 NP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYAET 143
            P C  C K + EC Y      ++R R +V    RD +    ET
Sbjct: 68  KPMCDKCVKMKLECVYTPVQPPKRRTRTRVKYITRDANGEIIET 111

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
           Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRR 127
           R +V+ AC  CK+RKV+CDG +PC +C   + +C Y       K++R+
Sbjct: 29  RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYVMNMKPLKKKRK 76

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
           Saccharomyces cerevisiae YBR150c TBS1, hypothetical
           start
          Length = 1049

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 54  REMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP----CLNCSKH 109
           RE + +  T   +D   A        + R  KAC+ C+KRK++CD  NP    C NC K 
Sbjct: 8   RENSQLPGTTPMIDYGMAMELLQQHYKRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKF 67

Query: 110 QKECRYDFKATNRKRRRR 127
           + EC + F    + +++R
Sbjct: 68  KVECTFKFHEELQTKKKR 85

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%)

Query: 516 IQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCC 575
           +Q  LL+  Y +           L +AVNM   + L+L+K  E  S  +  K    +  C
Sbjct: 511 LQGLLLLCHYIQIYINTETAAGVLVEAVNMAISLELHLHKSYEGLSPLELIKRRVLWSYC 570

Query: 576 FIMDKLISFQMGR 588
           F +DK  S  + R
Sbjct: 571 FSVDKYYSLILSR 583

>Kwal_23.6537
          Length = 552

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/357 (19%), Positives = 133/357 (37%), Gaps = 89/357 (24%)

Query: 311 FSLDKYRFHRRYQNI-LPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNLSGGHYLKYK 369
           F   K R+   +  +  P YLG           +E   +  P + ++ WN          
Sbjct: 94  FDPSKSRYMSLHSAVAFPRYLG-----------LELQSVNPPHLHSFAWNCG-------- 134

Query: 370 GDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATFWQQYNNKFL 429
              R +E +  H     D  + +     N+    YF+ ++P+F II  + F Q  ++ + 
Sbjct: 135 --IRPEENSTSHP----DLANIISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYW- 187

Query: 430 RQGKQNNSSANLFTSMLYLILSTTLRFRE--GHLDGQKGQGTYSNTSLNITFEEKSILIK 487
             G   N SA  F +++  +++    F    GH                           
Sbjct: 188 --GGARNVSA--FDAVIGGVVALGSFFSRNFGH--------------------------- 216

Query: 488 KPSIEENLFKYAYLIINTLTFEWE-SFELIQSWLLITFYFRTCYRQTACWNALSQAVNMC 546
             + E ++ +YA  I+   TF  + S E I +W+L + Y R   R    W A    +++ 
Sbjct: 217 --ARELDIVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLV 274

Query: 547 NGMSLY--LNKF-----------PEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLS 593
              +L+  ++K            P  +S  +  +A   FWC + ++ +IS++ GR     
Sbjct: 275 EATALHHEVDKVELATRNDAPLPPRANSVCE--RARRLFWCAWCINTIISYEYGR----- 327

Query: 594 LPASEMCEQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETV 650
                 C  +N + S K L+E    +  E  ++  +    +Q     +Q   L E +
Sbjct: 328 -----SCVTLNKI-SCKLLKESTKNYTAEMVELARMIPTTSQCSDPASQVAALIEAI 378

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           RLRV+KAC  C++RK KCD   PC  C+ +   C+YD
Sbjct: 13  RLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD 49

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
           Saccharomyces cerevisiae YLR228c ECM22, start by
           similarity
          Length = 775

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 66  LDTSTAASKENGKGRL--RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNR 122
           L   T +    GK +   + +  C+ CK+R+VKCD   P CLNC K   +C Y       
Sbjct: 34  LHGKTVSKTATGKRKFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDCVY--TPVQP 91

Query: 123 KRRRRQVASAVRDVSKTYAETSESFPRDLLS--KSNIIIN 160
           + R+   A+A +  SK     + S P + +S  + +I++N
Sbjct: 92  RSRKNSAATAPKHSSKVSKPATVSTPTEPISLNQVDILVN 131

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATN 121
           K   K   +V +AC+ C++RK+KC G  PC NC  +Q  C Y  +  N
Sbjct: 15  KRVTKSSSKVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRGN 62

>Scas_518.5
          Length = 919

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 14/99 (14%)

Query: 75  ENGKGRLRVQKACELCKKRKVKCDG----NNPCLNCSKHQKECRYDFKATNRKRRRRQVA 130
           E  + + RV KAC+ C+KRKVKC         C NC+K+  EC + F     +++R Q A
Sbjct: 107 EGKESKKRVLKACDYCRKRKVKCGDIIAQTGKCANCTKNDVECTFKFHLQLERKKRLQNA 166

Query: 131 --------SAVRDVSKTYAETSESFPRDLLSKSNIIINA 161
                       D   TY +  E    D L KS   +N+
Sbjct: 167 VWEYGDENGNSDDEEGTYLKLLEEL--DTLRKSEAFVNS 203

>KLLA0A02585g complement(226562..227674) some similarities with
           ca|CA5890|CaFCR1 Candida albicans Zinc cluster
           transcription factor, hypothetical start
          Length = 370

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 21/34 (61%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           RV KAC+ C+K K KCDG  PC  C K  K C Y
Sbjct: 17  RVSKACDACRKSKTKCDGERPCSRCLKENKLCTY 50

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
           cerevisiae YGL013c PDR1 transcription factor,
           hypothetical start
          Length = 1107

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%), Gaps = 1/42 (2%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY-DFKAT 120
           R +V KAC+ C++RK+KC+G  PC +C+ +  EC Y D K+T
Sbjct: 24  RTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTDAKST 65

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 48  NRKERFREMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNC 106
           NRK  + ++ +  +T  ++  ++A        R   +  C  CK+R++KCD   P C  C
Sbjct: 159 NRK-VYSQLPSPPDTKASIKKASAVGDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQC 217

Query: 107 SKHQKECRYDFKATNRKR 124
           S+  +EC+Y   A N+KR
Sbjct: 218 SRLNRECKYILNARNKKR 235

>Scas_542.8
          Length = 902

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 86  ACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           AC LC+KR +KC G NPC  C KH  +C Y
Sbjct: 28  ACILCRKRHIKCSGGNPCARCIKHDLKCEY 57

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
           cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 86  ACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQV 129
           AC  CKKRK KCDG  PC  C+K   +C Y    T+R++ +R++
Sbjct: 2   ACLECKKRKQKCDGQKPCRRCTKLNVKCIY---GTDRRKDKRKI 42

>Scas_638.14
          Length = 1043

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRR 125
           +V KAC+ C+KRK+KC G  PC  C  +Q  C Y  +     +R
Sbjct: 43  KVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIYSTQKRKTSKR 86

>Sklu_2082.1 YER184C, Contig c2082 2025-2273
          Length = 82

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKR 124
           +V KAC  C+KRK+KC G   C +C  +  +C YD     R R
Sbjct: 11  KVSKACNECRKRKIKCTGTFSCSSCVIYGSKCGYDQDGAVRSR 53

>KLLA0F02750g complement(250368..253814) some similarities with
           sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
           transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 7/83 (8%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP----CLNCSKHQKECRYDFKATNRK 123
           TS A        + RV KAC+ C++RK+KCD  +P    C NC K++  C + +   + +
Sbjct: 15  TSHAEGVTTKPAKKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHY---HEE 71

Query: 124 RRRRQVASAVRDVSKTYAETSES 146
             RR  + A   ++K  ++T++S
Sbjct: 72  MIRRTNSKAKSRITKFSSDTTKS 94

>Scas_637.7
          Length = 998

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 79  GRLRVQKACELCKKRKVKCDGNNP----CLNCSKHQKECRYDFKATNRKRRRR 127
           G+ RV KAC+ C+KRK+KCD  +P    C NC K+   C +     N    RR
Sbjct: 98  GKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTFKRGRDNVLNNRR 150

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
           Saccharomyces cerevisiae YLR098c CHA4 transcription
           factor, start by similarity
          Length = 603

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 14/92 (15%)

Query: 76  NGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAV-- 133
           +GK + +   AC+ C+ ++ KCD   PC NC K+  EC       N KR +R     V  
Sbjct: 6   DGKRKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIEC---ITVNNDKRTKRTTHEYVEK 62

Query: 134 ---------RDVSKTYAETSESFPRDLLSKSN 156
                    R + K  +ET E  P + L   N
Sbjct: 63  LEAEIDDLKRSIEKMKSETLEGTPSNTLPPRN 94

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 10/95 (10%)

Query: 515 LIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEI-HSTYDESKAW---- 569
           +IQ+ L + FY          W     A  M + + L+LN  PE     YD+  +     
Sbjct: 261 IIQTLLCLAFYDIGNGENPLAWYESGLAFRMAHEIGLHLN--PEAWDDVYDDKLSQIDIE 318

Query: 570 ---HCFWCCFIMDKLISFQMGRFYQLSLPASEMCE 601
                +W C+I D LI+   GR   L +  S + E
Sbjct: 319 VRSRIYWGCYIADHLIAVLFGRSNSLRVSNSTIPE 353

>YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein with
           similarity to transcription factors, contains an
           N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
           domain [3285 bp, 1094 aa]
          Length = 1094

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 82  RVQKACELCKKRKVKCDGNNP----CLNCSKHQKECRYDFKATNRKRR 125
           RV KAC+ C+KRK++C    P    C NC K+ K+C + F    ++RR
Sbjct: 102 RVTKACDYCRKRKIRCTEIEPISGKCRNCIKYNKDCTFHFHEELKRRR 149

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 71  AASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           AA +   K + RV KAC+ C ++K+KC+   PC  C   Q +C Y
Sbjct: 2   AAKRGLAKQKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTY 46

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 48/101 (47%), Gaps = 21/101 (20%)

Query: 59  IGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGN-NP--------CLNCSKH 109
           I N + A D+    S++    R   ++AC  C++RK+KCDG  NP        C NC + 
Sbjct: 3   ISNEESARDSRHPDSRK----RKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRS 58

Query: 110 QKECRYDFKATNRKRRR------RQVASAVRDVSKTYAETS 144
             EC   F A+NR  RR      R ++    DV    AE++
Sbjct: 59  TLECV--FVASNRGGRRVFDKSKRYISPPSSDVCPVLAESA 97

>Kwal_56.22605
          Length = 865

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 76  NGKGRLRVQKACELCKKRKVKCDGNNP----CLNCSKHQKECRY 115
            GK R RV KAC+ C+KRK+KC   NP    C NC+K    C +
Sbjct: 18  GGKFRKRVPKACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTF 61

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
           regulation of glucose transporters, acts as a
           transcriptional repressor that is converted to an
           activator upon glucose-induced phosphorylation [3513 bp,
           1170 aa]
          Length = 1170

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 58  AIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP---CLNCSKHQKECR 114
              N+ D +D++ AAS    K R +  +AC+ C+K+K+KCD  +    C NC ++   C 
Sbjct: 19  GTSNSPDDMDSAAAASHAIKK-RTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCS 77

Query: 115 YD 116
           +D
Sbjct: 78  FD 79

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
           regulatory protein, has a Zn[2]-Cys[6] fungal-type
           binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 83  VQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           V+ AC+ C+ R+VKCDG  PC  C +H  +C Y
Sbjct: 4   VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTY 36

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 84  QKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRR 127
           +  C  CKKR++KCD   P C  C++  +EC Y     N+KR+ R
Sbjct: 161 RNGCTECKKRRMKCDEGKPSCWQCTRLNRECVYILNPKNKKRKPR 205

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [1824 bp, 607 aa]
          Length = 607

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 83  VQKACELCKKRKVKCDGNNPCLNCSK--HQKECRYD 116
           +  AC +C+KRK+KCDGN PC  C +    KEC Y+
Sbjct: 12  ISLACTVCRKRKLKCDGNKPCGRCIRLNTPKECIYN 47

