Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR015C (ERG5)53852928530.0
Scas_709.5352351523940.0
CAGL0M07656g53549523310.0
Sklu_2168.454049523280.0
KLLA0D11242g53452422620.0
ABR053C51547120070.0
Kwal_26.817233633615570.0
KLLA0E03553g5271932244e-19
Kwal_47.183235362022022e-16
Sklu_2436.115321901932e-15
CAGL0E04334g5333531933e-15
YHR007C (ERG11)5302011923e-15
ADR162W5291891896e-15
Scas_699.205382031763e-13
KLLA0C06743g5131721051e-04
CAGL0F02607g498141960.001
Kwal_47.18804508215910.006
KLLA0C19206g511224790.15
Scas_584.536746740.59
AFR661W117925692.7
YHR076W (PTC7)37446673.4
Sklu_2324.4183102653.7
AAR028W37679648.6
AFR020W65667649.0
YDR060W (MAK21)102593649.7
Sklu_1987.252367649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR015C
         (529 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrom...  1103   0.0  
Scas_709.53                                                           926   0.0  
CAGL0M07656g 765772..767379 highly similar to sp|P54781 Saccharo...   902   0.0  
Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement        901   0.0  
KLLA0D11242g complement(959973..961577) highly similar to sp|P54...   875   0.0  
ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH] (492258..493...   777   0.0  
Kwal_26.8172                                                          604   0.0  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    91   4e-19
Kwal_47.18323                                                          82   2e-16
Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement      79   2e-15
CAGL0E04334g complement(415351..416952) highly similar to sp|P10...    79   3e-15
YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrom...    79   3e-15
ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH] complement...    77   6e-15
Scas_699.20                                                            72   3e-13
KLLA0C06743g complement(590585..592126) similar to sp|P21595 Sac...    45   1e-04
CAGL0F02607g complement(253736..255232) similar to sp|P21595 Sac...    42   0.001
Kwal_47.18804                                                          40   0.006
KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycin...    35   0.15 
Scas_584.5                                                             33   0.59 
AFR661W [3854] [Homologous to ScYGL140C - NSH] complement(164245...    31   2.7  
YHR076W (PTC7) [2365] chr8 (251102..252226) Protein phosphatase ...    30   3.4  
Sklu_2324.4 YGL247W, Contig c2324 6462-7013 reverse complement         30   3.7  
AAR028W [214] [Homologous to ScYGR112W (SHY1) - SH] complement(3...    29   8.6  
AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH] complement(...    29   9.0  
YDR060W (MAK21) [911] chr4 (570644..573721) Protein required for...    29   9.7  
Sklu_1987.2 YBL015W, Contig c1987 2738-4309                            29   9.9  

>YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrome
           P450, delta 22(23) sterol desaturase, catalyzes an
           intermediate pathway step in the biosynthesis of
           ergosterol [1617 bp, 538 aa]
          Length = 538

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/529 (100%), Positives = 529/529 (100%)

Query: 1   MSSVAENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWD 60
           MSSVAENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWD
Sbjct: 1   MSSVAENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWD 60

Query: 61  QVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIAST 120
           QVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIAST
Sbjct: 61  QVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIAST 120

Query: 121 RDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLP 180
           RDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLP
Sbjct: 121 RDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLP 180

Query: 181 SLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY 240
           SLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY
Sbjct: 181 SLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDY 240

Query: 241 YLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWC 300
           YLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWC
Sbjct: 241 YLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWC 300

Query: 301 KLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLA 360
           KLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLA
Sbjct: 301 KLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLA 360

Query: 361 KIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNY 420
           KIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNY
Sbjct: 361 KIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNY 420

Query: 421 TAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQT 480
           TAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQT
Sbjct: 421 TAPKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQT 480

Query: 481 YVMITFAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR 529
           YVMITFAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR
Sbjct: 481 YVMITFAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR 529

>Scas_709.53
          Length = 523

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/515 (83%), Positives = 473/515 (91%), Gaps = 7/515 (1%)

Query: 15  NSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGP 74
           NST+  + +  PS       +++ T++ +SY KIF T ICI+LVWDQ++YQIKKGSIAGP
Sbjct: 7   NSTMEFVQQQTPS-------TLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGP 59

