Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR016C (SOK2)78577125760.0
Scas_106.14231115815e-67
ABR055C6781075643e-62
Kwal_26.81765921065551e-61
KLLA0F04840g6361085528e-61
Scas_709.527251115551e-60
CAGL0L01771g4351065273e-59
YKL043W (PHD1)3661115171e-58
Scas_625.85211075184e-57
CAGL0M07634g2571043903e-42
Scas_510.21043801204e-06
KLLA0E05357g754771186e-06
YDL056W (MBP1)833771151e-05
Kwal_27.10756922821062e-04
Sklu_1824.2179821002e-04
AFR600C815771052e-04
CAGL0D01012g802771034e-04
Sklu_2055.3743771024e-04
AGL297C970821025e-04
Scas_683.37820771017e-04
YER111C (SWI4)1093801000.001
Kwal_26.935974277970.002
CAGL0A04565g104199960.002
KLLA0E20867g93378930.007
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR016C
         (771 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   996   0.0  
Scas_106.1                                                            228   5e-67
ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   221   3e-62
Kwal_26.8176                                                          218   1e-61
KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   217   8e-61
Scas_709.52                                                           218   1e-60
CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   207   3e-59
YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   203   1e-58
Scas_625.8                                                            204   4e-57
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   154   3e-42
Scas_510.2                                                             51   4e-06
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    50   6e-06
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    49   1e-05
Kwal_27.10756                                                          45   2e-04
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         43   2e-04
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    45   2e-04
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    44   4e-04
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            44   4e-04
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    44   5e-04
Scas_683.37                                                            44   7e-04
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    43   0.001
Kwal_26.9359                                                           42   0.002
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    42   0.002
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    40   0.007

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/771 (68%), Positives = 531/771 (68%)

Query: 1   MPIGNPINTNDIKSNRMRQESNMSAVSNSESTIGQSTXXXXXXXXYLGQSVQPLMPVSXX 60
           MPIGNPINTNDIKSNRMRQESNMSAVSNSESTIGQST        YLGQSVQPLMPVS  
Sbjct: 1   MPIGNPINTNDIKSNRMRQESNMSAVSNSESTIGQSTQQQQQQQQYLGQSVQPLMPVSYQ 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESFQSSGSDSNASNPPSTSVGVPSNA 120
                                             ESFQSSGSDSNASNPPSTSVGVPSNA
Sbjct: 61  YVVPEQWPYPQYYQQPQSQSQQQLQSQPQMYQVQESFQSSGSDSNASNPPSTSVGVPSNA 120

Query: 121 TATALPNGSAXXXXXXXXXXXXXXXVPYYYYFPQMXXXXXXXXXXXXXXXXXXXNGDGTT 180
           TATALPNGSA               VPYYYYFPQM                   NGDGTT
Sbjct: 121 TATALPNGSAITTKKSNNSTNISNNVPYYYYFPQMQAQQSMAYSYPQAYYYYPANGDGTT 180

Query: 181 NGATPSVTSNQVQNPNLEKTYSTFEXXXXXXXXXXXXXXTYPAQPPKIGNAXXXXXXXXX 240
           NGATPSVTSNQVQNPNLEKTYSTFE              TYPAQPPKIGNA         
Sbjct: 181 NGATPSVTSNQVQNPNLEKTYSTFEQQQQHQQQQQLQAQTYPAQPPKIGNAFSKFSKSGP 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXLAQQPPMSNYPQPSTYQYPGFHKTXXXXXXXXXXX 300
                                    LAQQPPMSNYPQPSTYQYPGFHKT           
Sbjct: 241 PSDSSSGSMSPNSNRTSRNSNSISSLAQQPPMSNYPQPSTYQYPGFHKTSSIPNSHSPIP 300

Query: 301 XXXLTTPTQGPTSQNGPLSYNXXXXXXXXXXXXXXXXXXYDGNSITPPVKPSTDQETYLT 360
              LTTPTQGPTSQNGPLSYN                  YDGNSITPPVKPSTDQETYLT
Sbjct: 301 PRSLTTPTQGPTSQNGPLSYNLPQVGLLPPQQQQQVSPLYDGNSITPPVKPSTDQETYLT 360