>CAGL0L03377g complement(382932..386561) some similarities with
           sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
           interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRDV 136
           + + R  +AC+ C+ +K+KCDG  PC NC+K    C      T+ K  RR +     D+
Sbjct: 20  RTKKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNC-----VTSDKLSRRGLPKGYTDL 73

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
           Transcription factor required for induction of
           peroxisomal proteins in response to oleic acid [2991 bp,
           996 aa]
          Length = 996

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 67  DTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRR 125
           D S+ A    GK R R+   C+ C+K K KCD   P C  C+K    C YD       R 
Sbjct: 5   DESSPAMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYDVARQAAPRN 64

Query: 126 RRQVASAVR 134
             + A+  R
Sbjct: 65  PNKDATIAR 73

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [1641 bp, 546 aa]
          Length = 546

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY-DFKATNRKRRRRQVASAVRD 135
           R RV+KAC  C++RK KC+G +PC  C  +   C Y D +  +   + +QV     D
Sbjct: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPD 69

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 11/108 (10%)

Query: 492 EENLFKYAYLIINTLTFE-WESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMS 550
           E ++ +YA  I++  TF    + E + +W+L T Y R   R    W A    +++   + 
Sbjct: 225 EMDIVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIG 284

Query: 551 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 588
           L+           N  P   +T         FWC + ++ ++S+  GR
Sbjct: 285 LHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 65  ALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRK 123
           A+ ++    K N   R   +  C  CK+R++KCD   P C  C++  ++C Y     N+K
Sbjct: 137 AVTSTVTDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQCVYVLNPKNKK 196

Query: 124 RR 125
           RR
Sbjct: 197 RR 198

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
           (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 75  ENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134
           ++G    +++ AC+ C+KR+ KCD   PC+NC K   EC          R++R  A  V+
Sbjct: 2   QSGSDLKKLKLACQTCRKRRRKCDLQVPCVNCQKFGVEC---LPVDQDLRKKRYSAQYVQ 58

Query: 135 DV 136
            +
Sbjct: 59  SL 60

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 78/215 (36%), Gaps = 30/215 (13%)

Query: 396 LINKLLRYYFDEINP-VFSIIHEATFWQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTL 454
           LI + L  +F  + P  F+ IH  TF   +       G     +      +++ I +   
Sbjct: 179 LILRSLSLFFKWLYPGPFTFIHRETFLSAFF------GDAETKTYYCSEELVFAIAALGS 232

Query: 455 RFREGHLDGQKGQGTYSNTSLNITFEEKSILIKKPSIEENLFKYAYLIINTLTFEWESFE 514
           R        QKG   ++ T+      +  +L K       +F+   +    ++       
Sbjct: 233 RL------SQKGSDLFAKTAEYYNISKTKVLSK-------VFQLDSVPCTGMSSSSSKLA 279

Query: 515 LIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWH---- 570
           ++Q+ L + FY          W     A  + + + L+LN  PE        K  H    
Sbjct: 280 VVQTLLCLAFYDMGNGENPLAWYESGLAFRIAHEIGLHLN--PEAWDDVYADKLSHLDIE 337

Query: 571 ----CFWCCFIMDKLISFQMGRFYQLSLPASEMCE 601
                +W C+I D LI+   GR Y L L  S + E
Sbjct: 338 VRSRIYWGCYIADHLIAVLFGRSYTLRLSNSTIPE 372

>KLLA0F22880g 2123577..2127071 some similarities with
           ca|CA3639|IPF9251 Candida albicans unknown function,
           hypothetical start
          Length = 1164

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 85  KACELCKKRKVKCDGNNP-CLNCSKHQK--ECRYDFKATNRKRRRRQVASAVRDVSKTYA 141
           K+C +C++RKV+CD   P CL C KH    EC Y+ +    KR  + V+    DVS    
Sbjct: 7   KSCLVCRRRKVRCDRAKPVCLVCVKHGSNMECNYEVQ----KREVKFVSMKTPDVSNPRM 62

Query: 142 ETSESF 147
           +  +SF
Sbjct: 63  KKQKSF 68

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, start by similarity
          Length = 880

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134
            K R ++   C+LC+K K KCD   P C  C +  K C YD +     R+  + A+  R
Sbjct: 11  AKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPCIYDLEYQPLPRKPNKDAALAR 69

>KLLA0C18953g 1682246..1684357 weakly similar to
           sp|P36598|Q9UTJ9|P40378 Schizosaccharomyces pombe
           Thiamine repressible genes regulatory protein THI1
           (Transcription factor NTF1), start by similarity
          Length = 703

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 79  GRLRVQKACELCKKRKVKCDGNNPCLNCSK--HQKECRYDFKAT--NRKRRRRQVAS 131
           G  + ++ACE CK+RK +C G  PC  C K  + + C Y  + T  N K   R +AS
Sbjct: 10  GNAKSKRACETCKRRKKRCSGGLPCEYCVKIGNPQGCEYKTRLTKKNVKVSERYIAS 66

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 515 LIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWC 574
           LIQ++L + ++  +  +    +  +  A+ +   +         IH T    K    FW 
Sbjct: 309 LIQAFLYVAYFGLSVDKSAFAYVMVGNAIRIAFTLG--------IHKTSATPKNNRIFWL 360

Query: 575 CFIMDKLISFQMG 587
           CF+ D+L++ + G
Sbjct: 361 CFLYDRLLAIRFG 373

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
           regulatory protein, contains a Zn[2]-Cys[6] fungal-type
           binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 83  VQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYAE 142
            ++AC+ C+ R+VKCDG  PC +C ++  +C Y        R+R   +  +R + +    
Sbjct: 9   AKQACDCCRIRRVKCDGKRPCSSCLQNSLDCTY----LQPSRKRGPKSIRLRSLKRIAEV 64

Query: 143 TSESFPRDLLSKSNI 157
             ES P  + +   I
Sbjct: 65  QRESGPNTIATAPVI 79

>CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomyces
           cerevisiae YLR266c, hypothetical start
          Length = 646

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKH--QKECRYDFKATNRKRRRRQV 129
           R RV K+C+ C   K+KC+  +PCL C +   Q +C Y+F+  +    R+ +
Sbjct: 11  RRRVIKSCQYCYAHKLKCNRESPCLTCQQQGTQDQCVYNFQDNDTLTHRKSL 62

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 55  EMTAIG--NTDDALDTSTAASKENGKGRLR--VQKACELCKKRKVKCDGNNP-CLNCS-K 108
           E   IG  N D+   +   AS  NGK R R  V K+C  C+KRK+KCD   P C  C  +
Sbjct: 54  ESAGIGSHNNDEEHYSDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMR 113

Query: 109 HQKECRY 115
              EC Y
Sbjct: 114 GLSECVY 120

>Scas_702.7d
          Length = 978

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 76  NGK-GRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116
           NGK  +LR  +AC  C++RK+KC G  PC NC  +   C ++
Sbjct: 6   NGKIKKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFE 47

>Scas_625.5
          Length = 1141

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 65  ALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP---CLNCSKHQKECRYDFKATN 121
           A  T+ A++  + K R +  +AC+ C+K+K+KCD +     C NC ++ ++C ++     
Sbjct: 53  AAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLK 112

Query: 122 RKRRRRQVASAVRDVSKTYAET 143
           R   +    +  +   +T  ET
Sbjct: 113 RGPSKGYTRNHSKSTPQTTHET 134

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATN 121
           R RV   C  C++RK +CD  NPC  C     EC Y     N
Sbjct: 68  RNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVYSISEMN 109

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
           cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 76  NGKGRLRVQKACELCKKRKVKCDGN---NPCLNCSKHQKECRYDFKATNRKRRRRQVASA 132
           N K R  V +AC+ C+++K+KCD N   N C +C ++ + C+++     R   +R  +  
Sbjct: 5   NDKKRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKFE-----RVPLKRGPSKG 59

Query: 133 VRDVSKTYAETSESFP--RDLLSKSNIII 159
               S    + S + P    L   SN II
Sbjct: 60  AHKASDPELKLSSNKPSKSSLFEDSNSII 88

>KLLA0C17050g 1490472..1493339 some similarities with
           ca|CA3454|IPF10533.exon1 Candida albicans unknown
           function, exon 1, hypothetical start
          Length = 955

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSK 138
           R R   +C  C KRK+KCD   P C +C K+  EC Y   A   +  +  +++   DV+ 
Sbjct: 39  RQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLYFLNARVSRGGKHNISTGTEDVTA 98

Query: 139 TYAETSE 145
           + A   E
Sbjct: 99  SEASKEE 105

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 70  TAASKENGKGR---LRVQKACELCKKRKVKCD----GNNPCLNCSKHQKECRYDFKATNR 122
           T ++  +G G+    RV KAC+ C+KRK++CD        C NC K Q  C +  +    
Sbjct: 116 TNSNDMSGSGKNLKKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLPCTFKHRDEIL 175

Query: 123 KRRRR 127
           K++R+
Sbjct: 176 KKKRK 180

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 66  LDTSTAASKENGKGRL--RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNR 122
           +D    +    GK +   + +  C+ CK+R+VKCD   P C  C K +  C Y   A  R
Sbjct: 66  VDGKKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSCVYT-PAKPR 124

Query: 123 KRRRRQVASAVRDVSK 138
           K++ R V + ++ V++
Sbjct: 125 KKKDRDVETVIKYVTR 140

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
           transcription factor, in conjunction with Pdr1p
           regulates the expression of a network of genes involved
           in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQ 128
           K     R +V  AC  C+KRK+KC G  PC NC  +   C +  K   +K    Q
Sbjct: 2   KVKKSTRSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKHLPQKEDSSQ 56

>Scas_669.8
          Length = 637

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 76  NGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKH--QKEC 113
           NG  R +   AC +CKKRKVKCD   PC +C +   + EC
Sbjct: 5   NGGERRKTPYACNVCKKRKVKCDKLIPCTSCIQKGLENEC 44

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
           Saccharomyces cerevisiae YLR014c PPR1 transcription
           factor regulating pyrimidine pathway, hypothetical start
          Length = 775

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 2/83 (2%)

Query: 513 FELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWHCF 572
            E +Q  LLI  Y          W  L  A+ +C  + L+  K  + +  +        F
Sbjct: 364 LEALQGLLLIAVYSLMRPTVPGLWYTLGSAIRLCVDLGLHAEKLNKNYEPFIRDVRRRLF 423

Query: 573 WCCFIMDKLISFQMGRFYQLSLP 595
           WCC+ MD+ +    GR   +S+P
Sbjct: 424 WCCYSMDRQVCAYFGR--PVSIP 444

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 72  ASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVA 130
            +KE+     R   AC+ C+ RK+KCD   P C  C + Q+ C     +T R+  R  V 
Sbjct: 5   VTKESSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSYVV 64

>Kwal_47.17681
          Length = 854

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 82  RVQKACELCKKRKVKCDGN--NPCLNCSKHQKECRY-DFKATNRKRR 125
           R  +ACE+C  RKV+CD N   PC +C      CR  D K   R R+
Sbjct: 14  RTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRDVKKVKRGRK 60

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 84  QKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRD 135
           +  C  CK+R++KCD + P C  C++  ++C Y     N+KR+  + +  V++
Sbjct: 201 RNGCAECKRRRMKCDESKPKCWQCTRLNRDCVYILNPKNKKRKTSKGSDRVKE 253

>Scas_610.9
          Length = 809

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 15/97 (15%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGN----NPCLNCSKHQKEC--RYDFKATNRK---- 123
           KE   GR +   AC  C+++K KCD N    NPC  C++    C  + DF+ T ++    
Sbjct: 8   KEIPMGRRKY--ACVECRQQKSKCDANDKAPNPCSKCARKGVPCILKKDFRRTYKRARNE 65

Query: 124 ---RRRRQVASAVRDVSKTYAETSESFPRDLLSKSNI 157
              +R +++A+ +  +S           R+LLS+ NI
Sbjct: 66  AIEKRFKELAAGLSSLSSEEIVRRIEHERELLSRGNI 102

