Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR018W51450526060.0
Kwal_27.117375753384882e-54
CAGL0K11209g5902444761e-52
Scas_721.645784554715e-52
KLLA0C15455g5663744653e-51
YDR244W (PEX5)6122544569e-50
AFR453W5693864461e-48
CAGL0J09570g5493063371e-33
YPR189W (SKI3)143292830.052
YDR135C (YCF1)1515106830.063
CAGL0G10087g141192810.097
Scas_705.55907114780.23
KLLA0B09262g941122760.33
YBL084C (CDC27)75867760.36
KLLA0E20933g71082750.49
CAGL0C01903g76963750.50
Kwal_23.367080279750.51
YBR112C (SSN6)96679750.53
CAGL0D01364g114879740.58
Scas_699.3158490730.73
CAGL0E01573g90459711.4
ADL344W91060711.4
CAGL0F04323g66189692.4
AGL294W65668682.8
Scas_585.491849665.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR018W
         (505 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR018W (YMR018W) [3982] chr13 (310207..311751) Protein containi...  1008   0.0  
Kwal_27.11737                                                         192   2e-54
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...   187   1e-52
Scas_721.64                                                           186   5e-52
KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces...   183   3e-51
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...   180   9e-50
AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH] complement(...   176   1e-48
CAGL0J09570g complement(939447..941096) some similarities with s...   134   1e-33
YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein w...    37   0.052
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    37   0.063
CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces c...    36   0.097
Scas_705.55                                                            35   0.23 
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    34   0.33 
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    34   0.36 
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    33   0.49 
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    33   0.50 
Kwal_23.3670                                                           33   0.51 
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    33   0.53 
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    33   0.58 
Scas_699.31                                                            33   0.73 
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    32   1.4  
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    32   1.4  
CAGL0F04323g 430854..432839 similar to sp|P38121 Saccharomyces c...    31   2.4  
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    31   2.8  
Scas_585.4                                                             30   5.4  

>YMR018W (YMR018W) [3982] chr13 (310207..311751) Protein containing
           three TPR (tetratrico peptide repeat) domains, which may
           mediate protein-protein interactions, has low similarity
           to peroxisomal protein (peroxin, S. cerevisiae Pex5p),
           which is a receptor for peroxisome targeted proteins
           [1545 bp, 514 aa]
          Length = 514

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/505 (97%), Positives = 490/505 (97%)

Query: 1   MNEVTCSITGDNPIHXXXXXXXXXXXXXXXFSDFQTNDSAARDARTIDYIFTNCQTGSSI 60
           MNEVTCSITGDNPIH               FSDFQTNDSAARDARTIDYIFTNCQTGSSI
Sbjct: 1   MNEVTCSITGDNPIHKINNGLGLKWNNLGKFSDFQTNDSAARDARTIDYIFTNCQTGSSI 60

Query: 61  GKIDFRAALPADKSQHSGVSEKEFSRLENQWSKEFSCFPKNKNADVTKPSRNKHEKRSAN 120
           GKIDFRAALPADKSQHSGVSEKEFSRLENQWSKEFSCFPKNKNADVTKPSRNKHEKRSAN
Sbjct: 61  GKIDFRAALPADKSQHSGVSEKEFSRLENQWSKEFSCFPKNKNADVTKPSRNKHEKRSAN 120

Query: 121 LHNRYFAQYYSTAYQQNRIYPCRISYNEHSSVSNGWEFQFKSIENQLLNELKIENNVEEK 180
           LHNRYFAQYYSTAYQQNRIYPCRISYNEHSSVSNGWEFQFKSIENQLLNELKIENNVEEK
Sbjct: 121 LHNRYFAQYYSTAYQQNRIYPCRISYNEHSSVSNGWEFQFKSIENQLLNELKIENNVEEK 180

Query: 181 TVGYEYVAEYEETIDFMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVM 240
           TVGYEYVAEYEETIDFMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVM
Sbjct: 181 TVGYEYVAEYEETIDFMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVM 240