Query: 361 ANRHGVSDQQYDSMAKTMNSFQTTTIRHPMPLXXXXXXXXXXXXXXXXXXXRPRVTTTMW 420
           ANRHGVSDQQYDSMAKTMNSFQTTTIRHPMPL                   RPRVTTTMW
Sbjct: 361 ANRHGVSDQQYDSMAKTMNSFQTTTIRHPMPLIATTNATGSNTSGTSASIIRPRVTTTMW 420

Query: 421 EDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHVVKIGSM 480
           EDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHVVKIGSM
Sbjct: 421 EDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHVVKIGSM 480

Query: 481 HLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNPXXXXXXXXXXXXXXXXXP 540
           HLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNP                 P
Sbjct: 481 HLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNPSNDSSSSSSSTGIKSISP 540

Query: 541 RTXXXXXXXXXXXXGPSNISAAQLTYSSMNLNNKIIPNNSIPAVSTIAAGEKPLKKCTMP 600
           RT            GPSNISAAQLTYSSMNLNNKIIPNNSIPAVSTIAAGEKPLKKCTMP
Sbjct: 541 RTYYQPINNYQNPNGPSNISAAQLTYSSMNLNNKIIPNNSIPAVSTIAAGEKPLKKCTMP 600

Query: 601 NSNQLEGHTITNLQTLSATMPMKQQLMGNIASPLSYPRNATMNSASTLGITPADXXXXXX 660
           NSNQLEGHTITNLQTLSATMPMKQQLMGNIASPLSYPRNATMNSASTLGITPAD      
Sbjct: 601 NSNQLEGHTITNLQTLSATMPMKQQLMGNIASPLSYPRNATMNSASTLGITPADSKPLTP 660

Query: 661 XXXXXXXXXXXXXXVGSIHTGITLPRVESESASHSKWSKEADSGNTVPDNQTLKEPRSSQ 720
                         VGSIHTGITLPRVESESASHSKWSKEADSGNTVPDNQTLKEPRSSQ
Sbjct: 661 SPTTTNTNQSSESNVGSIHTGITLPRVESESASHSKWSKEADSGNTVPDNQTLKEPRSSQ 720

Query: 721 LPISALXXXXXXXXXXXXXXEATQPNEPSEAEPVKESESSKSQVDGAGDVS 771
           LPISAL              EATQPNEPSEAEPVKESESSKSQVDGAGDVS
Sbjct: 721 LPISALTSTDTDKIKTSTSDEATQPNEPSEAEPVKESESSKSQVDGAGDVS 771

>Scas_106.1
          Length = 423

 Score =  228 bits (581), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%)

Query: 412 RPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKI 471
           RPRVTTTMWEDEKTLCYQVEA G+SVVRRADNDM+NGTKLLNVTKMTRGRRDGILKAEKI
Sbjct: 153 RPRVTTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEKI 212

Query: 472 RHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNP 522
           RHVVKIGSMHLKGVWIPF+RALA+AQREKI D L+PLF+RDIQSV++Q  P
Sbjct: 213 RHVVKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAP 263

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  221 bits (564), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 95/107 (88%), Positives = 103/107 (96%)

Query: 413 PRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIR 472
           PRVTTTMWEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNV KMTRGRRDGILKAEK+R
Sbjct: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388

Query: 473 HVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQ 519
           HVVKIGSMHLKGVWIPFERALA+AQREKI D L+PLF+RDIQSV++Q
Sbjct: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQ 435

>Kwal_26.8176
          Length = 592

 Score =  218 bits (555), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 93/106 (87%), Positives = 101/106 (95%)

Query: 415 VTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHV 474
           VTTTMWEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNV KMTRGRRDGILKAEKIRHV
Sbjct: 217 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV 276

Query: 475 VKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQN 520
           VKIGSMHLKGVWIPF+RALA+AQREKI D L+PLF+RDIQSV++Q 
Sbjct: 277 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQG 322

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  217 bits (552), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%)