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
           (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 73  SKENGKGR--LRVQKACELCKKRKVKCD-------GNNPCLNCSKHQKEC 113
           S   G GR   R+ KAC  C+ RKV+CD          PC+ CS+ +KEC
Sbjct: 16  SSNAGSGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
           complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 11/85 (12%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRR-- 125
           T   A +E+  G  + + AC  C++R+ KCD N PC +C + + EC  + +   +KR   
Sbjct: 28  TEEPAERESYTGVSKKRLACTNCRRRRKKCDLNYPCSSCLRLKLECNVNDEDLRKKRYSI 87

Query: 126 ------RRQVA---SAVRDVSKTYA 141
                   QVA   S VR+++ T A
Sbjct: 88  TYVKNLETQVAFLESKVRELADTVA 112

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
           complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSK 138
           R  +AC+ C+ +K+KCDG  P C +C K   +C+   K T R   R       R+V K
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGYTEMLEREVIK 81

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor or sp|P52960
           Saccharomyces cerevisiae YOR363c PIP2, hypothetical
           start
          Length = 1022

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 73  SKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDF---KATNRKRRRRQ 128
           S +  K R R+   C+ C+K K KCD   P C  C KH   C YD    KA     +   
Sbjct: 9   SSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRCVYDLTSQKAPKNPNKDAM 68

Query: 129 VASAVRDVS 137
           +A   +++S
Sbjct: 69  IARLEKELS 77

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
           RV +AC+ C+ +K++CDG  P C  C+    EC+   K + R   R
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPR 223

>YML076C (WAR1) [3893] chr13 complement(112513..115347)
           Transcription factor with a Zn[2]-Cys[6] fungal-type
           binuclear cluster domain, involved in mediating the weak
           acid stress response [2835 bp, 944 aa]
          Length = 944

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 8/83 (9%)

Query: 75  ENGKGRLRVQKACELCKKRKVKCDGNN-------PCLNCSKHQKECRYDFKATNRKRRRR 127
           E GK + R   AC  C   K KC+ ++       PC  C KH+K C++D     RKR+ R
Sbjct: 65  EKGKTK-RNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSKRTRKRKPR 123

Query: 128 QVASAVRDVSKTYAETSESFPRD 150
             +    +       T    P D
Sbjct: 124 SRSPTPFESPMVNVSTKSKGPTD 146

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 64  DALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNR 122
           D L      S    + R R+   C  C++RK+KCD   P C+ C++    C YD +    
Sbjct: 2   DPLKKPMEYSVGKVQKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYDIERQPA 61

Query: 123 KRRRRQVASAV 133
            R+  +V+  +
Sbjct: 62  PRKSSKVSETI 72

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
           activator of gluconeogenic genes through CSRE elements,
           activated by Snf1p kinase, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 50  KERFREMTAIGNTDD----ALDTSTAASKENGKGRLRVQKA--CELCKKRKVKCDGNNP- 102
           K ++    ++ +TD      L   T  S  N      V+KA  C+ C+ +K+KCDG  P 
Sbjct: 3   KRKYGRSYSLDDTDSCSNKVLIVPTGQSSSNAITDFSVRKAHACDRCRLKKIKCDGLKPN 62

Query: 103 CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDV 136
           C NC+K    C+     T+ K  RR +     ++
Sbjct: 63  CSNCAKIDFPCK-----TSDKLSRRGLPKGYTEL 91

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
           that activates the proline utilization pathway genes,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%)

Query: 72  ASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
            +K+  K + R   AC  C+KR +KC G NPC  C      C Y
Sbjct: 19  VNKQPQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEY 62

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
           element binding protein involved in the regulation of
           sterol biosynthetic gene expression and the uptake and
           intracellular esterification of sterols [2742 bp, 913
           aa]
          Length = 913

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 14/101 (13%)

Query: 49  RKERFREMTAIGNTDDALDTSTAASKENGKGRL--RVQKACELCKKRKVKCDGNNP-CLN 105
           R+E+  E+  +       D    ++   GK +   + +  C+ CK+R+VKCD   P C  
Sbjct: 18  RREKVIELIEV-------DGKKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEGKPACRK 70

Query: 106 CSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYAETSES 146
           C+  + EC+Y    T    R+ + A+ V+ V++    + ES
Sbjct: 71  CTNMKLECQY----TPIHLRKGRGATVVKYVTRKADGSVES 107

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
           regulatory element binding protein involved in the
           regulation of sterol biosynthetic gene expression and
           may be involved in regulating sterol uptake [2445 bp,
           814 aa]
          Length = 814

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 14/92 (15%)

Query: 50  KERFREMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           +E+  E+  +G    +  TST   K + K +      C+ CK+R+VKCD   P C  C+ 
Sbjct: 12  REKDAELIEVGGKKVS-KTSTGKRKFHNKSK----TGCDNCKRRRVKCDEGKPFCKKCTN 66

Query: 109 HQKECRYDFKATNRKRRRR-----QVASAVRD 135
            + +C Y   +  + RRR+     + ASAV D
Sbjct: 67  MKLDCVY---SPIQPRRRKDSSSSKFASAVHD 95

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor or sp|P52960
           Saccharomyces cerevisiae YOR363c PIP2, hypothetical
           start
          Length = 994

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 9/85 (10%)

Query: 56  MTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECR 114
           M+ +G+      +S   +    + R R+   C+ C++ K +CD   P C  C K + EC 
Sbjct: 1   MSVVGS-----GSSPEGNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLECV 55

Query: 115 YDFKATNRKR---RRRQVASAVRDV 136
           YD    +  R   +   +A   RDV
Sbjct: 56  YDMAKQSAPRIPSKDATIARLGRDV 80

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
           cerevisiae YKL015w PUT3 positive activator of the
           proline utilisation pathway, start by similarity
          Length = 865

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           R   AC  C++R +KC G NPC  C K    C Y
Sbjct: 41  RSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEY 74

>Scas_556.6
          Length = 1022

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 33/82 (40%), Gaps = 3/82 (3%)

Query: 54  REMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKE 112
           +E  + GN+  +   +   S    K R R+   C+ C+K K KCD   P C  C K    
Sbjct: 15  QEQVSSGNSTSS--PAAGGSNRQIKKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLA 72

Query: 113 CRYDFKATNRKRRRRQVASAVR 134
           C YD       R   + A   R
Sbjct: 73  CVYDVAKQPPPRIPSKDAKITR 94

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKR 124
           + T A+     G  R + AC  C+ R+ KCD   PC NCS+ +  C  + +   +KR
Sbjct: 51  SGTGANTLTNGGSTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDEDLRKKR 107

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 75  ENGKGRLRVQK---ACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           E G+ R R ++   AC  C++R VKC G NPC  C      C Y
Sbjct: 33  EGGQLRKRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEY 76

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134
           R R+   C+ C+K K KCD   P C  C K+  EC YD +   + R   + A+  R
Sbjct: 21  RNRISFVCKACRKSKTKCDREKPSCTRCIKNGIECVYDIEQQTQPRNPSKDATIGR 76

>Kwal_23.3122
          Length = 788

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 49  RKERFREMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCS 107
           +KE+  E+  + +      TST   K + K +      C+ CK+R+VKCD + P C  C 
Sbjct: 17  KKEKVIELIEV-DGKKVSKTSTGKRKFHKKSK----NGCDNCKRRRVKCDEDKPSCQKCL 71

Query: 108 KHQKECRYDFKATNRKRRRRQVA 130
             + EC Y    T+RKR+    A
Sbjct: 72  NMKLECVYT-PVTSRKRKSSSGA 93

>Kwal_23.3514
          Length = 579

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKE 112
           + +  C +C KRKVKCD N PC NC K  ++
Sbjct: 7   KTRTPCVVCTKRKVKCDRNIPCSNCVKRGQQ 37

>Kwal_14.915
          Length = 822

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%)

Query: 63  DDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           + A D     SK   +   R   AC  C++R  KC G+NPC  C      C Y
Sbjct: 25  EPASDMEEIGSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEY 77

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
           required for induction of SPS19 and POX1 on
           oleate-containing medium, plays a role in peroxisome
           proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 64  DALDTSTAASKENG----KGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYD 116
           +A  +ST+ + EN     + R R+   C+ C K K KCD   P C  C KH  +C YD
Sbjct: 39  EAEHSSTSPAPENSETHNRKRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKCVYD 96

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
           R  +AC+ C+ +K+KCDG  P C NC K    C    K T R   R
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPR 103

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulator
           of the maltose pathway MAL genes, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 83  VQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           V+++C+ C+ R+VKCD N PC  C +    C Y
Sbjct: 4   VRQSCDCCRVRRVKCDRNRPCDRCRQRNLRCTY 36

>Scas_679.26
          Length = 775

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 49  RKERFREMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCS 107
           +K+R  E+  + +      TST   K + K +      C+ CK+R+VKCD   P C  C 
Sbjct: 25  KKDRVVELVEV-DGKKVSKTSTGKRKFHNKSK----NGCDNCKRRRVKCDELKPTCQKCI 79

Query: 108 KHQKECRYDFKATNRKRRRRQVASAVRDVS 137
               EC Y      + R+ +  +++VR V+
Sbjct: 80  NMNLECVYSMP---KPRKAKGSSTSVRYVT 106

>Scas_234.1
          Length = 337

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 70  TAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSK 108
           T  + +N K R R    C  CKKRK KCD   PC  C++
Sbjct: 16  TEYNSQNSKKRNRPTVVCTNCKKRKSKCDRGRPCSTCAR 54

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
           [1449 bp, 482 aa]
          Length = 482

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 73  SKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQ--KECRYDFKATNRKRRRRQVA 130
           S E    R  + +AC  C ++ ++CD   PC NC K    + CR + +   RK R R   
Sbjct: 6   SAEEKLNRKPISRACVFCHEKHLQCDVGRPCQNCEKRNIGESCRDNVRKV-RKTRGRTPR 64

Query: 131 SAVRDVSKTYAE 142
           S V ++ +   E
Sbjct: 65  SGVMNLRRARRE 76

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
           RV +AC+ C+ +K +CDG  P C  C+    EC+   K + R   R
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118

>YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcription
           factor involved in expression of galactose-induced
           genes, phosphorylation correlates with activity [2646
           bp, 881 aa]
          Length = 881

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 83  VQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
           +++AC++C+ +K+KC    P C  C K+  ECRY  K
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPK 43

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
           (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 66  LDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           + + TA+SK   + R RV  +C +C+KRKVKCD   P C  C+K
Sbjct: 1   MSSPTASSK---RKRNRVPLSCTICRKRKVKCDKTRPHCNQCTK 41

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
           (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVAS 131
           R R+   C+ C+K K KCD   P C  C+K+  +C YD +    K+R  +V S
Sbjct: 25  RNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKCVYDIE----KQRAPRVPS 73

>AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH]
           complement(60109..61899) [1791 bp, 596 aa]
          Length = 596

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 5/52 (9%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNPCLNCSKH--QKECRYDFKATNRKRRR 126
            +  +   K C +C KRKVKCD   PC NC K     EC    +A   KR R
Sbjct: 2   ARSTIIASKPCAVCIKRKVKCDRLVPCTNCVKRGGAAECE---RADTIKRPR 50

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
           Saccharomyces cerevisiae YLR256w HAP1 transcription
           factor, hypothetical start
          Length = 1355

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           T+T       K R R+  +C +C+KRKVKCD   P C  C+K
Sbjct: 4   TTTIPGAAPKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTK 45

>Kwal_27.10232
          Length = 1209

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
           RV +AC+ C+ +K +CDG  P C  C+    EC+   K + R   R
Sbjct: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 45/121 (37%), Gaps = 3/121 (2%)

