Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR017W (SPO20)39739119970.0
Scas_575.56452313101e-30
CAGL0A01672g6942272922e-28
AFR469W5332152727e-26
Kwal_14.22655552202701e-25
Scas_648.77272152684e-25
YGR009C (SEC9)6512222666e-25
KLLA0D02024g5562672302e-20
Sklu_2351.55412241992e-16
KLLA0D12100g477100710.85
Scas_497.119974690.97
KLLA0D06281g75258638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR017W
         (391 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR017W (SPO20) [3981] chr13 (307488..308681) Protein required f...   773   0.0  
Scas_575.5                                                            124   1e-30
CAGL0A01672g complement(160144..162228) similar to sp|P40357 Sac...   117   2e-28
AFR469W [3661] [Homologous to ScYGR009C (SEC9) - NSH] complement...   109   7e-26
Kwal_14.2265                                                          108   1e-25
Scas_648.7                                                            107   4e-25
YGR009C (SEC9) [1980] chr7 complement(509049..511004) Component ...   107   6e-25
KLLA0D02024g complement(173877..175547) weakly similar to sp|P40...    93   2e-20
Sklu_2351.5 YGR009C, Contig c2351 9208-10833                           81   2e-16
KLLA0D12100g complement(1031728..1033161) some similarities with...    32   0.85 
Scas_497.1                                                             31   0.97 
KLLA0D06281g 540031..542289 weakly similar to sp|Q9RCV7 Streptom...    29   8.6  

>YMR017W (SPO20) [3981] chr13 (307488..308681) Protein required for
           sporulation and growth of prospore membrane, interacts
           with Dbf2p [1194 bp, 397 aa]
          Length = 397

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/391 (96%), Positives = 376/391 (96%)

Query: 1   MGFRKILAXXXXXXXXXXXXXXXLKLQNHRYVLISNITGSHETKYLSPFRMDNCSGSRRR 60
           MGFRKILA               LKLQNHRYVLISNITGSHETKYLSPFRMDNCSGSRRR
Sbjct: 1   MGFRKILASKSHHSRHHNQHHKNLKLQNHRYVLISNITGSHETKYLSPFRMDNCSGSRRR 60

Query: 61  DRLHVKLKSLRNKIHKQLHPNCRFDDATKTSDDKCVSYEVPERDGLATISLEEVFPKSNR 120
           DRLHVKLKSLRNKIHKQLHPNCRFDDATKTSDDKCVSYEVPERDGLATISLEEVFPKSNR
Sbjct: 61  DRLHVKLKSLRNKIHKQLHPNCRFDDATKTSDDKCVSYEVPERDGLATISLEEVFPKSNR 120

Query: 121 CQIPEENLGETDSVIHRDLGNFANENDYPQWRKVESQYNLENVQPEEDEIVDRLRSEIRS 180
           CQIPEENLGETDSVIHRDLGNFANENDYPQWRKVESQYNLENVQPEEDEIVDRLRSEIRS
Sbjct: 121 CQIPEENLGETDSVIHRDLGNFANENDYPQWRKVESQYNLENVQPEEDEIVDRLRSEIRS 180

Query: 181 TKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDE 240
           TKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDE
Sbjct: 181 TKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDE 240

Query: 241 LAHENRSLLALKSPNPFRKKREREKRDQIYNLKLKHRHLQQETMKRAQDSDKNLAINLSS 300
           LAHENRSLLALKSPNPFRKKREREKRDQIYNLKLKHRHLQQETMKRAQDSDKNLAINLSS
Sbjct: 241 LAHENRSLLALKSPNPFRKKREREKRDQIYNLKLKHRHLQQETMKRAQDSDKNLAINLSS 300

Query: 301 EYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVSGDLKIMAHAFGRE 360
           EYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVSGDLKIMAHAFGRE
Sbjct: 301 EYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVSGDLKIMAHAFGRE 360

Query: 361 FEAQNTRMFDIENNVQQADNALQAKRYRLEK 391
           FEAQNTRMFDIENNVQQADNALQAKRYRLEK
Sbjct: 361 FEAQNTRMFDIENNVQQADNALQAKRYRLEK 391

>Scas_575.5
          Length = 645

 Score =  124 bits (310), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 139/231 (60%), Gaps = 3/231 (1%)

Query: 164 QPEEDEIVDRLRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESN 223
           Q +EDE VD L+  I+ TK  SV +T  TL+ A EA  +G   L  L  QS QL  +E N
Sbjct: 413 QQDEDEAVDELKQNIKFTKQSSVASTRNTLKMAQEAEMSGMNTLGILGHQSEQLNNVEGN 472

Query: 224 CDMLKIQSNVADRKIDELAHENRSLLALKSPNPFRKKRER-EKRDQIYNLKLKHRHLQQE 282
            D++KIQ++VA+ K+DEL   NR++LA+ + NPF  KR R E  D++   +L+ + + Q 
Sbjct: 473 LDLIKIQNSVAEDKVDELKKLNRNVLAIHAKNPFNAKRRRMEHEDELKARRLEEQAMLQA 532

Query: 283 TMKRAQDSDKNL--AINLSSEYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNL 340
           T ++  +S + +  A+  +S+     +  +RQ +L  A+KYQFE DEED+ ME+++  NL
Sbjct: 533 TNQQIANSTQRISNALTENSKPSLIQEKYKRQEVLNRAKKYQFENDEEDDDMEVEIDRNL 592

Query: 341 EQIKAVSGDLKIMAHAFGREFEAQNTRMFDIENNVQQADNALQAKRYRLEK 391
           +Q++ +SG LK +A + G E ++Q  R+ D+E N    D  L     +L +
Sbjct: 593 DQVQQISGRLKKLAISTGEELDSQQERLKDVEENTDNLDIKLNTNTTKLSR 643

>CAGL0A01672g complement(160144..162228) similar to sp|P40357
           Saccharomyces cerevisiae YGR009c SEC9, start by
           similarity
          Length = 694

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 132/227 (58%), Gaps = 7/227 (3%)

Query: 168 DEIVDRLRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDML 227
           D+ VD ++ +IR TK  SV +T  TL+ A EA   G   L  L  QS +L  +E N D++
Sbjct: 466 DQAVDEIKEQIRFTKQSSVASTRNTLKMAQEAEMAGMNTLGMLGHQSEKLNNVERNLDLI 525

Query: 228 KIQSNVADRKIDELAHENRSLLALKSPNPFR-KKREREKRDQIYNLKLKHR----HLQQE 282
           KIQ+  AD K+ EL   NR++LA+   NPF  K+R RE+ D I   K++ +    H+ QE
Sbjct: 526 KIQNTAADEKVAELKKLNRNILAVHVSNPFNSKRRRREREDMIKGRKMEDKMRAEHMSQE 585

Query: 283 TMKRAQDSDKNLAINLSSEYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQ 342
             +  Q  +   A+   +E     +  +R+++L  A+KYQFE DEED++ME+++  NL++
Sbjct: 586 LHQSTQRIEG--ALGGGNETSAVREKYQREKVLAAAKKYQFENDEEDDEMEVEIDRNLDK 643

Query: 343 IKAVSGDLKIMAHAFGREFEAQNTRMFDIENNVQQADNALQAKRYRL 389
           I+ +SG LK +A A G E ++Q  R+ DIE N  + D  +     RL
Sbjct: 644 IQQISGRLKKLALATGEELDSQQRRIRDIEENTDEMDIKIHMNTTRL 690

>AFR469W [3661] [Homologous to ScYGR009C (SEC9) - NSH]
           complement(1283826..1285427) [1602 bp, 533 aa]
          Length = 533

 Score =  109 bits (272), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 128/215 (59%), Gaps = 1/215 (0%)