Query: 241 AFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQ 300
           AFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQ
Sbjct: 241 AFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQ 300

Query: 301 QNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLAHILESLLNMGIEKKDQY 360
           QNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLAHILESLLNMGIEKKDQY
Sbjct: 301 QNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLAHILESLLNMGIEKKDQY 360

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC 420
           DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC
Sbjct: 361 DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC 420

Query: 421 KQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKMQNKFMQNLKNA 480
           KQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKMQNKFMQNLKNA
Sbjct: 421 KQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKMQNKFMQNLKNA 480

Query: 481 LIASKNFDSLDLINGSHNTESLIST 505
           LIASKNFDSLDLINGSHNTESLIST
Sbjct: 481 LIASKNFDSLDLINGSHNTESLIST 505

>Kwal_27.11737
          Length = 575

 Score =  192 bits (488), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 183/338 (54%), Gaps = 12/338 (3%)

Query: 163 IENQLLNELK-IENNVEEKTVGYEYVAEYEETIDFMHMLSSVPQT---YQFLKSNIYITE 218
           +E+Q   E + + +N++++  G    AE +   ++   +S  P     Y+F   N ++  
Sbjct: 228 VEDQYQAEFQEVWDNLQDEAHGPGSTAEADWQREYQQYISGRPTATTQYRFESENQFLHN 287

Query: 219 RDPYKIGCVLMDNGSNLNEVVMAFEAAISQDPSHINAWLKLGIVNFENESESNGELALRN 278
            + Y+IGC+LM+NG+ L+E  +AFEAA+ +DP H++AWLKLG+V  +NE E +G  AL  
Sbjct: 288 SNAYEIGCILMENGAKLSEAALAFEAAVQEDPRHVDAWLKLGLVQTQNEMEYSGIGALEE 347

Query: 279 CLNLDPNNTIALENLAIHHINQQNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPK 338
           CL LDP N   +  LAI +IN+  +  + K+  KW+ +K+  +  P    N  S   I +
Sbjct: 348 CLRLDPQNLEGMVTLAISYINEGYDVSAFKMLDKWLETKYPDLVVP----NDSSQTNIDR 403

Query: 339 KAHLAHILESLLNMGIEKKDQYD--IYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTI 396
            +    I    L + + K  Q D  +   L IL+YS+    ++  C    L  +P++  +
Sbjct: 404 YSMNQAITLRFLQV-VNKLPQVDASLQLGLGILFYSNDDYDKTVDCFRAALAVRPDDELM 462

Query: 397 WNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVIL 456
           WNR GA LAN+     AI AY K  QL+P F R R NLA++ MN G Y +A++ L+  + 
Sbjct: 463 WNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNLAVSCMNMGCYKEAAEYLLTALS 522

Query: 457 LRS-KGYEHNKAKMQNKFMQNLKNALIASKNFDSLDLI 493
           +   +G   ++    N  ++ LK A I  +  D L+++
Sbjct: 523 MHEVEGILPSETPASNNLIETLKRAFIGMERRDLLEMV 560

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score =  187 bits (476), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 148/244 (60%), Gaps = 5/244 (2%)

Query: 213 NIYITERDPYKIGCVLMDNGSNLNEVVMAFEAAISQDPSHINAWLKLGIVNFENESESNG 272
           N Y+   + Y+IGC+LM+NG+ L+E  +AFEAAI QDP H++AWLKLGIV  +NE E NG
Sbjct: 280 NQYMNNPNAYQIGCILMENGAKLSEAALAFEAAIKQDPKHVDAWLKLGIVQIQNEKELNG 339

Query: 273 ELALRNCLNLDPNNTIALENLAIHHINQQNESESLKLFHKWILSKFSKVFQPSAGENK-D 331
             AL  CL LDPNN  A++NLAI +IN+  +  +  + ++W  +K+   +  +  E K D
Sbjct: 340 MSALETCLKLDPNNLEAMKNLAISYINEGYDMSAYNMLNRWADTKYPGFYNSAELEGKRD 399