Query: 475 LNITF---EEKSILIKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYR 531
           LNI F   E   +L        N  K A   I+TL    +  E +   LLI  Y      
Sbjct: 366 LNIIFSIGESTRVLDSNAEKSRNFKKRAVHYIDTLYCSNDRLEALAGVLLIAIYSIMRPN 425

Query: 532 QTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQ 591
               W  +  A+ +   + L+  K  + +  +        FWC + +D+ I    GR + 
Sbjct: 426 VPGVWYIMGSALRLAVDLGLHAEKLNKNYDPFTRELRRRLFWCTYALDRQICVHFGRPFG 485

Query: 592 L 592
           +
Sbjct: 486 I 486

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 61  NTDDALDTSTAASKENGK----GRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
           N    +DTS +  K+       G  R   AC+ C+ +KVKCD   P C  C+   + C  
Sbjct: 13  NISSNIDTSYSKQKKRPSSSILGISRSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVS 72

Query: 116 DFKATNRKRRRRQV 129
              AT R   R  V
Sbjct: 73  LDPATGRDVPRSYV 86

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 9/101 (8%)

Query: 35  ARSRQIDRTWAHTNRKERFREMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRK 94
            R R+++    H ++     E T+ GN   + ++S   +    K RL    AC  C++R+
Sbjct: 33  GRKRKVND--GHDDKSANGSEQTS-GNP--SRESSANVTSRPTKKRL----ACSNCRRRR 83

Query: 95  VKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRD 135
            KCD   PC  C K   EC  + +   +KR       ++ D
Sbjct: 84  KKCDLQYPCFTCDKLGLECNINEEDLRKKRYTNTYVKSLED 124

>Kwal_26.6805
          Length = 944

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 67  DTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYD 116
           +  T  S  +G+ R R+   C+ C+K K KCD   P C  C KH   C YD
Sbjct: 10  EVKTTQSAHSGR-RNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRCVYD 59

>KLLA0F13904g complement(1287758..1289497) some similarities with
           sp|P42950 Saccharomyces cerevisiae YJL103c, hypothetical
           start
          Length = 579

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKH--QKECRYDFKATNRKRRRRQVASAVRDVS 137
           R  +  AC  C ++ ++CD   PC NCSK      CR D +   RKR  R+V       +
Sbjct: 13  RKPIPTACVFCHEKHLQCDLGRPCQNCSKRGIGDTCR-DKERKPRKRGPRKVKKEREVSA 71

Query: 138 KTYAETSESFPRDLL 152
            T +E S +  + L+
Sbjct: 72  STKSEISNTINQQLI 86

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, start by similarity
          Length = 975

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKR 124
           TS  A K     R R+   C+ C+K K KCD   P C  C K+  +C YD +     R
Sbjct: 21  TSNGACK-----RQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVYDVEQQKPPR 73

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
           complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 69  STAASKE--NGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
            T A +E  N +   R   AC  C++R V+C G  PC  C+     C Y
Sbjct: 41  GTLAGREERNKRPAKRAPLACLRCRRRHVRCPGGTPCAKCAVANIACEY 89

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
           (subunit b) of the Cbf3 kinetochore protein complex
           [1827 bp, 608 aa]
          Length = 608

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 17/77 (22%)

Query: 76  NGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRD 135
           N   +L+ +  C +C +RKVKCD   PC NC                 R+R Q +  ++ 
Sbjct: 3   NRTTQLKSKHPCSVCTRRKVKCDRMIPCGNC-----------------RKRGQDSECMKS 45

Query: 136 VSKTYAETSESFPRDLL 152
                A +S+ +  DLL
Sbjct: 46  TKLITASSSKEYLPDLL 62

>YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong
           similarity to the MAL regulatory proteins Mal63p,
           Mal33p, and Mal23p, contains an N-terminal Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [1398 bp, 465 aa]
          Length = 465

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           R ++AC+ C  R+VKCD   PC  C +H  +C Y
Sbjct: 3   RNRQACDCCCIRRVKCDRKKPCKCCLQHNLQCTY 36

>Kwal_14.2619
          Length = 1167

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQ--KECRYDFK 118
           G     +  +C  C++RKVKCD + P CL C K++   EC Y+ K
Sbjct: 2   GNRAFNIGTSCLTCRRRKVKCDRSKPVCLACIKYKSISECSYEVK 46

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 65  ALDTSTAASKENGKGRLRVQK----ACELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
           ++D S A    +  G++  +K     C  CKKR++KCD   P C  C++  ++C Y
Sbjct: 129 SVDASGATPSTDADGKIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKCVY 184

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
           Saccharomyces cerevisiae YDR421w positive transcription
           regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 14/71 (19%)

Query: 67  DTSTAASKENGKGRLRVQKACELCKKRKVKCD-------GNNPCLNCSKHQKECRYDFKA 119
           ++ TA  K+  K   R  KAC  CK RKVKCD          PC+ C +  +EC +    
Sbjct: 7   ESQTAPKKQTFK---RGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMF---- 59

Query: 120 TNRKRRRRQVA 130
           T  KR   +VA
Sbjct: 60  TETKRGGFRVA 70

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 64  DALDTSTAASKENGKGRLRVQKACELCKKRKVKCD---GN--NP---CLNCSKHQKECRY 115
           D++ ++ + +    + R +V +AC+ C+K+K+KCD   G+  NP   C  C K  ++C +
Sbjct: 94  DSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSF 153

Query: 116 D 116
           +
Sbjct: 154 E 154

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
           Saccharomyces cerevisiae YMR280c CAT8 transcription
           factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 43/108 (39%), Gaps = 26/108 (24%)

Query: 58  AIGNTDDALDTSTAASKENGKG-------------RLRVQKACELCKKRKVKCDGNNP-C 103
           A G  DD   + + A   NG                 RV +AC+ C+ +K KCDG  P C
Sbjct: 18  AGGGDDDVHGSGSGAGPANGNSVSGSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQC 77

Query: 104 LNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYAETSESFPRDL 151
             C+    EC    K ++R  R        +   + Y ET E   R+L
Sbjct: 78  SQCALVGFEC----KISDRLNR--------KSFPRGYTETLEERVREL 113

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
           [1839 bp, 612 aa]
          Length = 612

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 66  LDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKR 124
           +D   A  K   +     +  C  CK+RKVKCD   P C  CS   K C Y     N K 
Sbjct: 1   MDVPEAGRKGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRCVY--MVNNSKI 58

Query: 125 RRRQV 129
           R +++
Sbjct: 59  RFKEI 63

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSK 138
           R  +AC+ C+ +K+KCDG  P C +C K    C+   K T R   R       ++V K
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGYTEMLEKEVVK 81

>Scas_564.9*
          Length = 609

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYA 141
           R++K  +   K + KCD  +PC NC K + EC Y     +  R+ R   S V+ + +  A
Sbjct: 6   RLRKILKKLAKIRRKCDTGSPCANCMKFETECVY---TGHDLRKARYSNSYVKALEEHIA 62

Query: 142 ETSESFPRDL 151
              +SF +DL
Sbjct: 63  LLEKSF-KDL 71

>Kwal_23.6425
          Length = 735

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 65  ALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNC-SKHQKECRY 115
            LD     ++   + R +  K C  C+KRK+KCD N P C  C S+   EC Y
Sbjct: 14  GLDEDQVEAELGSRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTECVY 66

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 57  TAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNC-SKHQKECR 114
           TA G       T T+ S   GK R ++ K+C  C++RK++CD   P C  C S++   C+
Sbjct: 27  TAGGANGSNSGTPTSTS---GKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQ 83

Query: 115 Y 115
           Y
Sbjct: 84  Y 84

>Scas_696.44
          Length = 1164

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 13/77 (16%)

Query: 76  NGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134
           N    LR+ +AC+ C+ +K +CDG  P C  C+    EC    K +++ +R        +
Sbjct: 70  NEDSNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFEC----KISDKLQR--------K 117

Query: 135 DVSKTYAETSESFPRDL 151
              + Y ET E   R+L
Sbjct: 118 SFPRGYTETLEEKVREL 134

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 89/209 (42%), Gaps = 37/209 (17%)

Query: 397 INKLLRYYFDEINPVFSIIHEATFWQQYNNKF---LRQGKQNNSSANLFTSMLYLILSTT 453
           +++L+ ++F + N +  II++  F   Y N F   L+  +++  S+NL   M Y I    
Sbjct: 352 MDELINFFFQDWNDIIPIINKEEFLSNY-NAFKLDLKNSERDKLSSNL--KMNYKIFGCI 408

Query: 454 LRF--REGHLDGQKGQGTYSNTSLNITFEEKSILIKKPSIEENLFKYAYLIINTLTFEWE 511
           L    + G L   K + T   +S NI    KSI+     +  NL    +  I T+     
Sbjct: 409 LVLMCQMGLL--TKIKATNGKSSPNIHL--KSIMAYYHQLIANLPINNFFQIATI----- 459

Query: 512 SFELIQSWLLITFYFRTCYRQTACWNALSQAVNMC-------------NGMSLYLNKFPE 558
           S   ++ ++LI FY       +A +    + ++M              +G SL +NK   
Sbjct: 460 SIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKL-- 517

Query: 559 IHSTYDESKAWHCFWCCFIMDKLISFQMG 587
                D+S     FW  + +D L S Q+G
Sbjct: 518 -----DQSNRRILFWTIYSLDALSSLQLG 541

>KLLA0D00396g complement(36277..37362) some similarities with
           ca|CA2346|CaSEF1 Candida albicans Putative transcription
           factor1, hypothetical start
          Length = 361

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 81  LRVQKACELCKKRKVKCDGNN----PCLNCSKHQKECRYDFKATNRK 123
           L+  ++C  C+K KVKCD  N    PC  CSK    C  D+    R+
Sbjct: 2   LKPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVCTLDYVVPPRR 48

>Kwal_23.4370
          Length = 692

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 63  DDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATN 121
           DD +   T     NG+ +     +C  C+K K +C   +P C++C+K  + C Y  +A  
Sbjct: 54  DDGVSADT-----NGEYKKYELYSCSRCRKLKKRCSKESPVCVSCAKAGESCTYPGRAPR 108

Query: 122 RKRRRRQVASAVRDVSKTYAETSES 146
           R R+  +       +S+  A+ S S
Sbjct: 109 RTRKELERVRRENSLSRPAAKRSRS 133

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
           (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNC-SKHQKECRY 115
           K R +V K+C  C+KR+VKC+   P C  C  K   EC Y
Sbjct: 10  KTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVY 49

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECR 114
           R+ +AC+ C+ +K +CDG  P C  C+    ECR
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 98

>Kwal_34.15751
          Length = 628

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 70  TAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQ 128
           T  SK+N     R+   C+ C+ RK+KC+   P C  C KH  +C Y         RR  
Sbjct: 3   TPKSKKN-----RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQCVY------TPYRREG 51

Query: 129 VASAVRDVSK 138
             SA+  + K
Sbjct: 52  DPSAIESLQK 61

>KLLA0A09251g 808253..810319 some similarities with sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 688

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 66  LDTSTAASKENGKGRLRVQKACELCKKRKVKCDGN-NPCLNCSKHQKECRYDFKATNRKR 124
           + T T    E      +   +C  C++ K KC  + + C NC+K  + C Y  +A  RKR
Sbjct: 1   MGTETDGGGEISGPNKKASHSCSRCRRLKKKCSKDLSTCTNCAKANEPCDYPGRAPRRKR 60

Query: 125 RRRQVASAVRDVS 137
           +  + A  + ++S
Sbjct: 61  KEIEEAMLLGELS 73

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 122/319 (38%), Gaps = 42/319 (13%)

Query: 490 SIEENLFK-YAYLIINTL--TFEWESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMC 546
           S EE L + +AYL +         ++ E I+  LL+  Y     +  + W      + +C
Sbjct: 323 SEEEGLSEHFAYLAMKNFCPVMHLQNLETIKCLLLLGIYSFFEPKGVSSWTISGLIMRLC 382