Query: 166 EEDEIVDRLRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCD 225
           EEDE VD ++ +IR TK  SV +T  TL+ A +A   G   L  L  QS +L  +E N +
Sbjct: 305 EEDEEVDEIKQQIRFTKQSSVASTRNTLKMAQDAELAGMNSLGMLGHQSEKLNNVERNLN 364

Query: 226 MLKIQSNVADRKIDELAHENRSLLALKSPNPFRKKRE-REKRDQIYNLKLKHRHLQQETM 284
           ++K+Q+ VA+ K+ EL   NR++LA+   NPF  KR+ RE  ++I N +++ +  Q+ET 
Sbjct: 365 LMKVQNRVAEDKVAELKRLNRNILAVHVGNPFTSKRKVREAEERIKNQRMQDKMQQEETT 424

Query: 285 KRAQDSDKNLAINLSSEYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIK 344
            +   S   +   L+ E     +  +R + L  A+KYQFE DEED++ME ++  NL++I 
Sbjct: 425 TQLMSSTNRIENALNDERHSVRERYQRDQALERAKKYQFENDEEDDEMEFEIDRNLDKIG 484

Query: 345 AVSGDLKIMAHAFGREFEAQNTRMFDIENNVQQAD 379
            VSG LK +A A G+E ++Q +R+  IE +    D
Sbjct: 485 QVSGRLKKLAIAAGQEIDSQQSRIKRIEEDADDMD 519

>Kwal_14.2265
          Length = 555

 Score =  108 bits (270), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 128/220 (58%), Gaps = 4/220 (1%)

Query: 174 LRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNV 233
           ++ +IR TK  SV +T  TL+ A EA   G   L  L  QS +L  +E N D++K+Q+ V
Sbjct: 332 IKQQIRFTKQSSVASTRNTLKMAQEAEMAGTNTLGMLGHQSEKLNNVERNLDLMKMQNRV 391

Query: 234 ADRKIDELAHENRSLLALKSPNPFRKKRE-REKRDQIYNLKLKHRHLQQETMKRAQDSDK 292
           AD K+ EL   NR++LA+   NPF  KR  RE  ++I N +++ + +Q+ET  R   S  
Sbjct: 392 ADDKVAELKKLNRNILAVHVSNPFTSKRRLREAEERIRNQRIEDKLMQKETTGRLHKSTN 451

Query: 293 NL--AINLSS-EYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVSGD 349
            +  A+N S+ E     +  + Q IL  A++YQFE DEED+++E++L  NL+++  +SG 
Sbjct: 452 RIEGALNGSANEIDSVKERYQNQAILEKAKRYQFENDEEDDELELELDKNLDKVGQISGR 511

Query: 350 LKIMAHAFGREFEAQNTRMFDIENNVQQADNALQAKRYRL 389
           LK +A A G E +AQ  R+ +IE +    D  +     RL
Sbjct: 512 LKRLAIAAGDEIDAQQGRVKNIEEDTDNMDIKIHLNTTRL 551

>Scas_648.7
          Length = 727

 Score =  107 bits (268), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 129/215 (60%), Gaps = 6/215 (2%)

Query: 171 VDRLRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQ 230
           VD ++ +I+ TK  SV +T  TL+ A +A   G   L  L  QS +L  +E N D++K+Q
Sbjct: 499 VDEIKQQIKFTKQSSVASTKNTLKMAQDAEMAGMNTLGMLGHQSEKLNNVERNLDLMKVQ 558

Query: 231 SNVADRKIDELAHENRSLLALKSPNPFR-KKREREKRDQIYNLKLKHRHLQQETMKRAQD 289
           + VAD K+ EL   NRSLLA+   NPF  K+R R++ +Q+ N K++ + + +ET ++   
Sbjct: 559 NVVADDKVKELKKLNRSLLAVHVSNPFNSKRRARDREEQLKNRKMEEKLMFEETNRQLYS 618