Query: 75  KFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFV 134
           +FK WPIIGPFLESLDPKFEEYKAKW SG LSCVSIFHKFV+I+STRD++RKI QSSKFV
Sbjct: 60  RFKIWPIIGPFLESLDPKFEEYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFV 119

Query: 135 KPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFV 194
           KPCVVDVA+KILRP NWVFLDGKAH DYRKSLNGLFTK ALAQYLPS EQ+MDKY+ KF+
Sbjct: 120 KPCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFI 179

Query: 195 RLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPI 254
            +SKENNYEPQVFFHEMREILCALSL +FCG YITEDQ+RKIADDYYLVTAALELVNFPI
Sbjct: 180 EISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPI 239

Query: 255 IIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDS 314
           IIP+TKTWYGK+TAD AMKIFE CAQM+KD+IA GGKP+CVMDAWCKLMHDAK  ND+DS
Sbjct: 240 IIPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDS 299

Query: 315 RIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDM 374
           RI HREF+NKEISEA+FTFLFASQDASSSLACWLFQIVADRPD+L KIR+EQ+ VRNNDM
Sbjct: 300 RILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDM 359

Query: 375 STELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYP 434
           STELN++LI+KMKYTNMVIKETLRYRPPVLMVPYVVK+ FPV+PNYTAPKG+MLIPTLYP
Sbjct: 360 STELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYP 419

Query: 435 ALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFA 494
           +LHDPEVYENPDEFIPERW EGS ASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFA
Sbjct: 420 SLHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFA 479

Query: 495 LYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR 529
           LYTDF H +TPLSEKIKVFATIFPKDDLL+TFKKR
Sbjct: 480 LYTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKR 514

>CAGL0M07656g 765772..767379 highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c C-22 sterol desaturase,
           start by similarity
          Length = 535

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/495 (84%), Positives = 463/495 (93%)

Query: 35  SILDTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFE 94
           S+LD L+ MSYL++F TLIC +LVWDQV+YQ+KKG+IAGP+FK +PIIGPFLESLDPKFE
Sbjct: 32  SLLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFE 91

Query: 95  EYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFL 154
           EYKAKW SGPLSCVSIFHKFV+IASTRDLARK+LQ+ K+VKPCVVDVAVKILRP NWVFL
Sbjct: 92  EYKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFL 151

Query: 155 DGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREI 214
           DGKAHTDYRKSLNGLFTK ALAQYLP LE++MDKY++KFV LSKENNYEPQ+FFHEMREI
Sbjct: 152 DGKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211

Query: 215 LCALSLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKI 274
           LCALSL SFCG+YI+EDQ+RKIADDYYLVTAALELVNFPII+P+TKTWYGK+TADMAMKI
Sbjct: 212 LCALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKI 271

Query: 275 FENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFL 334
           FE+CAQ AKDHIAAGGKP+CVMD WCKLMHDAKN  DDDSR+ HREFTN+EISEAVFTFL
Sbjct: 272 FESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFL 331

Query: 335 FASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIK 394
           FASQDASSSLACWLFQIVADRPDVLAKIREEQL VR  D++  L++DL++KM+YT+MV+K
Sbjct: 332 FASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVK 391

Query: 395 ETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWV 454
           ETLRYRPPVLMVPYVVK  FPV P+Y APKG+MLI TLYPALHDPEVYENPD+FIPERWV
Sbjct: 392 ETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWV 451

Query: 455 EGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFHHTVTPLSEKIKVFA 514
           EGS A+EAKKNWLVFGCGPHVCLGQTYVMIT  AL+GKFAL+TDF H VTPLSEKIKVFA
Sbjct: 452 EGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFA 511

Query: 515 TIFPKDDLLLTFKKR 529
           TIFPKDDLLL+FKKR
Sbjct: 512 TIFPKDDLLLSFKKR 526

>Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement
          Length = 540

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/495 (83%), Positives = 460/495 (92%)

Query: 35  SILDTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFE 94
           +++D+++S+SY K+F T+IC+ LVWDQV+YQIKKGSIAGPK+K WP+IGPFLESLDPKFE
Sbjct: 37  NVIDSVQSISYWKLFVTIICVGLVWDQVSYQIKKGSIAGPKWKVWPVIGPFLESLDPKFE 96