Query: 547 NGMSLYLNKFPE---IHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMCEQM 603
            G  L     P+     S  D    +  FW  +  ++L++  +GR   LS       + +
Sbjct: 383 IGFGLNRALTPKKLKTMSVIDVEMRYRAFWAFYSFERLVATSLGRISCLS------DDDI 436

Query: 604 NLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKR------DAQDLNLNETV----QLR 653
           ++   +   +EE D   E T  M+ L  I  +  ++        + LN  E      +LR
Sbjct: 437 SVPPPRALFEEEKDDI-EVTNMMISLRRIGGRIYRKVHSVGAARRKLNAEEKKNVIDKLR 495

Query: 654 SQLGQWYDTFIVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLI-APSSTANN 712
            +L + Y        +   + N   F+       + D  L+    QL  +I  PS+    
Sbjct: 496 QELDELYKLETFKIHSAKQETNNITFH-------HSDTWLSMRYYQLQIMIYRPSALIPK 548

Query: 713 KSLEYVVDTELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHA---- 768
            +++ +    +L   C  +++    + +  L  + W      LF V  IC   L+     
Sbjct: 549 PAMDSLT---ILGDACLKSLKYTYNLYQKKLLPLNWI----TLFRVLTICNTMLYCLCQW 601

Query: 769 GIAVTQNKAIMQSCQEIWR 787
            I + ++K  +  C E+ R
Sbjct: 602 SIDIIESKIEIHQCIEVLR 620

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor singleton,
           hypothetical start
          Length = 1253

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 21/98 (21%)

Query: 65  ALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSK--------------- 108
           ++ +    + +  + R RV  +C +C+KRKVKCD   P C  C K               
Sbjct: 3   SITSPGTGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQTWA 62

Query: 109 --HQKECRYDFKATNRKRRRRQVASAVRDVSKTYAETS 144
              +KE   D   +  K+ R +V S    +SK +A T+
Sbjct: 63  EEAEKELSKD---SELKQLRERVKSLEETLSKVHATTT 97

>Kwal_26.6732
          Length = 676

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASA 132
           R    C  C+KR+ KCD   P C  C  +  +C +      R RR+R  ASA
Sbjct: 7   RSVTGCLTCRKRRKKCDERKPVCTGCESNFLQCTWPDYNGGRVRRKRGCASA 58

>Kwal_55.21884
          Length = 882

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGN----NPCLNCSKHQKEC--RYDFKATNRKRRRR 127
           K + +GR R + AC  C+++K KCD +     PC  C+K    C  + DF+ T ++ R  
Sbjct: 19  KSSRRGR-RKKLACVECRQQKSKCDAHEKAPEPCTRCAKKNVACVLQKDFRRTYKRVRNE 77

Query: 128 QVASAVRDVSKTYA 141
            +    ++++K+ +
Sbjct: 78  VIEKRFKELTKSLS 91

>YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription factor
           regulating genes of branched chain amino acid
           biosynthesis pathways, acts as both a repressor and an
           inducer [2661 bp, 886 aa]
          Length = 886

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 7/82 (8%)

Query: 86  ACELCKKRKVKCDGN----NPCLNCSKHQKEC--RYDFKATNRKRRRRQVASAVRDVSKT 139
           AC  C+++K KCD +     PC  C+K    C  + DF+ T ++ R   +    +++++T
Sbjct: 36  ACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRT 95

Query: 140 YAE-TSESFPRDLLSKSNIIIN 160
               TS+   + +  +  I+++
Sbjct: 96  LTNLTSDEILKKIEEEQEIVLD 117

>Scas_703.29
          Length = 894

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 76  NGKGRLRVQK-ACELCKKRKVKC---DGNN----PCLNCSKHQKECRYDFKATNRKRRRR 127
           N  G+L+    AC  C   K KC   D N+    PC  CS++++ C++D     RKR+ +
Sbjct: 50  NEVGKLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKFDLSKRTRKRKPK 109

Query: 128 QVASAVR 134
             A+  R
Sbjct: 110 NSATPSR 116

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 63  DDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATN 121
           DD+  TS    +E+ +       +C  C++ K KC    P C NCS+  +EC Y  +A  
Sbjct: 3   DDSATTSITTDRESQQNE---PYSCSRCRRLKKKCSKELPACRNCSRAGEECTYPGRAAR 59

Query: 122 RKRRR 126
           R +++
Sbjct: 60  RTKKQ 64

>Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement
          Length = 532

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 73  SKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQ--KECR 114
           S E  + R  +QKAC  C ++ ++CD   PC NC +     ECR
Sbjct: 6   SVEEKQTRKPIQKACVFCHEKHLQCDVGRPCQNCLRRNIGHECR 49

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
           of the abundant RSC chromatin remodeling complex [2658
           bp, 885 aa]
          Length = 885

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 78  KGR-LRVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           +GR ++   AC  C+KRK+ CD   P C NC KH K +C Y
Sbjct: 4   RGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFY 44

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNC-SKHQKECRYDFKATN 121
           + R +V K+C  C+KRK+KCD   P C  C +++  EC Y  K T+
Sbjct: 10  RKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTH 55

>Kwal_26.7014
          Length = 654

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYA 141
           R + AC  C++R+ KC+   PC +C K + +C  + +     R++R  AS V+ +    A
Sbjct: 30  RKRLACSNCRRRRKKCNMEYPCASCVKLKVDCNVNMEDM---RKKRYAASYVKSLEAHVA 86

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 83  VQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYA 141
           + +AC+ C+K+K KC    P C NC K+  +C Y  +       R  +      V++   
Sbjct: 91  MHQACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAHLTEMENRVAELEQ 150

Query: 142 ETSESFP 148
              E FP
Sbjct: 151 FLKELFP 157

>Scas_449.1
          Length = 636

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRDV 136
           R + AC  C++R+ KCD N PC NC +    C  +       R++R  +S V+ +
Sbjct: 32  RKRLACSNCRRRRKKCDLNFPCANCIRLGLNCNVN---EEDMRKKRYTSSYVKSL 83

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
           Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 9/51 (17%)

Query: 85  KACELCKKRKVKCDGNNPCLNCSKHQKE--CRYDFKATNRKRRRRQVASAV 133
           KACE C ++ + CD   PC+NC K  +   CR        K R++   S V
Sbjct: 3   KACEFCHEKHLHCDPGRPCINCVKRNRGQLCR-------DKERKKSKKSGV 46

>CAGL0L09691g complement(1039799..1042273) some similarities with
           sp|P25502 Saccharomyces cerevisiae YKL015w PUT3 positive
           activator of the proline utilisation pathway,
           hypothetical start
          Length = 824

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 56  MTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115
           M  +    + +  S+ +S    + R+    AC  C+++ +KC G NPC  C      C Y
Sbjct: 1   MGTVSGKGNGVRKSSTSSDPPTEKRV----ACLRCRQKHIKCPGGNPCAKCVISSATCEY 56

>AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W
           (EDS1) - NSH] complement(550291..552861) [2571 bp, 856
           aa]
          Length = 856

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 73  SKENGKGRLRVQKACELCKKRKVKC---DGNNPCLNCSKHQKECRYD 116
           S  +G+ R +V +AC+ C+++K+KC   +    C  C K+ + C ++
Sbjct: 32  SAGDGRRRTKVSRACDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFE 78

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
           (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
            S   +K  G+ R ++   C+ C++ K KCD   P C  C K+   C YD +   + + R
Sbjct: 21  VSGKVTKTKGR-RNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVCVYDVETQTKPKSR 79

>Kwal_47.16939
          Length = 669

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 9/77 (11%)

Query: 77  GKGRLRVQKACELCKKRKVKCD--GNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVR 134
             G  +  K C  CKK KVKC+   + PC  C++H  +C Y      R  R  + +S++ 
Sbjct: 3   ANGNRKRTKPCSNCKKNKVKCEYLSSLPCQRCARHSLKCYY---LDGRPPRNAEASSSLE 59

Query: 135 ----DVSKTYAETSESF 147
                V      +SE F
Sbjct: 60  TNPNTVEAILPSSSEPF 76

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component of
           the abundant RSC chromatin remodeling complex [2652 bp,
           883 aa]
          Length = 883

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           ++R   AC  C+KRK+ CD   P C NC K+ K +C Y
Sbjct: 8   KVRKPPACTQCRKRKIGCDRAKPICGNCVKYNKPDCFY 45

>Scas_699.7
          Length = 935

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 85  KACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRD 135
           +AC+LC+ +K+KC    P C  C K+  EC Y  K T R    R   + V D
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPK-TRRSPLTRAHLTKVED 61

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [2592 bp, 863 aa]
          Length = 863

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 73  SKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSK 108
           S+   K R R+   C  CKKRK KCD   PC  C +
Sbjct: 5   SQVRTKKRHRITVVCTNCKKRKSKCDRTKPCGTCVR 40

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes singleton, start by
           similarity
          Length = 673

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 62  TDDALDTSTAASKENGKGRLRVQK-ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
            D   DT+ +   E  K + +  K  C  CK++KVKCD   P C  C+    EC Y  K
Sbjct: 2   ADTTPDTAVSNVTEPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLECVYKTK 60

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
           Saccharomyces cerevisiae YLR451w LEU3 transcription
           factor, hypothetical start
          Length = 940

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 86  ACELCKKRKVKCDGNN----PCLNCSKHQKEC--RYDFKATNRKRRRRQVASAVRDVSKT 139
           AC  C+++K KCD ++    PC  C K    C  + DF+ T ++ R   +    ++++ T
Sbjct: 57  ACVECRQQKSKCDAHDKAPEPCTRCQKKGVPCVLKKDFRRTYKRARNEAIEKRFKELTAT 116

Query: 140 YAETS 144
            +  S
Sbjct: 117 LSNLS 121

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCS 107
           K R R    C  CKKRK+KCD   P C NCS
Sbjct: 19  KKRQRTTVVCTNCKKRKIKCDRKRPACSNCS 49

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSK 108
           R  +Q ACE C  + ++CD   PC NC K
Sbjct: 13  RKSIQTACEFCHTKHIQCDVGRPCQNCLK 41

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 2/64 (3%)

Query: 57  TAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-R 114
           T     D+AL     +     + R +    C  C+ RKVKCD   P C  C K   +C  
Sbjct: 14  TPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGG 73

Query: 115 YDFK 118
           YD K
Sbjct: 74  YDIK 77

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, 601
           aa]
          Length = 601

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 84  QKACELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
           +K C  CKK   KCD   P CL C K   EC Y
Sbjct: 18  RKGCLQCKKSHTKCDETKPACLKCVKRNVECTY 50

>Scas_715.3
          Length = 1115

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query: 49  RKERFREMTAIGNTDDA------LDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNN- 101
           +K+R   +T +G   D       +D     S  +     R   +C  C+++K+KCD +  
Sbjct: 62  KKQRHSSVTPVGTPIDMSRHHLHMDRMRTESFSHNSLNHRPVTSCSHCRQQKIKCDASQN 121

Query: 102 ---PCLNCSKHQKECRYDFKATNRKRRRRQ 128
              PC  C K   +C+ D +   +K  + Q
Sbjct: 122 FPAPCSRCQKMALQCQIDPRFKPKKGSQLQ 151

>Scas_573.4
          Length = 1478

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 56  MTAIGNTDDALDTSTAASKENGKG--------RLRVQKACELCKKRKVKCDGNNP-CLNC 106
           ++ +  ++  L  + ++S  N  G        R RV  +C +C+KRKVKCD   P C  C
Sbjct: 4   VSPVSFSNTPLSATDSSSHANANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQC 63

Query: 107 SK 108
           +K
Sbjct: 64  TK 65

>Scas_711.18
          Length = 509

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 79  GRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVAS 131
            R  +  ACE C  + ++CD   PC NC K  +      K T RK+++R+  +
Sbjct: 26  ARKSIPIACEFCHIKHLQCDVGRPCKNCIK--RNIGNTCKDTVRKKKKRETEA 76