Query: 290 SDKNLAINLSSEYG-RYGQGV----ERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIK 344
           S + +   L+ +    +G  +    +RQ IL  +++YQFE DEED++ME+++  NLE+I 
Sbjct: 619 STQRIEGALTGDTSLNHGSEIRERYQRQNILEKSKRYQFENDEEDDEMEMEIDRNLEKIH 678

Query: 345 AVSGDLKIMAHAFGREFEAQNTRMFDIENNVQQAD 379
            +SG LK +A + G E E+Q  R+  IE +    D
Sbjct: 679 QISGRLKKLAISTGEELESQQKRIGRIEEDTDNLD 713

>YGR009C (SEC9) [1980] chr7 complement(509049..511004) Component of
           a t-SNARE complex on the plasma membrane, involved in
           vesicle docking and secretion [1956 bp, 651 aa]
          Length = 651

 Score =  107 bits (266), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 133/222 (59%), Gaps = 3/222 (1%)

Query: 171 VDRLRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQ 230
           VD ++ EI+ TK  SV +T  TL+ A +A   G   L  L  QS QL  +E N D++K+Q
Sbjct: 426 VDEIKQEIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQ 485

Query: 231 SNVADRKIDELAHENRSLLALKSPNPFRKK-REREKRDQIYNLKLKHRHLQQETMKRAQD 289
           + VAD K+ EL   NRS+LA+   NPF  K R RE+ +Q+ N K++ + ++++T ++   
Sbjct: 486 NKVADEKVAELKKLNRSILAVHVSNPFNSKRRRREREEQLKNRKIEEKLMREQTSQQLSQ 545

Query: 290 SDKNL--AINLSSEYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVS 347
           S + +  A+N ++      +  +R+ +L  A++YQFE DEED++ME+++  NL+QI+ VS
Sbjct: 546 STQRIEGAMNANNNISEVRERYQRKNVLEKAKRYQFENDEEDDEMELEIDRNLDQIQQVS 605

Query: 348 GDLKIMAHAFGREFEAQNTRMFDIENNVQQADNALQAKRYRL 389
             LK MA   G+E ++Q  R+ +IE +    D  L     RL
Sbjct: 606 NRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRL 647

>KLLA0D02024g complement(173877..175547) weakly similar to sp|P40357
           Saccharomyces cerevisiae YGR009c SEC9 protein transport
           protein, start by similarity
          Length = 556

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 140/267 (52%), Gaps = 20/267 (7%)

Query: 138 DLGNFANENDYPQWRKVESQYNLENVQPEEDEIVDR--------LRSEIRSTKLKSVKTT 189
           DL N  +EN+       +     E++Q E      +        ++ +I+ TK  SV +T
Sbjct: 291 DLNNSIHENEG-IGTPAKGYQTFEDIQKESQRAEQQEEDEEVDGIKQQIKFTKQSSVAST 349

Query: 190 SRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDELAHENRSLL 249
             TL+ A +A   G   +  L  QS +L  +E N ++++IQ+ VAD K+ EL   NR++L
Sbjct: 350 RNTLKMAQDAELAGMNTIGMLGHQSEKLNNVERNLNLMQIQNRVADDKVSELKKLNRNIL 409

Query: 250 ALKSPNPFR-KKREREKRDQIYNLKLKHRHLQQETMKRAQDSDKNLAINLSSEYG----- 303
           A+   NPF  K+R RE  D+I   +++ +  Q++       S K +   +SS +G     
Sbjct: 410 AVHVSNPFHSKRRAREAEDKIKLQRMQDKQNQEDITSTLHQSTKRIENAMSSGHGPSEVR 469

Query: 304 -RYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVSGDLKIMAHAFGREFE 362
            RY    + Q+IL  A++YQFE DEED++ME+++  NL++I  +SG LK +A   G+E +
Sbjct: 470 DRY----QNQQILEKAKRYQFENDEEDDEMEMEIDKNLDKIGQISGRLKKLAITTGKEID 525

Query: 363 AQNTRMFDIENNVQQADNALQAKRYRL 389
           +Q  R+  IE +    D  +     RL
Sbjct: 526 SQQDRIKRIEESTDDLDIKIHVNTTRL 552