Query: 95  EYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFL 154
           EYKAKW SGPLSCVSIFHKFVVIASTRDLARKILQS KFVKPCVVDVA+KILRP NWVFL
Sbjct: 97  EYKAKWDSGPLSCVSIFHKFVVIASTRDLARKILQSPKFVKPCVVDVAIKILRPSNWVFL 156

Query: 155 DGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREI 214
           DGK H DYRKSLNGLFTK ALAQYLPS E +M+KY++KFV LSKEN YEPQVFFHEMREI
Sbjct: 157 DGKQHVDYRKSLNGLFTKSALAQYLPSQENVMNKYLEKFVELSKENKYEPQVFFHEMREI 216

Query: 215 LCALSLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKI 274
           +CALSL +FCG+YITEDQ+RK+ADDYYLVTAALELVNFPII+P+TKTWYGKKTADM MKI
Sbjct: 217 MCALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIILPFTKTWYGKKTADMTMKI 276

Query: 275 FENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFL 334
           FE CAQMAKDHIA+GG   CVMDAWCKLMHDAKN ND DSR+ HREF+NKEISEA+FTFL
Sbjct: 277 FEQCAQMAKDHIASGGPTTCVMDAWCKLMHDAKNQNDADSRLLHREFSNKEISEAIFTFL 336

Query: 335 FASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIK 394
           FASQDASSSLACWLFQIVADRPDVL KIREEQL VR ND +  L+LDLIE+MKYTNMV+K
Sbjct: 337 FASQDASSSLACWLFQIVADRPDVLEKIREEQLKVRENDPTKALSLDLIEEMKYTNMVVK 396

Query: 395 ETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWV 454
           E+LRYRPPVLMVPYVVK+ FP++PNY+APKG+MLIPTLYPALHDPEVYENPDEFIPERWV
Sbjct: 397 ESLRYRPPVLMVPYVVKQKFPIAPNYSAPKGSMLIPTLYPALHDPEVYENPDEFIPERWV 456

Query: 455 EGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFHHTVTPLSEKIKVFA 514
           EGS A++AK+NWLVFG GPHVCLGQTYVM+TF AL+GKFA+YTDF H VTPLSEKIKVFA
Sbjct: 457 EGSPANQAKRNWLVFGSGPHVCLGQTYVMMTFTALIGKFAMYTDFEHKVTPLSEKIKVFA 516

Query: 515 TIFPKDDLLLTFKKR 529
           TIFPKDDLLL+FKKR
Sbjct: 517 TIFPKDDLLLSFKKR 531

>KLLA0D11242g complement(959973..961577) highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c ERG5 C-22 sterol
           desaturase, start by similarity
          Length = 534

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/524 (76%), Positives = 465/524 (88%)

Query: 6   ENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWDQVAYQ 65
           +NI+   T N+T            +  A  +++T++ MSY K+F TL+ I++VWDQV+YQ
Sbjct: 2   DNIVVSQTSNATQVASEASVKLFSLANAQQLVETVQQMSYFKLFCTLVAIVIVWDQVSYQ 61

Query: 66  IKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLAR 125
           I+KG+IAGPK+K WP+IGPFLES DPKFEEY AKW SGPLSCVSIFHKFVVIASTRDLAR
Sbjct: 62  IQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLSCVSIFHKFVVIASTRDLAR 121

Query: 126 KILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLPSLEQI 185
           KI QS ++VKPCVVDVAVKILRP NWVFLDGK H DYRKSLNGLFTKQALA+Y+PS E +
Sbjct: 122 KIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKSLNGLFTKQALAKYMPSQELL 181

Query: 186 MDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDYYLVTA 245
           MDKY++KF+ LSKEN YE +VFFH+MREI+CALSL +FCG+YITEDQ+RK+ADDYYLVTA
Sbjct: 182 MDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVTA 241

Query: 246 ALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHD 305
           ALELVNFPIIIPYTKTWYGKKTADM MKIFE CAQMAKDHIAAGG+  CV+DAWC LMH+
Sbjct: 242 ALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMHE 301