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [2361 bp, 786 aa]
          Length = 786

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 56  MTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNC-SKHQKEC 113
           M+  G+  D    S    K+  K R  + K+C  C+KRK++CD   P C  C ++ +  C
Sbjct: 1   MSKRGSLQDRASPSEETVKKAQKRRKPI-KSCAFCRKRKLRCDQQKPMCSTCKTRGRSGC 59

Query: 114 RYDFKATNRKRRRRQVASA 132
            Y  K T++   +    S 
Sbjct: 60  LYTEKFTHKIETKELFGST 78

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
           Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           K R +  K+C  C+KRK+KCD   P C +C++
Sbjct: 28  KKRFKPLKSCAFCRKRKLKCDKQKPRCSSCAR 59

>Kwal_33.13934
          Length = 797

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 72  ASKENGKGRLRVQK------ACELCKKRKVKCDGNNP-CLNCSK--HQKECRYDFKATNR 122
           A  +NG+  LR +K       C  CK+RK KCD   P C NCS+   Q  C Y  +  N+
Sbjct: 2   AYPDNGENELRTKKRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLGDQATCVYGPELGNK 61

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [2118 bp, 705 aa]
          Length = 705

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGNNP-CLNC-SKHQKECRYDFKATN-----RKRRR 126
           K + + R +  K+C  C+ RK+KCD   P C +C S+++K+C Y    +      RK+ R
Sbjct: 11  KLDRQSRRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRNRKQCEYKENTSAMEDQLRKKYR 70

Query: 127 R 127
           R
Sbjct: 71  R 71

>Kwal_8.580
          Length = 638

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 83  VQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRYDFKATNRKRRRRQVASAV 133
           V KAC+ C+ RK KC G+ P C NCS     +C Y      RK  +   A ++
Sbjct: 13  VSKACDNCRLRKAKCSGDLPVCRNCSTAGTIKCTYSLADKRRKTNKDSKARSL 65

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
           Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYD 116
           K R +  ++C +C++RK KCD   P C  C K   EC Y+
Sbjct: 3   KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIYN 42

>Scas_688.17
          Length = 769

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY--DFKATNRKRRRRQVASAVRDVS 137
           AC  C+KRK+ CD  +P C NC K ++ +C Y  +F   +   R  + AS ++ +S
Sbjct: 16  ACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIYPDEFHTASELLREMEKASPLQTLS 71

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
           Saccharomyces cerevisiae YLR014c PPR1 transcription
           factor regulating pyrimidine pathway, hypothetical start
          Length = 887

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 14/94 (14%)

Query: 78  KGRLRVQK-------------ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRK 123
           KG+ RV K             AC+LC+++KVKCD   P C  C ++   C      T + 
Sbjct: 3   KGKKRVSKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVDPVTGQD 62

Query: 124 RRRRQVASAVRDVSKTYAETSESFPRDLLSKSNI 157
             R  V      +S   ++ SE     +  KSN+
Sbjct: 63  IPRSYVFFLEDSLSNMMSKLSECGINPMTIKSNV 96

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/221 (16%), Positives = 75/221 (33%), Gaps = 37/221 (16%)

Query: 511 ESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWH 570
           +  E +   LL+  Y          W  +   + +   + L+  K    +  +       
Sbjct: 409 DRLEALMGTLLLAIYSIMRPNVPGVWYTMGSVLRLTVDLGLHSEKINMTYDPFTREIRRR 468

Query: 571 CFWCCFIMDKLISFQMGRFYQLS-----------LPASEMCEQMNLVKSKKFLQEEDDWF 619
            FWC + +D+ +    GR + +            LP SE+      ++    ++ +   +
Sbjct: 469 LFWCVYSLDRQVCSYFGRPFGIPEDTITTGYPSLLPDSEITPAYGTIEDYSDVKPKSISY 528

Query: 620 HEETFQMLDLSIIVTQFLK----------RDAQDLNLNETVQLRSQLGQWYDTFIVGSQ- 668
            +    M  +  +  + ++          R   DL       + S+L  WYD  +  SQ 
Sbjct: 529 KKLAIAMFAIRQLQAKIVRVLYAPHAEIPRKYNDLE-EWRAAVHSELNAWYDKAVPRSQK 587

Query: 669 -------TNAYDDNYRYFYQVQ-------PFMTYLDIRLTF 695
                  ++ ++ NY Y   +        P +T L  RL F
Sbjct: 588 MIDCHYNSSLFELNYHYTKSILYGLSPKCPILTELSCRLVF 628

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
           Saccharomyces cerevisiae YMR168c CEP3 kinetochore
           protein complex, start by similarity
          Length = 611

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 85  KACELCKKRKVKCDGNNPCLNCSKHQKE 112
           + C +C KRKVKCD   PC +C K   E
Sbjct: 12  RPCSVCSKRKVKCDRLVPCGHCRKRGTE 39

>Kwal_47.17565
          Length = 628

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 80  RLRVQKACELCKKRKVKCDGNNPCLNCSKH--QKECRYDFK 118
           R R  K C+ C + K+KC+  +PC NC++      C Y FK
Sbjct: 6   RHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHCVYGFK 46

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, hypothetical
           start
          Length = 922

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
           + +  C+ CK+R+VKCD   P C  CS     C Y     N+  ++
Sbjct: 43  KSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVCVYSTVVDNKVAKK 88

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           R RV  +C +C++RKVKCD + P C  C K
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVK 93

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           + R R+  +C +C+KRKVKCD   P C  C+K
Sbjct: 55  RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTK 86

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
           regulatory protein for thiamine pyrophosphokinase
           (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 70  TAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
            A+S +    + R    C  C+ +K +CD N P C  C+KH   C YD +
Sbjct: 13  VASSSKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIR 62

>YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-finger
           protein required for transcriptional activation of CHA1,
           has a Zn[2]-Cys[6] fungal-type binuclear cluster domain
           [1947 bp, 648 aa]
          Length = 648

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 65  ALDTSTAASKENGKGRLRVQK-ACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRK 123
           +L  S   + +N     R +K AC+ C++R+ KC+   PC NC K + EC +  +    K
Sbjct: 21  SLKKSVTDNDQNNNNVPRKRKLACQNCRRRRRKCNMEKPCSNCIKFRTECVFTQQDLRNK 80

Query: 124 RRRRQVASAVRDVSKTYAETSESFPRDLLSKSNII 158
           R            S TY E  +S  R L  +  I+
Sbjct: 81  R-----------YSTTYVEALQSQIRSLKEQLQIL 104

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 44/108 (40%), Gaps = 10/108 (9%)

Query: 515 LIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAW----- 569
           +IQ+ L + FY          W     A  + + + L+LN  PE  S   E +       
Sbjct: 310 IIQTLLCLAFYDIGSGENPMAWYLSGLAFRIAHEIGLHLN--PEAWSNVYEDELSIMDFE 367

Query: 570 ---HCFWCCFIMDKLISFQMGRFYQLSLPASEMCEQMNLVKSKKFLQE 614
                +W C+I D LI+   GR   L L  S + E   L + +  ++E
Sbjct: 368 VRSRIYWGCYIADHLIAILFGRSTSLRLSNSTVPETDELPEIETGIEE 415

>Kwal_27.9688
          Length = 841

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118
           R++    C  C+ RKVKCD   P C  C K   EC  YD K
Sbjct: 16  RVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIK 56

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 71  AASKENGK---GRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118
             S +NG    GR +    C  C+ RKVKCD  +P C  C K    C  YD K
Sbjct: 2   GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54

>Scas_626.6
          Length = 839

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118
           R +    C  C+ RKVKCD   P C+ C K   EC  YD K
Sbjct: 14  RAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIK 54

>Scas_711.31
          Length = 932

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 81  LRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR 126
           ++ ++AC+ C+ +K+KCD   P C  C K    CR     T R +RR
Sbjct: 39  IKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPCR----TTERLKRR 81

>Kwal_14.778
          Length = 665

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 9/82 (10%)

Query: 507 TFEWE-SFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDE 565
            +EW  S  L+QS L + ++  +  R T  +     A+     + L        H +   
Sbjct: 261 VYEWATSVSLVQSLLYMAYFALSLNRTTFAFVITGDAIRTMFTLGL--------HKSTSS 312

Query: 566 SKAWHCFWCCFIMDKLISFQMG 587
            +    FW CFI D+L++ + G
Sbjct: 313 VRGNRVFWLCFIYDRLLAVRFG 334

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 12/63 (19%)

Query: 83  VQKACELCKKRKVKCDGNNPCLNCSK--HQKECRYDFKATNRKRRRRQVASAVRDVSKTY 140
           + KAC  CK+RK KC    PC  C K    + C Y          R +V S V  V++ Y
Sbjct: 1   MTKACTKCKQRKKKCSKTLPCEYCLKIDQPQGCEY----------RSRVKSKVAKVTERY 50

Query: 141 AET 143
             +
Sbjct: 51  ISS 53

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
           cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 85  KACELCKKRKVKCDGNNP-CLNC-SKHQKECRYDFKATNRKRRRRQVASAVRDVS 137
           + C  C++RK+KCD   P C  C S+    C Y+     RK +  +V  +V +++
Sbjct: 38  RTCAFCRRRKLKCDNARPMCSTCVSRKFSTCIYEDTVDTRKVKLEEVFDSVPNLT 92

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
           aa]
          Length = 696

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 84  QKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYAE 142
           +K C  CKK  +KCD   P C  C+K    C Y+              S+ R + K   +
Sbjct: 58  RKGCSQCKKSHIKCDKVQPLCTTCAKKNILCTYELSFVFED------GSSKRKILKRLPK 111

Query: 143 TSESFPRDLLS 153
           T +  P+++++
Sbjct: 112 TKKKRPQEIVT 122

>Kwal_56.24566
          Length = 755

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 58  AIGNTDDALDTSTAASKENGKG-RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
               T  A+ T  +A+    +  R R +  C  C+ R+ KCD   P C  CSKH  +C +
Sbjct: 2   GAATTQPAISTGNSATALMLRPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKCIW 61

Query: 116 DFKATNR 122
             K   R
Sbjct: 62  PRKGQGR 68

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
           complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
           K R+R    C  C+ +K +CD   P C  C KH   C YD +
Sbjct: 15  KPRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDACSYDVR 56

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
           transcription regulator of ARO9 and ARO10, member of the
           Zn2Cys6 transcription factor family [2853 bp, 950 aa]
          Length = 950

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 80  RLRVQKACELCKKRKVKCD-------GNNPCLNCSKHQKEC 113
           R R  +AC  C+ RKVKCD        + PC  C +  K+C
Sbjct: 18  RRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>KLLA0E14036g complement(1239566..1241602) some similarities with
           ca|CA4758|CaPPR1 Candida albicans transcription factor
           regulating pyrimidine pathway (by homology),
           hypothetical start
          Length = 678

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRR---RQVASAVRDVSKTYA 141
           AC  CK+R+ +CDG  P C  C     +C +  K T R+  R    ++ S V D+     
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDYIDRLESKVFDLESKLR 125

Query: 142 ETSE 145
            T E
Sbjct: 126 STEE 129

>KLLA0C08657g 757100..759268 some similarities with
           ca|CA3551|IPF13229 Candida albicans unknown function,
           hypothetical start
          Length = 722

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 5/50 (10%)

Query: 72  ASKENGKGRLRVQKACELCKKRKVKC-----DGNNPCLNCSKHQKECRYD 116
           A K   K   R  KAC+ CKK K KC      G   CL C   ++ C ++
Sbjct: 9   AKKTPAKRGTRGVKACDYCKKLKAKCVPSPVPGEVRCLRCDSLKRHCSFE 58

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
           transcriptional activator of multidrug resistance genes
           such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAV 133
           +C  C+K K KC    P C NC K+   C Y  +A   +R ++++A A+
Sbjct: 21  SCARCRKLKKKCGKQIPTCANCDKNGAHCSYPGRAP--RRTKKELADAM 67