Query: 332 SINKIPKKAHLAHILESLLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKP 391
               I  K  +     SL+N  I   D  DI   L +L+Y++ +  ++  C +  L   P
Sbjct: 400 EHENIHSK--MTRRFLSLVNR-INSVDP-DIQLCLGLLFYANDEFDRTIDCFQAALKVNP 455

Query: 392 NNGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYMNKGDYVKASKML 451
           N+  +WNR GA LAN+     AI AY++  QL+P+F R RYNLA++ MN G Y +A++ L
Sbjct: 456 NDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGCYKEAAEHL 515

Query: 452 IEVI 455
           +  +
Sbjct: 516 LTAL 519

>Scas_721.64
          Length = 578

 Score =  186 bits (471), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 131/455 (28%), Positives = 238/455 (52%), Gaps = 56/455 (12%)

Query: 91  WSKEF----SCFPKNKN---ADVTKPSRNKHEKRSANLHNRYFAQYYSTAYQQNRIYPCR 143
           WS+EF    +  P+N +     VT    + +   S    +R+   Y     QQN  +   
Sbjct: 113 WSREFQYHSAAAPENASMSHGSVTPQQVSLNSDGSMYGKDRFKTSYQPQFTQQNNGFLQY 172

Query: 144 ISYNE-----HSSVSNGWEFQFKSIENQLLNELKIE--------------NNVEEKTVGY 184
                     + +V+  W+ +FK++E++L   L I+              N+++     +
Sbjct: 173 QRQQVQQTPVNQTVNTNWDQEFKNLESELSENLNIKEENPDIIVEDQEGANSMDNTDANF 232

Query: 185 EYVAEYEETIDFM-----HMLSSVPQ---------TYQF---LKSNIYITERDPYKIGCV 227
           EY +E+++  D +      +LS++ +          Y+F    + N ++ + + YKIGC+
Sbjct: 233 EYQSEFQKVWDSLKDDEEDLLSTIEKIDSRELLLFNYKFDSDSRENPFLNKPNAYKIGCL 292

Query: 228 LMDNGSNLNEVVMAFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNT 287
           LM+NG+ L++  +AFEAA+ ++  H++AWL+LGIV  +NE E NG  AL  CL++DP N 
Sbjct: 293 LMENGAKLSDAALAFEAALKENSRHVDAWLRLGIVQIQNEKELNGIAALEYCLDIDPVNL 352

Query: 288 IALENLAIHHINQQNESESLKLFHKWILSKFSKV--FQPSAGENKDSINKIPKKAHLAHI 345
            ALENLAI +IN+  ++ +LK+ ++W+ +K+     ++ +  E+K   + +  +  L+H 
Sbjct: 353 DALENLAISYINEGYDTNALKILNRWVKNKYPNFEHYEATTEESKRIESDL--EDDLSHN 410

Query: 346 LESLL----NMGIEKKDQYD--IYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNR 399
             +++    N   E   ++D  +  +  +LYY++    ++ +C +  L   PN+  +WNR
Sbjct: 411 FNAVMIKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNR 470

Query: 400 YGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILL-R 458
            GA LAN+     AI AY++   L+P+F R RYNLA+A MN G Y +A + L+ V+ + +
Sbjct: 471 LGASLANSNKPEDAIQAYHRALNLKPSFVRARYNLAVASMNIGCYKEAGEHLLTVLRMHQ 530

Query: 459 SKGYEHNKAKMQNKFMQNLKNALIASKNFDSLDLI 493
            +G   N  +  N  ++ LK  L+     D L+ +
Sbjct: 531 VEGV--NNVETDNNVLEILKRVLMGMDREDLLEKV 563

>KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, start by similarity
          Length = 566

 Score =  183 bits (465), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 195/374 (52%), Gaps = 45/374 (12%)

Query: 156 WEFQFKSIENQLLNELKIENNVEEK----TVGYEYVAEYEETID---------------- 195
           W  QF+++E  +   L +E+N EE      V   Y A+++E  D                
Sbjct: 187 WNEQFEALEKAVAENLTMEDNKEETKEEIVVEDGYQADFQEVWDKLQAETADNNLETSDS 246