Query: 306 AKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREE 365
           AKN +D DS++YHREFTN+E+SEA+FTFLFASQDASSSLACW+FQI+ADRPDV+A IREE
Sbjct: 302 AKNKDDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREE 361

Query: 366 QLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKG 425
           QL VRNND + +L++DLI++MKYTNMV+KETLRYRPPV+MVPY VKK+FPV P Y+APKG
Sbjct: 362 QLRVRNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPKG 421

Query: 426 AMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMIT 485
           +MLIPTLYPALHDPEVYE+PDEFIPERWVEGS A++AKKNWLVFGCGPHVCLGQTYVM T
Sbjct: 422 SMLIPTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQT 481

Query: 486 FAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR 529
           F  L+GKFA+++D+ H VTPLSEKIKVFATIFPKDDLLL+FKKR
Sbjct: 482 FTGLIGKFAMFSDWEHKVTPLSEKIKVFATIFPKDDLLLSFKKR 525

>ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH]
           (492258..493805) [1548 bp, 515 aa]
          Length = 515

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/471 (77%), Positives = 417/471 (88%), Gaps = 1/471 (0%)

Query: 60  DQVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIAS 119
           DQ AY+  KG IAGP +K WP+IGPFLESLDPKFE Y+AKWASGPLSCVSIFHKFVVIAS
Sbjct: 36  DQAAYRRNKGRIAGPAWKMWPLIGPFLESLDPKFEVYQAKWASGPLSCVSIFHKFVVIAS 95

Query: 120 TRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYL 179
           TRDL RKILQS K+VKPC+VDVA KILRP NWVFLDG+AH DYR+SLNGLFT+ ALA+YL
Sbjct: 96  TRDLTRKILQSPKYVKPCLVDVAKKILRPTNWVFLDGQAHLDYRRSLNGLFTRDALARYL 155

Query: 180 PSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADD 239
           PS E ++D+YM KFV  S+E +YE +VFFHEMRE+LCALSL +FCG+YIT+DQVRKIADD
Sbjct: 156 PSQEAVIDRYMAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADD 215

Query: 240 YYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAW 299
           YYLVTAALELVNFP+I+P+TKTWYGK+TADMAMKIFE CAQ AK HIAAGG+P CV+DAW
Sbjct: 216 YYLVTAALELVNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAW 275

Query: 300 CKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVL 359
           CKLM DAK  +D DSR+ HR+FTN+E+SEA+FTFLFASQDASSSLACWLFQIVADRPDVL
Sbjct: 276 CKLMLDAKAKDDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDVL 335

Query: 360 AKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPN 419
           AKIREEQLAVR ND S  L+L+LI++MKYT+M +KE LRYRPPVLMVPY V + F VS +
Sbjct: 336 AKIREEQLAVRRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAVSAD 395

Query: 420 YTAPKGAMLIPTLYPALHDPEVYENPDEFIPERW-VEGSKASEAKKNWLVFGCGPHVCLG 478
           YTAPKG+ML+ T+YPALHDP VYENPD++IPERW  E S A++AKKNWLVFG GPHVCLG
Sbjct: 396 YTAPKGSMLVATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGPHVCLG 455

Query: 479 QTYVMITFAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR 529
           Q YV +TF AL+GKFAL+T+F H VT LSEKIKVFATIFP+DDLL++FKKR
Sbjct: 456 QKYVFMTFTALIGKFALFTEFDHKVTSLSEKIKVFATIFPQDDLLMSFKKR 506

>Kwal_26.8172
          Length = 336

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 312/336 (92%)

Query: 190 MDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDYYLVTAALEL 249
           M+KFV  S E N+EPQV+FHE+REI+CALSL +FCG+YITE Q+RK+ADDYYLVTAALEL
Sbjct: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60

Query: 250 VNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNS 309
           VNFPII+P+TKTWYG++TADM MKIFE CAQMAKDHIAAGGKP CVMDAWC+LMH+AKN 
Sbjct: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120

Query: 310 NDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAV 369
           ND+DSR++HREFTN+EISEAVFTFLFASQDASSSLACWLFQIVADRPDV+ KIREEQL V
Sbjct: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180

Query: 370 RNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLI 429
           RNND S  L+LDLI++MKYT MV+KETLRYRPPV+MVPYVVK  FP++PNYTAPKGAMLI
Sbjct: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240