>Scas_680.25
          Length = 738

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVA 130
           +C  C++ K KC    P C NC K    C Y  +A  R +R  + A
Sbjct: 15  SCSRCRRLKKKCPRQTPSCANCEKAHATCIYVGRAPRRTKRELEEA 60

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
           cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKH 109
           K+  K R R    C  C+KRK KCD   PC  C +H
Sbjct: 5   KKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQH 40

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
           with similarity to transcription factors, contains an
           N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
           domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 54  REMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKE 112
           RE+   GN  D L        ++ KGR R   +C LC++RK +CD   P C  C K   +
Sbjct: 18  RELELAGNRTDVL-------LQDKKGRSR---SCLLCRRRKQRCDHKLPSCTACLKAGIK 67

Query: 113 C 113
           C
Sbjct: 68  C 68

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
           Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
           Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           +++   AC+ C++RK+ CD   P C NC K  K +C Y
Sbjct: 9   KVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDCFY 46

>Scas_674.12*
          Length = 909

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDF 117
           + R    C +C+ +KVKCD   P C  C K  K C Y+ 
Sbjct: 8   KARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLCVYEI 46

>Scas_526.3
          Length = 1109

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 16/76 (21%)

Query: 51  ERF-REMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           E+F +E+ A G+  D L        ++ KGR R   +C LC++RK +CD   P C  C K
Sbjct: 14  EQFQKELEAAGDRTDVL-------LQDKKGRSR---SCLLCRRRKQRCDHKMPSCTACLK 63

Query: 109 HQKEC----RYDFKAT 120
              +C    RY   A+
Sbjct: 64  AAVKCVQPARYSSPAS 79

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
           Saccharomyces cerevisiae YKR064w singleton, start by
           similarity
          Length = 657

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
           K R R    C  C++RK KCD   P C NC K  + C Y
Sbjct: 12  KKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVY 50

>Scas_721.94
          Length = 869

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 66  LDTSTAASKENGKGRL--RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNR 122
           +D    ++   GK +   + ++ C  CK+R+VKCD   P C  C      C Y       
Sbjct: 32  VDGKKVSATSTGKRKFHNKSKQGCTHCKRRRVKCDELKPACRRCLNWNVPCVYPV----V 87

Query: 123 KRRRRQVASAVRDVSK 138
           + ++R+V++ V+ +++
Sbjct: 88  QPKKRKVSTVVKYITR 103

>Scas_597.2
          Length = 540

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 28/128 (21%)

Query: 37  SRQIDRTWAHTNRKERFREMTAIGNTDDALDTSTAASKENGKGRLR-VQKACELCKKRKV 95
           S  ID T   +N   RF E T +G         +A  K++  G+ R +  AC  C K   
Sbjct: 2   SMTIDETMMASN-INRF-EATMVG--------PSAKEKKSQTGKRRKINVACSNCAKSHS 51

Query: 96  KCDGNNPCLNCSKH--QKECRYDFKATNRKRRRRQVASAVRDVSKTYAETSESFPRDLLS 153
            CD   PC  C K   Q  C       ++ R++R+    + DV           P  L S
Sbjct: 52  SCDSCRPCSRCIKKELQDSC------VDKPRKKRKYLDGIPDV---------KLPNQLRS 96

Query: 154 KSNIIINA 161
           +  + ++A
Sbjct: 97  EEPVTVSA 104

>YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys[6]
           zinc finger transcription factor, likely involved in
           pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 71  AASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCS-KHQKECRY 115
            +S + GK R +V K+C  C+KRK+KC    P C  C  +   +C Y
Sbjct: 16  VSSGKKGKRR-KVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCVY 61

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
           Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 514 ELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYD-ESKAWHCF 572
           EL  S LL+ +  RT       +  +   +N+C    L L+K+   H+     SK    F
Sbjct: 578 ELELSTLLVLYIVRTDSDSMLLYEIIKDVMNICKN-KLQLHKW---HANDQFASKKLRLF 633

Query: 573 WCCFIMDKLISFQMGRFYQL 592
           WC ++++++I   +G+ Y +
Sbjct: 634 WCVYLLERMICVAVGKPYTI 653

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 12/65 (18%)

Query: 51  ERF-REMTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSK 108
           ERF RE+   G+  D L        ++ KGR R   +C LC++RK +CD   P C  C K
Sbjct: 14  ERFQRELELAGDKLDVL-------LKDKKGRSR---SCLLCRRRKQRCDHKLPSCTACLK 63

Query: 109 HQKEC 113
              +C
Sbjct: 64  AAVKC 68

>Scas_709.65*
          Length = 651

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 13/96 (13%)

Query: 59  IGNTDDALDTSTAASKENG--KGRLRVQKACELCKKRKVKCDGNNP---CLNCSKHQKEC 113
           + +TD   + S     E    + R +  +AC+ C  R++KCD N     C  C K +++C
Sbjct: 14  LSHTDGPNNLSVVNKPERSYNRKRKKASRACDQCHHRRIKCDFNPETRNCSGCEKTEEKC 73

Query: 114 --------RYDFKATNRKRRRRQVASAVRDVSKTYA 141
                   R   K   R R+     S   +VS T A
Sbjct: 74  LFNRIPMKRGPAKGYIRSRKGSVTMSPRINVSLTSA 109

>KLLA0D09977g complement(841852..843756) weakly similar to sp|P40969
           Saccharomyces cerevisiae YMR168c CEP3 kinetochore
           protein complex, 71 KD subunit singleton, start by
           similarity
          Length = 634

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 87  CELCKKRKVKCDGNNP-CLNCSKHQ--KECRYDFKATNRKRRRRQVASAV 133
           C  C+ RKVKCD + P C NC +    + C YD    N  R+R ++A  V
Sbjct: 15  CTFCQARKVKCDRSLPACQNCIERNVTELCEYD---DNGSRKRARLADDV 61

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
           Saccharomyces cerevisiae YLR451w LEU3 transcription
           factor, hypothetical start
          Length = 925

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 86  ACELCKKRKVKCDGN----NPCLNCSKHQKEC--RYDFKATNRKRRRRQVASAVRDVSKT 139
           AC  C+++K KCD +     PC  C K    C  + DF+ T ++ R   +A   ++++++
Sbjct: 48  ACVECRQQKSKCDAHERAPEPCSRCLKKGVPCVLQKDFRRTCKRARNEVIAKKFQELTQS 107

Query: 140 YA 141
            +
Sbjct: 108 LS 109

>Scas_588.11
          Length = 835

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 78  KGR-LRVQKACELCKKRKVKCDGNNP-CLNCSKHQK 111
           +GR +R   AC  C+KRK+ CD   P C NC K  K
Sbjct: 4   RGRKMRKPPACVQCRKRKIGCDRVKPICGNCRKTNK 39

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
           (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 78  KGR-LRVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           +GR ++   AC  C+KRK+ CD   P C NC ++ K +C Y
Sbjct: 6   RGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFY 46

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
           (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
           R  V +AC+ C++RK+KC    P C  C +  + C Y  K
Sbjct: 2   RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPK 41

>KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05854
           Saccharomyces cerevisiae YLR278c, start by similarity
          Length = 1269

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 75  ENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC------RYDFKATNRKRRRR 127
           ++ KGR R   AC LC++RK KCD   P C  C K   +C       YD     +   + 
Sbjct: 32  KDKKGRSR---ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYDGAVGEQSSPQS 88

Query: 128 QVASAVR 134
            VA+  R
Sbjct: 89  SVATVTR 95

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 5/67 (7%)

Query: 527 RTCYRQTACWNALSQAVNMCNGMSLYLNKF-PEIHSTYDESKAWHCFWCCFIMDKLISFQ 585
           RT       +  +    N+C    L+LNK+ P+    Y   K    FWC ++++++I   
Sbjct: 519 RTDRDSIGLYEIIKDVTNICKN-KLHLNKWNPKDPFAY---KKLRLFWCVYLIERMICVA 574

Query: 586 MGRFYQL 592
           +G+ Y +
Sbjct: 575 VGKPYTI 581

>Scas_691.32
          Length = 906

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 86  ACELCKKRKVKCD----GNNPCLNCSKHQKEC--RYDFKATNRKRRRRQVASAVRDVSKT 139
           AC  C+++K KCD      +PC  C K    C  + DF+ T ++ R   +    ++++ +
Sbjct: 45  ACVECRQQKSKCDAYEKAPDPCTKCQKKGVPCVLKKDFRRTYKRARNELIEKRFKELTNS 104

Query: 140 YAETS 144
               S
Sbjct: 105 LTNLS 109

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
           Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
           activator, start by similarity
          Length = 727

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 66  LDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRR 125
           L   + AS E    RL    AC  C++R+ KCD   PC  C +    C  + K   RK+R
Sbjct: 24  LQMDSEASSEPPAKRL----ACANCRRRRKKCDLEYPCGRCQELGLGCNIN-KVDLRKKR 78

>KLLA0B04422g 394524..395585 similar to sp|P25335 Saccharomyces
           cerevisiae YIR029w DAL2 allantoinase singleton, start by
           similarity
          Length = 353

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 33/76 (43%)

Query: 669 TNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYVVDTELLISHC 728
           T  +  N+  F  V    T  +   + +     CL+  S T  +K  EYV++  L I+H 
Sbjct: 276 TAHFRGNFPQFITVHGIKTLGESAPSHDDSNWICLVDKSKTGPDKEHEYVINKSLEITHI 335

Query: 729 QMAIENLAEITRSNLF 744
           ++ I     + R  +F
Sbjct: 336 KLTIIPDGGVKRVRVF 351

>KLLA0F18084g complement(1652031..1654613) no similarity,
           hypothetical start
          Length = 860

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVA 130
           +C+ C+K + KCD   P C  C K++ +C Y+    ++ ++   + 
Sbjct: 4   SCQNCRKTRRKCDRGKPTCARCIKYKIDCVYELPPKHKIKQSVDIG 49

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 71  AASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDF 117
           A +K+      R +  C +C+ RK KC    P C NC +   EC YD 
Sbjct: 664 APNKKKAGAGTRSRTGCWICRLRKKKCSEERPQCSNCLRLNLECVYDI 711

>KLLA0B04620g complement(413129..415888) some similarities with
           sp|Q03631 Saccharomyces cerevisiae YML076c singleton,
           hypothetical start
          Length = 919

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 62  TDDALDTSTAASKENGKGRL-RVQKACELCKKRKVKCDGNNP-------CLNCSKHQKEC 113
            DD+   +  + + N  G++ R   AC  C   K KC+  +P       C+ C+K  K C
Sbjct: 38  ADDSRHFTPMSKETNADGKVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKIC 97

Query: 114 RYDF 117
           ++D 
Sbjct: 98  QFDL 101

>Scas_720.58
          Length = 890

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 1/67 (1%)

Query: 83  VQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYA 141
           +++AC+ C+ +K+KC    P C  C K+  +C Y  K       R  +      + K   
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTRVHLTQTENKLEKLER 75

Query: 142 ETSESFP 148
              E FP
Sbjct: 76  LFIELFP 82

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 74/207 (35%), Gaps = 34/207 (16%)

Query: 395 SLINKLLRYYFDEINPVFSIIHEATFWQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTL 454
           ++ +K ++ YFD  +  + I+ +  F + YNN                            
Sbjct: 231 TMTSKFIQSYFDNFHIYYPIVKKDFFLRIYNNG--------------------------- 263

Query: 455 RFREGHLDGQKGQGTYSNTSLNITFEEKSILIKKPSIEENLFKY--AYLIINTLTFEWES 512
                HL G   +  +    LNI     +  +   + E +LF Y  A   +    FE  S
Sbjct: 264 ----NHLTGPNDKQVWQ-LLLNIVLAIGAWCVDGDATEIDLFYYQSAKSHLTGKLFESGS 318