Query: 196 --------FMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVMAFEAAIS 247
                   +M   ++    Y+F   N Y+   + Y+IGC+LM+NG+ L+E  +AFEAA+ 
Sbjct: 247 QWEKDYARYMTGKATHIPPYRFDNDNQYMHNPNAYEIGCILMENGAKLSEAALAFEAAVQ 306

Query: 248 QDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQQNESESL 307
           +DP+H++AWLKLG+V  +NE E NG  AL  CL+LDP N  AL  ++I +IN+  +  + 
Sbjct: 307 EDPAHVDAWLKLGLVQTQNEKEMNGISALEQCLSLDPTNQQALMTISISYINEGYDLTAF 366

Query: 308 KLFHKWILSKFSKVFQ-PSAGE-NKDSIN----KIPKKAHLAHILESLLNMGIEKKDQYD 361
            + ++W+ SK+ ++ + P+  E N D  N     I K   +A+ L  +           +
Sbjct: 367 SMLNRWLDSKYPELTRSPTIDEANIDRFNLSKQVITKYLQVANALPQV---------DPE 417

Query: 362 IYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKCK 421
           +   L  L+Y++++  ++  C    L   PN+  +WNR GA LAN+     AI AY+K  
Sbjct: 418 VQLGLGTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKAL 477

Query: 422 QLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRS-KGYEHNKAKMQ-NKFMQNLKN 479
            L+P+F R RYNLAI+ MN G Y +A++ L+  + +   +      + +Q N  ++ LK 
Sbjct: 478 ALKPSFVRARYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKR 537

Query: 480 ALIASKNFDSLDLI 493
           + +A    D L+ +
Sbjct: 538 SFVAMDRRDLLEKV 551

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score =  180 bits (456), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 146/254 (57%), Gaps = 7/254 (2%)

Query: 207 YQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVMAFEAAISQDPSHINAWLKLGIVNFEN 266
           Y F  +N Y    + YKIGC+LM+NG+ L+E  +AFEAA+ + P H++AWL+LG+V  +N
Sbjct: 301 YAFQSNNEYFNNPNAYKIGCLLMENGAKLSEAALAFEAAVKEKPDHVDAWLRLGLVQTQN 360

Query: 267 ESESNGELALRNCLNLDPNNTIALENLAIHHINQQNESESLKLFHKWILSKFSKVFQPSA 326
           E E NG  AL  CL LDP N  A++ LAI +IN+  +  +  +  KW  +K+ +++    
Sbjct: 361 EKELNGISALEECLKLDPKNLEAMKTLAISYINEGYDMSAFTMLDKWAETKYPEIWS-RI 419

Query: 327 GENKDSINKIPKKAHL---AHILESLLNMG--IEKKDQYDIYSVLSILYYSDQKIKQSQK 381
            +  D   K     H+   AHI +  L +   +   D  +I   L +L+Y+     ++  
Sbjct: 420 KQQDDKFQKEKGFTHIDMNAHITKQFLQLANNLSTIDP-EIQLCLGLLFYTKDDFDKTID 478

Query: 382 CLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYMNK 441
           C E  L   PN+  +WNR GA LAN+     AI AY++  QL+P+F R RYNLA++ MN 
Sbjct: 479 CFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNI 538

Query: 442 GDYVKASKMLIEVI 455
           G + +A+  L+ V+
Sbjct: 539 GCFKEAAGYLLSVL 552

>AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH]
           complement(1251018..1252727) [1710 bp, 569 aa]
          Length = 569

 Score =  176 bits (446), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 188/386 (48%), Gaps = 60/386 (15%)

Query: 156 WEFQFKSIENQLLNELKIENNVEEKTVGYEYVAEYEE----------------------- 192
           WE QF+ +E Q+   L I + VE++ V  E  AE  E                       
Sbjct: 181 WEQQFQELEKQVEKTLNISDPVEQQQVLEELSAEAREADYAGGDYEKRFQQIWNDIHDQT 240