Query: 412 RPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKI 471
           R +VTTTMWEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNVT+MTRGRRDGILKAEKI
Sbjct: 362 RSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKI 421

Query: 472 RHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQ 519
           RHVVKIGSMHLKGVWIPFERAL +AQREKI D LY LF+RDIQS+++Q
Sbjct: 422 RHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469

>Scas_709.52
          Length = 725

 Score =  218 bits (555), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 93/111 (83%), Positives = 103/111 (92%)

Query: 412 RPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKI 471
           +PRVTTTMWEDE+T+CYQVEANG+SVVRRADNDM+NGTKLLNVTKMTRGRRDGILK+EKI
Sbjct: 383 KPRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKI 442

Query: 472 RHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNP 522
           RHVVKIGSMHLKGVW+PFERA  +A RE I D LYPLF+RDI+SVLKQ  P
Sbjct: 443 RHVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRP 493

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/16 (87%), Positives = 14/16 (87%)

Query: 273 SNYPQPSTYQYPGFHK 288
           SNYP PSTYQYPGF K
Sbjct: 265 SNYPNPSTYQYPGFQK 280

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  207 bits (527), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 89/106 (83%), Positives = 98/106 (92%)

Query: 413 PRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIR 472
           PR+ TT+WEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNVTKMTRG+RDGIL++EK R
Sbjct: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260

Query: 473 HVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLK 518
            VVKIGSMHLKGVWIPFERAL IA+REKI D LYPLF+RDI SVLK
Sbjct: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  203 bits (517), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 101/111 (90%)

Query: 412 RPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKI 471
           +PRV TTMWEDE T+CYQVEANGISVVRRADN+M+NGTKLLNVTKMTRGRRDGIL++EK+
Sbjct: 184 KPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKV 243

Query: 472 RHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNP 522
           R VVKIGSMHLKGVWIPFERA  +AQRE+I D+LYPLF++DI+S++    P
Sbjct: 244 REVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKP 294

>Scas_625.8
          Length = 521

 Score =  204 bits (518), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (92%)

Query: 413 PRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIR 472
           PRV TTMWEDE+TLCYQVE NG++VVRRADNDM+NGTKLLNVTKMTRGRRDGIL+AEK+R
Sbjct: 208 PRVITTMWEDERTLCYQVECNGVAVVRRADNDMINGTKLLNVTKMTRGRRDGILRAEKVR 267

Query: 473 HVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQ 519
            V+KIGSMHLKGVWIPF+RAL +A+REKI D LYPLF++DI S+L Q
Sbjct: 268 SVIKIGSMHLKGVWIPFDRALMMAKREKIVDLLYPLFVKDINSILSQ 314

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  154 bits (390), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (78%)

Query: 414 RVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRH 473
           RV TT WEDE T+C+ V  NG++VVRRADNDMVNGTKLLNVT MTRGRRDGILK E +R 
Sbjct: 121 RVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEPVRD 180

Query: 474 VVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVL 517
           VVK G M LKGVWIP +RA AIA++E I  +LYPLFI D+   +
Sbjct: 181 VVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQAI 224

>Scas_510.2
          Length = 1043

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEK---IRHVVKIGSMHLK 483
           CY        V+RR  +D +N T++  +   ++  R  +L+ E    +   V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 484 GVWIPFERALAIAQREKIAD 503
           G WIP E AL + Q+ KI D
Sbjct: 124 GTWIPLESALMLVQKYKIND 143

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKI---RHVVKIGSMHLKGVWIPFERA 492
           S+++R  ++ VN T +L   K  + +R  IL+ E I      V+ G    +G WIP E A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 493 LAIAQREKIADYLYPLF 509
             +A++ ++ D L PLF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 492
           S+++R  +D VN T +L      + +R  IL+ E ++     V+ G    +G W+P   A
Sbjct: 24  SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIA 83

Query: 493 LAIAQREKIADYLYPLF 509
             +A++  + D L PLF
Sbjct: 84  KQLAEKFSVYDQLKPLF 100

>Kwal_27.10756
          Length = 922

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEK--IRH-VVKIGSMHLK 483
           CY        V+RR  +D VN T++  +   ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQ 105