Query: 430 PTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAAL 489
           PTLYPALHDPEVY++P+EFIPERWVEGS A+EAKKNWLVFG G HVCLGQTYVM+TF AL
Sbjct: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300

Query: 490 LGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLT 525
           +GKFA+YT++ H VTPLSEKIKVFATIFPKDDLLLT
Sbjct: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKDDLLLT 336

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 94/193 (48%), Gaps = 22/193 (11%)

Query: 320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELN 379
           + T++EI+  +   L   Q  S++ + W+   +A+RPD+  K+ EEQ+ V +N  + EL 
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWVILHLAERPDIQEKLYEEQMKVLDNG-TKELT 357

Query: 380 LDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPN--YTAPKG-AMLIPTLYPAL 436
            DL+++M   N  IKETLR   P+  +   V  + PV PN  Y  PKG  +L+   Y  L
Sbjct: 358 FDLLQEMPLLNQTIKETLRLHHPLHSLFRKVMNDMPV-PNSSYVVPKGHHVLVSPGYCHL 416

Query: 437 HDPEVYENPDEFIPERWVEGSKASEAKKN----------------WLVFGCGPHVCLGQT 480
            D + + N  EF P RW   + +S A                   +L FG G H C+G+ 
Sbjct: 417 QD-KYFPNASEFNPNRWDNDAASSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEH 475

Query: 481 YVMITFAALLGKF 493
           +  +    +L  +
Sbjct: 476 FAYMQLGTILSNY 488

>Kwal_47.18323
          Length = 536

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 93/202 (46%), Gaps = 24/202 (11%)

Query: 307 KNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQ 366
           KNS   D      + T++EI+  +   L   Q  S++ + W+   +A+RPD+  ++  EQ
Sbjct: 294 KNSTYKDGT----KMTDQEIANLLIGVLMGGQHTSAATSAWMLLHLAERPDLQEELYAEQ 349

Query: 367 LAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPV-SPNYTAPKG 425
           + V +N    EL  +L+++M   N  IKETLR   P+  +   V+++ PV    Y  P+G
Sbjct: 350 MEVLDNG-KKELTYELLQQMPLLNQTIKETLRMHHPLHSIFRRVERDLPVPKTQYVVPRG 408

Query: 426 A-MLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKN----------------WLV 468
             +L+   Y  L D E +   + F P RW    K+S A                   +L 
Sbjct: 409 HFVLVSPGYCHLQD-EYFPKANTFDPHRWNNDYKSSYATGEEVDYGFGAISKGVSSPYLP 467

Query: 469 FGCGPHVCLGQTYVMITFAALL 490
           FG G H C+G+ +       L+
Sbjct: 468 FGGGRHRCIGEHFAYCQLGVLM 489

>Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement
          Length = 532

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 89/190 (46%), Gaps = 22/190 (11%)

Query: 320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELN 379
           + T++EI+  +   L   Q  S++ + WL   +A++P++  ++  EQ+ V +N    EL 
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWLLLHLAEKPELQEELYAEQMRVLDNG-KKELT 357

Query: 380 LDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPN--YTAPKG-AMLIPTLYPAL 436
            DL+++M   N  IKETLR   P+  +   V ++ PV PN  Y  PKG  +L+   Y  L
Sbjct: 358 YDLLQEMPLLNQTIKETLRMHHPLHSIFRKVMRDLPV-PNTSYVVPKGHHVLVSPGYAHL 416

Query: 437 HDPEVYENPDEFIPERWVE----------------GSKASEAKKNWLVFGCGPHVCLGQT 480
            D E + +   F P RW                  GS +      +L FG G H C+G+ 
Sbjct: 417 RD-EYFPHAATFDPHRWDNDAASSYSSSEQVDYGFGSVSKGVSSPYLPFGGGRHRCVGEH 475

Query: 481 YVMITFAALL 490
           +       ++
Sbjct: 476 FAYCQLGTIM 485

>CAGL0E04334g complement(415351..416952) highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11, start by
           similarity
          Length = 533

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 148/353 (41%), Gaps = 37/353 (10%)