Query: 193 ------------TIDFMHMLSSVP-QT--YQFLKSNIYITERDPYKIGCVLMDNGSNLNE 237
                       + D+  + S+ P QT  Y F   N      + YKIG  LM  G+ L+E
Sbjct: 241 DDLDSRTELGGGSGDYQRVFSTRPAQTAQYAFETDNQIPATTNAYKIGGHLMKTGAKLSE 300

Query: 238 VVMAFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHH 297
             +AFEAA+ QDP H++AWL+LG+V  +NE E +G  AL  CL  DP+N +AL  +AI +
Sbjct: 301 PALAFEAAVQQDPGHVDAWLRLGLVQTQNEKELSGINALEQCLKADPHNLMALMTVAISY 360

Query: 298 INQQNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLAHILESLLNM--GIE 355
           IN+  +  +  +  +W+ +K+    +       + ++++ +      I+E  L +   + 
Sbjct: 361 INEGYDVSAFTMLGRWLETKYPAFVE-------EPLDRVDRYNLSRLIIEQYLRVANALP 413

Query: 356 KKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAIN 415
           + D  D+   L IL+Y+++   ++  C    L  +P++  +WNR GA LAN+     AI 
Sbjct: 414 EVDP-DVQLGLGILFYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQ 472

Query: 416 AYNKCKQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKM------ 469
           AY++  QL+P F R RYNLA++ MN G Y +A++ L+  + +    +E     M      
Sbjct: 473 AYHRAIQLKPTFVRARYNLAVSSMNIGCYREAAEHLLTALSM----HEVEGVAMAPGSGN 528

Query: 470 --QNKFMQNLKNALIASKNFDSLDLI 493
              +  ++ LK A IA    D L+ +
Sbjct: 529 VPSSNILETLKRAFIAMDRRDLLERV 554

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score =  134 bits (337), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 152/306 (49%), Gaps = 36/306 (11%)

Query: 207 YQFLKSNIYI-TERDPYKIGCVLMDNGSNLNEVVMAFEAAISQDPSH--INAWLKLGIVN 263
           Y F   N Y+ +    Y+I C+LM+N  NL+E+++AFEAA+ +      ++ W +LGIV 
Sbjct: 240 YVFNTENKYLNSSPSAYEIACILMENNCNLSEIILAFEAALQEHEQQHMVDCWYRLGIVQ 299

Query: 264 FENESESNGELALRNCLNLDPNNTIALENLAIHHINQQNESESLKLFHKWILSKFSKVFQ 323
            +NE E +   A ++ L L+P +  AL+ LA+ HINQ N  E+     + +  K      
Sbjct: 300 LQNEQEESAMDAFQHALELEPGHLEALKLLAVSHINQGNAVEATVCLSRALELKGV---- 355

Query: 324 PSAGENKDSINKIPKKAHLAHILESLLNM-------GIEKKDQYDIYSVLSILYYSDQKI 376
                   +I+  P++  + ++ E++ N+        I      DI +VL++  Y   + 
Sbjct: 356 --------TISNWPQELSILNVRETMENVLLDIPSTAINITRDKDILTVLALFNYLLGRS 407

Query: 377 KQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAI 436
             + KC E LL + P +   WN  GA LAN+K Y +AI  Y    +L+P+F R RYNL  
Sbjct: 408 DNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGS 467

Query: 437 AYMNKGDYVKASKMLIEVILLRSKG-----------YEH---NKAKMQNKFMQNLKNALI 482
             +  G+  +  + L+  ++++               EH    +A+ +N  + +LKNAL+
Sbjct: 468 TLVKNGELQRGIESLLTALVMQGSPIPPIATNLESFIEHLIFTEAQGKNTIVTSLKNALL 527

Query: 483 ASKNFD 488
              + D
Sbjct: 528 KIPDDD 533

>YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein with
           tetratricopeptide (TPR) repeats, part of a system to
           protect cells from double-stranded RNA (dsRNA) viruses
           [4299 bp, 1432 aa]
          Length = 1432