>Sklu_2351.5 YGR009C, Contig c2351 9208-10833
          Length = 541

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 124/224 (55%), Gaps = 12/224 (5%)

Query: 174 LRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNV 233
           ++ +I+ TK  SV +T  TL+ A +A   G   L  L  QS  L  +E+N +++K+Q+ V
Sbjct: 318 IKQQIKFTKQSSVASTRNTLKMAQDAEMAGMNTLGMLGHQSETLNNVENNLNLMKMQNRV 377

Query: 234 ADRKIDELAHENRSLLALKSPNPFRKKRE-REKRDQIYNLKLKHRHLQQETMKRAQDSDK 292
           AD K+ EL   NR++LA+   NPF  KR  RE  D+I   +++ + +QQE       S +
Sbjct: 378 ADDKVQELKKLNRNILAVHVSNPFNSKRRLREAEDKIRMQRVQDKIMQQEANSTLHQSTR 437

Query: 293 NL--AINLSSEYG-----RYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKA 345
            +  A+N +   G     RY    + Q+IL  +++YQFE DEED++ME+++  NL++I  
Sbjct: 438 RIEGAMNNAGNDGNTVRERY----QNQQILDRSKRYQFENDEEDDEMELEIDRNLDKIGQ 493

Query: 346 VSGDLKIMAHAFGREFEAQNTRMFDIENNVQQADNALQAKRYRL 389
           VS  LK +A A G E  +Q  R+  IE +    D  +     RL
Sbjct: 494 VSSRLKKLAVATGEEINSQQDRIKSIEEDTDNMDIKIHLNTTRL 537

>KLLA0D12100g complement(1031728..1033161) some similarities with
           sgd|S0002655 Saccharomyces cerevisiae YDR247w,
           hypothetical start
          Length = 477

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 85  DDATKTSDDKCVSYEVPERDGLATISLEEVFP---KSNRCQIPEENLGETDSVIHRDLGN 141
           ++ +++SD+ C  Y++     L + S EE F      N    P  N G T +        
Sbjct: 380 EELSESSDEVCKEYDIDGNSNLPSYSSEEDFELIQDGNLINAPFPNTGITPN-------G 432

Query: 142 FANENDYPQWRKVE-SQYNLENVQPEEDEIVDRLRSEIRS 180
           F N++D   W K++ SQ+NL N      +  + L S + S
Sbjct: 433 FLNQDDSKFWLKMQYSQFNLSNTPTTGSQGANALNSTLDS 472

>Scas_497.1
          Length = 199

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 141 NFANENDYPQWRKVESQYNLENVQPEEDEIV-DRLRSEIRSTKLKSVKTTSRTLE--KAI 197
           N + EN  P WR++ESQ +     P +  ++ D L   + + +L+   T+ R     K+I
Sbjct: 86  NVSGENVIPVWRRIESQSS----SPLKHIVIHDDLEKPLGNVQLRGPGTSLRGHNGLKSI 141

Query: 198 EARCTGKRVLQQLS 211
            ++  GK    +LS
Sbjct: 142 ASKLGGKNTFYKLS 155

>KLLA0D06281g 540031..542289 weakly similar to sp|Q9RCV7
           Streptomyces coelicolor Hypothetical protein SCO0854,
           start by similarity
          Length = 752

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 184 KSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDEL 241
           KS+KT +RT+E A+ AR       + L  + N  + +ES   +LK +     R++D L
Sbjct: 333 KSIKTFNRTIETALRAR-------KDLKNEGNMESSLESIIHILKARPGDFARRLDHL 383

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,270,975
Number of extensions: 543872
Number of successful extensions: 2561
Number of sequences better than 10.0: 149
Number of HSP's gapped: 2591
Number of HSP's successfully gapped: 156
Length of query: 391
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 287
Effective length of database: 12,995,837
Effective search space: 3729805219
Effective search space used: 3729805219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)