Query: 163 RKSLNGLFTKQALAQYLPSLEQIMDKYM--DKFVRLSKENNYEPQVFFHEMREILCALSL 220
           +K + G  TK+A  +Y+P + + + KY    K  ++++ N+    V   +  E+    + 
Sbjct: 152 KKFVKGALTKEAFVRYVPLIAEEIYKYFRNSKNFKINENNSGIVDVMVSQ-PEMTIFTAS 210

Query: 221 NSFCGNYITEDQVRKIADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQ 280
            S  G  + +      A  Y  +      +NF  + P     + +K       I      
Sbjct: 211 RSLLGKEMRDKLDTDFAYLYSDLDKGFTPINF--VFPNLPLEHYRKRDHAQQAISGTYMS 268

Query: 281 MAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDA 340
           + K+        +   D   +LM   KNS   D      + T++EI+  +   L   Q  
Sbjct: 269 LIKERREKND--IQNRDLIDELM---KNSTYKDGT----KMTDQEIANLLIGVLMGGQHT 319

Query: 341 SSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYR 400
           S++ + W    +A+RPDV  ++ +EQ+ V NND + EL  D ++ M   N +IKETLR  
Sbjct: 320 SAATSAWCLLHLAERPDVQEELYQEQMRVLNND-TKELTYDDLQNMPLLNQMIKETLRLH 378

Query: 401 PPVLMVPYVVKKNFPVSPN--YTAPKG-AMLIPTLYPALHDPEVYENPDEFIPERWVEGS 457
            P+  +   V ++  + PN  Y  P+   +L+   Y  L + E +  P+EF   RW   +
Sbjct: 379 HPLHSLFRKVMRDVAI-PNTSYVVPRDYHVLVSPGYTHLQE-EFFPKPNEFNIHRWDGDA 436

Query: 458 KASEAKKN-----------------WLVFGCGPHVCLGQTYVMITFAALLGKF 493
            +S A                    +L FG G H C+G+ +       L+  F
Sbjct: 437 ASSSAAGGDEVDYGFGAISKGVSSPYLPFGGGRHRCIGELFAYCQLGVLMSIF 489

>YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrome
           P450 (lanosterol 14alpha-demethylase), essential for
           biosynthesis of ergosterol [1593 bp, 530 aa]
          Length = 530

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 93/201 (46%), Gaps = 22/201 (10%)

Query: 320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELN 379
           + T++EI+  +   L   Q  S++ + W+   +A+RPDV  ++ EEQ+ V +     EL 
Sbjct: 298 KMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGG-KKELT 356

Query: 380 LDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPN--YTAPKG-AMLIPTLYPAL 436
            DL+++M   N  IKETLR   P+  +   V K+  V PN  Y  P G  +L+   Y  L
Sbjct: 357 YDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHV-PNTSYVIPAGYHVLVSPGYTHL 415

Query: 437 HDPEVYENPDEFIPERWVEGSKASEA----------------KKNWLVFGCGPHVCLGQT 480
            D E + N  +F   RW + S +S +                   +L FG G H C+G+ 
Sbjct: 416 RD-EYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEH 474

Query: 481 YVMITFAALLGKFALYTDFHH 501
           +       L+  F     +H+
Sbjct: 475 FAYCQLGVLMSIFIRTLKWHY 495

>ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH]
           complement(987458..989047) [1590 bp, 529 aa]
          Length = 529

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 88/189 (46%), Gaps = 20/189 (10%)

Query: 320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELN 379
           + T+++I+  +   L   Q  S++ + W+   +A+RPD+  ++ EEQ+ V +   + EL 
Sbjct: 296 KMTDQQIANLLIGVLMGGQHTSAATSAWVLLHLAERPDIQEELYEEQMRVLDGG-AKELT 354

Query: 380 LDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPN--YTAPKGAMLIPTLYPALH 437
            +L+++M   N VIKETLR   P+  +   V ++ PV PN  Y  PK   ++ +      
Sbjct: 355 YELLQEMPLLNQVIKETLRMHHPLHSLFRKVTRDMPV-PNTSYVIPKDHYVLASPGFCHL 413