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 363 YSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKCKQ 422
           + V+ I +   Q+   S +  +  L   PN+   W   G          ++I  ++K  Q
Sbjct: 705 FRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQ 764

Query: 423 LRPNFTRVRYNLAIAYMNKGDYVKASKMLIEV 454
           LRP+ T  +Y  AI+  + G+Y+++  +L +V
Sbjct: 765 LRPSHTFAQYFKAISLCDVGEYLESLDILEKV 796

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
            glutathione S-conjugate transporter, member of the
            ATP-binding cassette (ABC) superfamily [4548 bp, 1515 aa]
          Length = 1515

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 252  HINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQQNESESLKLFH 311
            HI    K+GIV      +S+  LAL   +     N I ++N+AI+ I   +    L    
Sbjct: 1295 HIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGN-IVIDNIAINEIGLYDLRHKLS--- 1350

Query: 312  KWILSKFSKVFQPSAGENKDSINK-----IPKKAHLAHILESLLNM 352
              I+ + S+VF+ +  EN D IN+     I +   L+H+ E +L+M
Sbjct: 1351 --IIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSM 1394

>CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein, start by
           similarity
          Length = 1411

 Score = 35.8 bits (81), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 221 PYKIGCVLMDNGSNLNEVVMAFEAAISQDPSHINAWLKLGIVNFENESESNGEL-ALRNC 279
           PY+I  V         E +  F+ A+  DP+ + +W+ LG  ++ N       L      
Sbjct: 681 PYRILGVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLG-QSYLNCGRVEASLKVFERA 739

Query: 280 LNLDPNNTIALENLAIHHINQQNESESLKLFH 311
           L+LD +++ AL   A+ H       ESLKL +
Sbjct: 740 LDLDEHHSYALYYKAVCHSQLGEYEESLKLMY 771

>Scas_705.55
          Length = 907

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 8/114 (7%)

Query: 342 LAHILESLLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKP---NNGTIWN 398
            A +LE  L+   EK +  +IY  L I+Y    K  Q+ +C  ++L + P       IW 
Sbjct: 183 FAKVLE--LDPQFEKAN--EIYFRLGIIYKHQGKWTQALECFRYILNQPPAPLQEWDIWF 238

Query: 399 RYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY-MNKGDYVKASKML 451
           + G++L +   +  A  AY        N  +V   L   Y MN   +    K L
Sbjct: 239 QLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNNVSFYDPQKAL 292

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 349 LLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILA-NT 407
           +LN       ++DI+  L  +  S  + + +++  E +LL+  N+  +  + G +   N 
Sbjct: 223 ILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNN 282

Query: 408 KSYHSAINAYN---KCKQLRPNFTRVRYNLAIAYMNKGDYVKA 447
            S++    A N   K  ++ PN +   Y+L   +M + DY  A
Sbjct: 283 VSFYDPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAA 325

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 393 NGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY 438
           N   W   G +      Y  A++AY +  +L P  + V Y+L   Y
Sbjct: 339 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLY 384

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 41/92 (44%), Gaps = 5/92 (5%)

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLL--LEKPNNGTIWNRYGAILANTKSYHSAINAYN 418
           D+++ L   Y     ++++    +  L  L  PN   +W+  G +     S   A  A+ 
Sbjct: 125 DVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFA 184

Query: 419 KCKQLRPNFTR---VRYNLAIAYMNKGDYVKA 447
           K  +L P F +   + + L I Y ++G + +A
Sbjct: 185 KVLELDPQFEKANEIYFRLGIIYKHQGKWTQA 216

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 10/122 (8%)

Query: 342 LAHILESLLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKP---NNGTIWN 398
            A +LE  L+   EK +  +IY  L I+Y    K  Q+ +C  ++L + P       +W 
Sbjct: 235 FAKVLE--LDPQFEKAN--EIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWF 290