Query: 484 GVWIPFERALAIAQREKIADYL 505
           G WIP E A  + Q+  ++D +
Sbjct: 106 GTWIPLENAHYLVQKYSVSDVV 127

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 483
           CY        V+RR  ++ VN T++  +   ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKIQGGYGRFQ 87

Query: 484 GVWIPFERALAIAQREKIADYL 505
           G WIP E A  +  + K+ D +
Sbjct: 88  GTWIPLENARYLVSKYKVDDII 109

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 492
           S+++R  +D VN T +L   K  + +R  IL+ E I+     V+ G    +G W+P + A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 493 LAIAQREKIADYLYPLF 509
             +AQ+ ++ + L PLF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 492
           S+++R ++  VN T +L      + +R  IL+ E ++ +   V+ G    +G W+P   A
Sbjct: 24  SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIA 83

Query: 493 LAIAQREKIADYLYPLF 509
           + +A++  +   L PLF
Sbjct: 84  INLAEKFDVYQDLKPLF 100

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 492
           S+++R  +D VN T +L   K  + +R  IL+ E I+ +   V+ G    +G W+P + A
Sbjct: 27  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDIHEKVQGGFGKYQGTWVPLDIA 86

Query: 493 LAIAQREKIADYLYPLF 509
             +A +  + + L PLF
Sbjct: 87  RKLASKFDVMEELKPLF 103

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 483
           CY        V+RR  +D VN T++  V   ++ +R  IL+ E   I H  ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 484 GVWIPFERALAIAQREKIADYL 505
           G WIP + A  +  + +I D +
Sbjct: 93  GTWIPLDSAKGLVAKYEITDIV 114

>Scas_683.37
          Length = 820

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAE---KIRHVVKIGSMHLKGVWIPFERA 492
           SV++R  +D VN T +L      + +R  IL  E   +    V+ G    +G W+P E A
Sbjct: 24  SVMKRKKDDWVNATHILKAANFAKAKRTRILDKEVMGRKHEKVQGGFGKYQGTWVPLEIA 83

Query: 493 LAIAQREKIADYLYPLF 509
             +A +  + + L  LF
Sbjct: 84  TELAMKFDVYEELRALF 100

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 483
           CY        V+RR  +D +N T++  + + ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 50  CYIRGFETKIVMRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQ 109

Query: 484 GVWIPFERALAIAQREKIAD 503
           G WIP + A  +  + +I D
Sbjct: 110 GTWIPLDSAKFLVNKYEIID 129

>Kwal_26.9359
          Length = 742

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 436 SVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 492
           S+++R ++D VN T +L   K  + +R  IL+ E I+     V+ G    +G W+P + A
Sbjct: 25  SIMKRKEDDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 84

Query: 493 LAIAQREKIADYLYPLF 509
             +A + ++   L PLF
Sbjct: 85  RNLAAKFEVLSELKPLF 101

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 483
           CY        V+RR  +D VN T++  + + ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 52  CYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEKVQGGYGRFQ 111

Query: 484 GVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNP 522
           G W+P E A  +  +  I +   P+    +  +L  NNP
Sbjct: 112 GTWVPLEAAKFMTTKYNIDN---PVVNTILSFILNPNNP 147

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 427 CYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 483
           CY  +     ++RR +++ +N T++      T+ +R  IL+ E  +I+H  ++ G    +
Sbjct: 109 CYTKDKPPCLIMRRCNDNWLNITQVFKAGSFTKAQRTKILEKEANEIKHEKIQGGYGRFQ 168

Query: 484 GVWIPFERALAIAQREKI 501
           G WIP+E    + ++  I
Sbjct: 169 GTWIPWESTKYLVEKYNI 186

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.124    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,472,271
Number of extensions: 541097
Number of successful extensions: 1375
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1390
Number of HSP's successfully gapped: 27
Length of query: 771
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 662
Effective length of database: 12,822,747
Effective search space: 8488658514
Effective search space used: 8488658514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)