Query: 438 DPEVYENPDEFIPERWVE----------------GSKASEAKKNWLVFGCGPHVCLGQTY 481
             E + N  EF P RW                  G+ +      +L FG G H C+G+ +
Sbjct: 414 SEEYFPNAKEFNPHRWDNDAASSVSTGEKVDYGFGAISKGVSSPYLPFGGGRHRCIGEGF 473

Query: 482 VMITFAALL 490
             +    + 
Sbjct: 474 AYMQLGTIF 482

>Scas_699.20
          Length = 538

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 94/203 (46%), Gaps = 28/203 (13%)

Query: 320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELN 379
           + T+ EI+  +   L   Q  S++ + W    +A+RPDV  ++ +EQ+ V +N    E+ 
Sbjct: 305 KMTDPEIANLLIGVLMGGQHTSAATSAWCLLHLAERPDVQEELYQEQMRVLDNG-KKEIT 363

Query: 380 LDLIEKMKYTNMVIKETLRYRPPV----------LMVP---YVVKKNF--PVSPNYTAPK 424
            DL+E+M   N +IKETLR   P+          + VP   YV+ K++   VSP YT   
Sbjct: 364 YDLLEQMPLLNQMIKETLRLHHPLHSLFRKVIRDMQVPNTSYVIPKDYFVLVSPGYTH-- 421

Query: 425 GAMLIPTLYPALHDPEVY--ENPDE--FIPERWVE---GSKASEAKKNWLVFGCGPHVCL 477
              L    +P  H   ++  +N  E  ++    V+   G+        +L FG G H C+
Sbjct: 422 ---LQEHYFPQAHSFNIHRWDNDAESSYVVGEEVDYGFGAITKGVTSPYLPFGGGRHRCI 478

Query: 478 GQTYVMITFAALLGKFALYTDFH 500
           G+ Y       ++ +F     +H
Sbjct: 479 GEHYAYCQLGVIMAEFIREMKWH 501

>KLLA0C06743g complement(590585..592126) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450 56
           singleton, start by similarity
          Length = 513

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 70/172 (40%), Gaps = 17/172 (9%)

Query: 360 AKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPV-LMVPYVVKKNFPVSP 418
           AK +  Q A+R   +S + N D++   K T   I E LR  PP+  ++     +   + P
Sbjct: 315 AKHQNWQYAIREELLSVDRNEDILNSFKLT-AFIYEALRMFPPLGQIINRRTTRKCQLGP 373

Query: 419 NYTAPKGAMLIPTLYPALHDPEVY-ENPDEFIPERWVEGSKASEAKKNW---------LV 468
                K       +Y       V+ E   +FIPERW  G  ++E   NW           
Sbjct: 374 GIIIDKDVYCGYNVYGTGTATSVWGETAKQFIPERW--GENSNELANNWKKHKYDASMSA 431

Query: 469 FGCGPHVCLGQTYVMITFAALLGKFALYTDFHHTVTP-LSEKIKVFATIFPK 519
           F  G   CLG+   ++    +L  + +  +FH  + P   EK+     I PK
Sbjct: 432 FHGGRRSCLGEKLALMEMKYVL--YYVLMNFHIELHPQWKEKMTPAGPICPK 481

>CAGL0F02607g complement(253736..255232) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450,
           hypothetical start
          Length = 498

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 12/141 (8%)

Query: 390 NMVIKETLRYRPPV-LMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVY-ENPDE 447
           N  + E LRY PP+ +++     K   + P    PK   +    Y   HD   +    D 
Sbjct: 339 NSFLYECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCHDSNFWGHTSDI 398

Query: 448 FIPERWVEG----SKASEAKKNWLV---FGCGPHVCLGQTYVMITFAALLGKFALYTDFH 500
           F P RW +     +KA +  KN  +   F  G   CLG+  V ++   ++ +F   + F 
Sbjct: 399 FDPTRWGKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTRIIIAEFL--SSFE 456

Query: 501 HTVTPL-SEKIKVFATIFPKD 520
             ++PL  E++     + PKD
Sbjct: 457 WKLSPLWVEQMTHAGPLCPKD 477

>Kwal_47.18804
          Length = 508

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 79/215 (36%), Gaps = 29/215 (13%)