Query: 399 RYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY-MNKGDYVKASKMLIEVILL 457
           + G++L +   +  A +AY           +V   L   Y MN   +    K L   +LL
Sbjct: 291 QLGSVLESMGEWQGARDAYEHIISQNDRHAKVLQQLGCLYGMNNVSFYDPQKAL--NLLL 348

Query: 458 RS 459
           +S
Sbjct: 349 KS 350

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 393 NGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY 438
           N T W   G +      Y  A++AY +  +L P  + V Y+L   Y
Sbjct: 391 NPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLY 436

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC 420
           +I+S L  L++   K+K S      L+   PN    W   G +L+  K + +AI A+ K 
Sbjct: 510 EIFSTL--LWHLHDKVKSSNLA-NGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKA 566

Query: 421 KQLRPNF 427
            QL PNF
Sbjct: 567 TQLDPNF 573

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 8/82 (9%)

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC 420
           D+ +  ++L++   K   S  C E L L+K  N   W   G + +  K +  AI A+ K 
Sbjct: 460 DMDTFSTVLWHLQDKTHLSALCAELLTLDK-YNPIAWCSMGNLHSLNKDHDEAITAFGKA 518

Query: 421 KQLRPNFTRVRYNLAIAYMNKG 442
            QL P F       A AY  +G
Sbjct: 519 IQLDPFF-------AYAYTLQG 533

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%)

Query: 365 VLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKCKQLR 424
           + S L +  Q  K+    +++LL   PN    W   G  L+  K +  AI A+ K  ++ 
Sbjct: 522 IFSTLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKID 581

Query: 425 PNF 427
           P F
Sbjct: 582 PKF 584

>Kwal_23.3670
          Length = 802

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 342 LAHILESLLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKP---NNGTIWN 398
            A +LE  L+   EK +  +IY  L I+Y    K  Q+ +C  ++L + P       +W 
Sbjct: 193 FAKVLE--LDPQFEKAN--EIYFRLGIIYKHQGKWNQALECFRYILTQPPAPLQEWDVWF 248

Query: 399 RYGAILANTKSYHSAINAY 417
           + G++L +   +  A  AY
Sbjct: 249 QLGSVLESMSEWQGAREAY 267

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 393 NGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY 438
           N T W   G +      Y  A++AY +  +L P  + V Y+L   Y
Sbjct: 349 NPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLY 394

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 342 LAHILESLLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKP---NNGTIWN 398
            A +LE  L+   EK +  +IY  L I+Y    K  Q+ +C  ++L + P       IW 
Sbjct: 173 FAKVLE--LDPHFEKAN--EIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWF 228

Query: 399 RYGAILANTKSYHSAINAY 417
           + G++L +   +  A  AY
Sbjct: 229 QLGSVLESMGEWQGAKEAY 247

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 393 NGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY 438
           N   W   G +      Y  A++AY +  +L P  + V Y+L   Y
Sbjct: 329 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLY 374

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 342 LAHILESLLNMGIEKKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLEKPN---NGTIWN 398
            A +LE  L+   EK ++  IY  L I+Y    K  Q+ +C  ++L + P       IW 
Sbjct: 175 FAKVLE--LDPHFEKANE--IYFRLGIIYKHQGKWSQALECFRYILAQPPTPLQEWDIWF 230

Query: 399 RYGAILANTKSYHSAINAY 417
           + G++L +   +  A  AY
Sbjct: 231 QLGSVLESMGEWQGAREAY 249

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 393 NGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY 438
           N   W   G +      Y  A++AY +  +L P  + V Y+L   Y
Sbjct: 331 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLY 376

>Scas_699.31
          Length = 584

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 3/90 (3%)

Query: 386 LLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYMNKGDYV 445
           ++   P +   ++   A LA   S+  AI    K  +  PNF R     A A +   D+V
Sbjct: 416 MIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRKATAQIAIKDFV 475

Query: 446 KASKMLIEVILLRSKGYEHNKAKMQNKFMQ 475
           KA + L E    + K  E N     N+ M+
Sbjct: 476 KALETLEEA---KKKDDEVNNGASSNEIMK 502

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 24/59 (40%)