Query: 513 FELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWHCF 572
             L+  + L++ Y +   +  + +  +  ++ +   + LY      I       +    +
Sbjct: 319 TRLVVCFFLLSKYAQWRQKSNSAYQYIGHSLRLATSLGLYKELPNTIQDKLAIEQRRRTW 378

Query: 573 WCCFIMDKLISFQMGRFYQLSLPASEM 599
           W  F  D  IS   GR  Q SLP  E+
Sbjct: 379 WSIFNQDFKISLLFGRPLQCSLPFEEI 405

>ACR107W [1154] [Homologous to ScYPL133C - SH]
           complement(544402..545556) [1155 bp, 384 aa]
          Length = 384

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNPCLNCSKH 109
           K R +V KAC LC++  + CD   PC  C K 
Sbjct: 14  KKRKKVVKACVLCRRSHMICDDRRPCSRCIKR 45

>Sklu_2330.2 YML076C, Contig c2330 2931-5360
          Length = 809

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 7/69 (10%)

Query: 56  MTAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKC---DGNN----PCLNCSK 108
           +  +   D  L +  + SK +G    R   AC  C   K KC   D NN    PC  C K
Sbjct: 33  IIGVPPDDPRLHSPVSLSKNDGGKPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMK 92

Query: 109 HQKECRYDF 117
             + C++D 
Sbjct: 93  CNRTCKFDL 101

>Scas_717.33
          Length = 904

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 63  DDALDTSTAASKENGKGRLRVQKACELCKKRKVKCD-------GNNPCLNCSKHQKEC 113
           D+A  T++  S  + K + R  +AC  C+ RKVKCD          PC+ C +  K C
Sbjct: 11  DEAGTTASKRSSRDIKWQ-RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQV 129
           ACE C+ +K KCD N P C  C+   + C     AT R   R  V
Sbjct: 39  ACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSYV 83

>Kwal_26.8109
          Length = 970

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 80  RLRVQKACELCKKRKVKCD--GNNP-CLNCSKHQKECRYD 116
           R +  +AC+ C+ +K +CD    NP C +C +  K C ++
Sbjct: 32  RSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFE 71

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 1005

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRR 125
           +C  C+K K KC    P C NC K ++ C Y  +A  R ++
Sbjct: 31  SCARCRKLKKKCPRQLPECSNCLKAREPCNYPGRAPRRTKK 71

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118
           R +    C  C+ RKVKCD   P C  C +   EC  YD K
Sbjct: 13  RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
           Saccharomyces cerevisiae YDR303c RSC3, start by
           similarity
          Length = 794

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 78  KGR-LRVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           +GR ++   AC  C++RKV CD   P C NC++  K +C Y
Sbjct: 4   RGRKMKKPPACAQCRRRKVGCDRVRPVCGNCARAGKGDCFY 44

>Scas_700.40
          Length = 407

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 17/33 (51%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNPCLNCSKH 109
           G  + +  K+C  C++  V CDG  PC  C K 
Sbjct: 12  GNKKRKKTKSCLFCRRSHVNCDGKRPCSRCLKR 44

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 78  KGR-LRVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           +GR ++   AC  C+KRK+ CD   P C NC ++ K +C Y
Sbjct: 6   RGRKMKKPPACVQCRKRKIGCDRAKPICGNCLRNGKNDCFY 46

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 81  LRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC 113
           ++    C  C+ RKVKCD   P CL C + + +C
Sbjct: 9   VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42

>Scas_659.10
          Length = 757

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNPCLN 105
           K R +  K+C  C+ RK+KCD N P  N
Sbjct: 12  KRRRKPIKSCAFCRGRKLKCDKNKPICN 39

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYD 116
           R +  C +C+ RK KC    P C NC + + +C YD
Sbjct: 766 RSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYD 801

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 66  LDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDF 117
           + +S    K N  G  R +  C +C+ RK KC    P C NC +   EC YD 
Sbjct: 699 VKSSDQIKKRNATG-ARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLECFYDI 750

>KLLA0D11286g complement(964642..966678) no similarity, hypothetical
           start
          Length = 678

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 2/80 (2%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVSK 138
           R R  K+C  C   K KCD   P C  C K    C Y F   +   R  Q  S +R V  
Sbjct: 19  RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEY-FTEEHVLERCLQRQSNLRSVIH 77

Query: 139 TYAETSESFPRDLLSKSNII 158
             A  S S   + +S+++ +
Sbjct: 78  QKAPASRSSTNETISENDTL 97

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118
            K R++    C  C+ RKVKCD   P C  C K    C  YD K
Sbjct: 4   AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVK 47

>Kwal_14.1636
          Length = 456

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 23/59 (38%), Gaps = 4/59 (6%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAVRD 135
           G  R +   AC  C K  V C    PC  C K   E        +  R+RR+  + V D
Sbjct: 2   GSRRQKTSVACINCSKSHVTCQAERPCTRCVKKGLEA----SCVDAPRKRRKYLADVPD 56

>Kwal_23.2905
          Length = 881

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 79  GRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQV 129
           G  R   AC+ C+ RKVKCD   P C  C    + C     AT R   R  V
Sbjct: 41  GISRSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSYV 92

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 34/90 (37%)

Query: 503 INTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHST 562
           I+ L    +  E +   LLI  Y          W  +  A+ +   + L+  K  + +  
Sbjct: 389 IDALFRSNDRMEALAGTLLIAKYSIMRPNVPGVWYTMGSALRLAVDLGLHAEKLNKNYDP 448

Query: 563 YDESKAWHCFWCCFIMDKLISFQMGRFYQL 592
           +        FWC F +D+ I    GR + +
Sbjct: 449 FTRDFRRRLFWCTFSLDRQICAFFGRPFGI 478

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 67  DTSTAASKENGKGRLRVQKACELCKKRKVKCDGN----NPCLNCSKHQKECRYDFKATNR 122
           D S  + ++NG    R   +C  C++ K+KC+ +    + C  C +   +C  D +   +
Sbjct: 72  DRSKVSKQQNGASGHRPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQCEIDPQFRPK 131

Query: 123 KRRRRQ 128
           K  + Q
Sbjct: 132 KGSQLQ 137

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 11/85 (12%)

Query: 82  RVQKACELCKKRKVKCDGNN----PCLNCSKHQKECRYDFKATNRKRRRRQVASAVRDVS 137
           R   +C  C++ K+KC+ +     PC  C +    C  D +   R ++  Q+ S   DV 
Sbjct: 132 RPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHCEIDPQF--RPKKGSQLQSLRNDVD 189

Query: 138 K-----TYAETSESFPRDLLSKSNI 157
           +      Y   +ES     L +SNI
Sbjct: 190 ELKVKIEYLTRNESLIAKALKQSNI 214

>Kwal_55.20674
          Length = 252

 Score = 31.6 bits (70), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKR 124
           T  + + + GK R      C+ C++RK KC    P C  C++    C Y+    +  R
Sbjct: 2   TLNSRATKMGKDRSGAMFTCKSCRQRKRKCSREKPQCQRCARLSIPCVYELPPKHLMR 59

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
           Transcription factor regulating pyrimidine pathway,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 79  GRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRKRRRRQV 129
           G  + + AC+ C+ +K+KCD   P C  C+K +  C     AT +   R  V
Sbjct: 26  GISKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYV 77

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
           [2454 bp, 817 aa]
          Length = 817

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 87  CELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
           C  C KRKVKC+   P C +C K++  C Y
Sbjct: 38  CMPCHKRKVKCNRARPVCDHCEKNRYACAY 67

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similarity
           to transcription factors, has Zn[2]-Cys[6] fungal-type
           binuclear cluster domain in the N-terminal region,
           involved in resistance to cycloheximide [2499 bp, 832
           aa]
          Length = 832

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYD 116
           K RLR+   C  CKK K KCD   P C  C ++  +C Y+
Sbjct: 8   KPRLRL--VCLQCKKIKRKCDKLRPACSRCQQNSLQCEYE 45

>CAGL0M11440g complement(1125748..1127475) similar to sp|P43634
           Saccharomyces cerevisiae YLR098c CHA4 transcription
           factor, hypothetical start
          Length = 575

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 35/93 (37%), Gaps = 6/93 (6%)

Query: 515 LIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAW----- 569
           +IQ+ L + FY          W     A  +   + L+LN     H   DE         
Sbjct: 239 IIQTLLCLAFYDIGHGDNPMAWYLSGLAFRISYEIGLHLNPEAWAHVYEDELSGVDIEVR 298

Query: 570 -HCFWCCFIMDKLISFQMGRFYQLSLPASEMCE 601
              +W C+I D LI+   GR   L L  S + E
Sbjct: 299 SRVYWGCYIADHLITLLFGRTTILKLSNSTVPE 331

>Kwal_47.17233
          Length = 948

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRY 115
           R R   +C  C KRK+KC    P C  C K   EC Y
Sbjct: 28  RQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSY 64

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
           Saccharomyces cerevisiae YBR240c THI2 regulator of the
           thiamine biosynthetic genes singleton, hypothetical
           start
          Length = 348

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 86  ACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKAT 120
            C  C+ +K KCD   P C  C KH  EC YD + +
Sbjct: 9   GCWACRFKKRKCDERKPICSLCLKHGVECCYDVRLS 44

>Kwal_14.1631
          Length = 443

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 77  GKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
            K + R    C  C+ +K +CD   P C  C KH  +C YD +
Sbjct: 5   SKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQCSYDIR 47

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, start by similarity
          Length = 507

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 15/31 (48%)

Query: 82  RVQKACELCKKRKVKCDGNNPCLNCSKHQKE 112
           +V  AC  C K  V CD N PC  C +   E
Sbjct: 8   KVSVACVHCAKSHVTCDDNRPCTRCIRKGLE 38

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDF 117
           R +  C +C+ RK KC    P C NC++   EC YD 
Sbjct: 536 RSRTGCWICRLRKKKCTEEKPHCNNCTRLNLECFYDI 572

>Kwal_23.6529
          Length = 598

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 82  RVQKACELCKKRKVKCDGNNP-CLNCSKHQK-ECRY 115
           R +  C  CKK K+KCD   P C  C+K  + +C Y
Sbjct: 9   RSRGGCINCKKSKIKCDEKKPMCGQCAKKGRDDCAY 44

>AFL031W [3162] [Homologous to ScYBR239C - SH]
           complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 4/60 (6%)

Query: 74  KENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKATNRKRRRRQVASAV 133
           ++    R +   AC  C +  V C+   PC  C K   E        N  R+RR+  + V
Sbjct: 6   RDKAAKRKKTNVACVNCSRSHVTCESQRPCTRCVKKGLE----MSCVNAPRKRRKYLADV 61

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]
          Length = 109

 Score = 29.6 bits (65), Expect = 3.6,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 4/37 (10%)

Query: 85  KACELCKKRKVKCDGNN----PCLNCSKHQKECRYDF 117
           ++C  C+K K+KCD       PC +C K    C  ++
Sbjct: 29  RSCVRCRKNKIKCDSATRRPKPCSSCLKKGVGCELEY 65

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
           (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 65  ALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFK 118
           ++ TS +  K N   R ++   C  C+K K KCD   P C  C++    C YD +
Sbjct: 3   SIPTSGSVLKPNTHKR-KLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYCGYDIE 56

>Scas_590.2
          Length = 1172

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 78  KGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC 113
           KGR     AC LC++RK KCD   P C  C K   +C
Sbjct: 35  KGR---STACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>Scas_710.10
          Length = 437

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 68  TSTAASKENGKGRLRVQKACELCKKRKVKCDGN 100
           + T+++ +    R R   +C+ C++RK+KCD N
Sbjct: 121 SKTSSTSKAPPIRKRNSSSCDYCRQRKIKCDSN 153

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.133    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,150,210
Number of extensions: 1269298
Number of successful extensions: 4793
Number of sequences better than 10.0: 299
Number of HSP's gapped: 4864
Number of HSP's successfully gapped: 322
Length of query: 933
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 822
Effective length of database: 12,753,511
Effective search space: 10483386042
Effective search space used: 10483386042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)