Query: 397 WNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVI 455
           W  YG I         A  A+ +C  L P       NL+ AY+ +G   +A   L + I
Sbjct: 636 WYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAI 694

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLLLEKP---NNGTIWNRYGAILANTKSYHSAINAY 417
           +IY  L I+Y    K  Q+ +C  ++L + P       +W + G++L +   +  A  AY
Sbjct: 204 EIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAY 263

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 393 NGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAY 438
           N T W   G +      Y  A++AY +  +L P  + V Y+L   Y
Sbjct: 345 NPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLY 390

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLL--LEKPNNGTIWNRYGAILANTKSYHSAINAYN 418
           D+++ L   Y     ++++    +  L  L  PN   +W+  G +     S   A  A+ 
Sbjct: 131 DVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFA 190

Query: 419 KCKQLRPNFTRVR---YNLAIAYMNKGDYVKA 447
           K  +L P+F +V    + L I Y ++G + +A
Sbjct: 191 KVLELDPHFEKVNEIYFRLGIIYKHQGKWNQA 222

>CAGL0F04323g 430854..432839 similar to sp|P38121 Saccharomyces
           cerevisiae YBL035c POL12 DNA-directed DNA polymerase
           alpha, hypothetical start
          Length = 661

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 35/89 (39%), Gaps = 16/89 (17%)

Query: 69  LPADK---SQHSGVSEKEFSRLENQWSKEFSCFPKN------------KNADVTKPSRNK 113
           LP+ +   S+H+   +  F R   Q  + F CFP               N D+ K  +  
Sbjct: 453 LPSTRDVLSRHAAYPQDSFDRKMLQLPRNFKCFPNPSTFQLNEVFVGCSNVDIYKDMKEI 512

Query: 114 HEKRSANLHNRYFAQYYSTAYQQNRIYPC 142
            +  S ++ NR F +      QQ R YP 
Sbjct: 513 TKGGSTSMRNR-FDRVSEHVLQQRRYYPV 540

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 361 DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC 420
           D+YS L  L++   KI+ +  C E L+ +   N   W   G + +  + +  AI A  K 
Sbjct: 408 DVYSTL--LWHLHDKIRLADLCHE-LMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKKA 464

Query: 421 KQLRPNFT 428
             L P F 
Sbjct: 465 TSLNPQFA 472

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 76/210 (36%), Gaps = 45/210 (21%)

Query: 236 NEVVMAFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAI 295
           +E + A + A S +P    A+   G     N++  N ++  R  L ++PN+  A   L +
Sbjct: 455 DEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGM 514

Query: 296 HHINQQNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLAHILESLLNMGIE 355
             I      E+L  F                 E   SIN +        IL     + +E
Sbjct: 515 SCIKLGQYDEALLHF-----------------EKARSINPVNV------ILNCCCGVALE 551

Query: 356 KKDQYDIYSVLSILYYSDQKIKQSQKCLEFLLLE---KPNNGTIWNRYGAILANTKSYHS 412
           +                   + + +K L+F  L    +PN+     +   +L N   Y +
Sbjct: 552 R-------------------LGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSN 592

Query: 413 AINAYNKCKQLRPNFTRVRYNLAIAYMNKG 442
           A+  + K +QL PN   V + L   Y   G
Sbjct: 593 ALQNFEKLEQLTPNEAPVHFLLGQLYQIVG 622

>Scas_585.4
          Length = 918

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 20/49 (40%)

Query: 391 PNNGTIWNRYGAILANTKSYHSAINAYNKCKQLRPNFTRVRYNLAIAYM 439
           P N   W  YG +         A  A+++C  L P       NL+ AY+
Sbjct: 641 PLNFETWYFYGCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYV 689

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,947,825
Number of extensions: 752812
Number of successful extensions: 2775
Number of sequences better than 10.0: 63
Number of HSP's gapped: 2809
Number of HSP's successfully gapped: 86
Length of query: 505
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 399
Effective length of database: 12,926,601
Effective search space: 5157713799
Effective search space used: 5157713799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)