Query: 309 SNDDDSRIYHRE-FTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQL 367
           S+ D  R Y+RE  + K++ + +   + A  +    L    F +          +REE  
Sbjct: 286 SSSDLIRSYNREEISKKQLIDNIVIIMVAGHENPQLLLTTCFYMFGKNRKWQDLVREEVQ 345

Query: 368 AVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPV-LMVPYVVKKNFPVSPNYTAPKGA 426
                       ++ +  +   N  I E +R  PP+  ++     K   +  +   P+  
Sbjct: 346 GC---------GIENLNDLPLLNSFIFECIRMYPPLSQIINRCTTKKCVLGTDIVLPENV 396

Query: 427 MLIPTLYPALHDPEVY-ENPDEFIPERWVEGSKASEAKKNW---------LVFGCGPHVC 476
            L   +Y        + +N D FIPERW  G+   E  K W           F  G   C
Sbjct: 397 YLGYNVYSTGRYKSAWGDNADCFIPERW--GNNIEEITKEWRHRKNTCAMAAFHGGRRAC 454

Query: 477 LGQTY----VMITFAALLGKF--ALYTDFHHTVTP 505
           LG+      V I  AA+L  F   L   +   VTP
Sbjct: 455 LGEKLALMEVRIAMAAVLKNFEWTLAASWVDKVTP 489

>KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycine
           max Cytochrome P450 71D10 (EC 1.14.-.-), hypothetical
           start
          Length = 511

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 90/224 (40%), Gaps = 25/224 (11%)

Query: 320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELN 379
           +FT     + +   LFA+ + +S++  W    +    +   ++R E L V+      + N
Sbjct: 293 KFTFNNWIQTIDEILFANIEVTSTVMAWALVEMGSNIEEQNRLRCEILKVKEQSSKDDFN 352

Query: 380 LD---LIEKMKYTNMVIK----ETLRYRPPV-LMVPYVVKKNFPVSPNYTAPKGAMLIPT 431
            +   +   MK T+  ++    ETLR  P +    P +  +   +     +P   +++  
Sbjct: 353 KETDPMQRYMKLTDTYLQYCVWETLRMHPLLWFSFPEISSETLFIDGIRISPNTPIVVDQ 412

Query: 432 LYPALHDPEVYENPD-------EFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMI 484
            Y   ++  ++   D       +F P R+ E     +A  + + FG G   CLG+     
Sbjct: 413 -YQINYNSPIWNPSDKPKDFGKKFAPSRF-ENITLRDALYSQVTFGAGSRKCLGR----- 465

Query: 485 TFAALLGKFALYTDFHHTVTPLSEKIKVFATIF---PKDDLLLT 525
            FA LL K  L          L+EK++     F   PK  + LT
Sbjct: 466 NFAELLIKSELAYILSKYKVTLTEKVEFSKDTFVVQPKTKIQLT 509

>Scas_584.5
          Length = 367

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 169 LFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREI 214
           LF K   AQ   +L+ + +K++ K V LSK+ NY P +F  E+ ++
Sbjct: 302 LFLKDESAQIQKNLQNVTEKFVKKVVALSKDPNY-PSLFSQELSKL 346

>AFR661W [3854] [Homologous to ScYGL140C - NSH]
           complement(1642457..1645996) [3540 bp, 1179 aa]
          Length = 1179

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 241 YLVTAALELVNFPIIIPYTKTWYGK 265
           + VT AL L +FP+ IP T+ WY K
Sbjct: 626 FQVTIALTLASFPMYIPATREWYMK 650

>YHR076W (PTC7) [2365] chr8 (251102..252226) Protein phosphatase
           type 2C, localizes to mitochondria and may be involved
           in utilization of nonfermentable carbon sources under
           oxygen-limiting conditions [1125 bp, 374 aa]
          Length = 374

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 169 LFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREI 214
           LF K   A+    L+ +  K++D  V LSK+ NY P VF  E+ ++
Sbjct: 309 LFLKDNAARTNDELQLLSQKFVDNVVSLSKDPNY-PSVFAQEISKL 353

>Sklu_2324.4 YGL247W, Contig c2324 6462-7013 reverse complement
          Length = 183

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 225 GNYITEDQVRKIADDYYLV-TAALELVNFPIIIPYTKTWYGK---KTADMAMKIFENCAQ 280
            N++  D  R ++    L+  AAL  + F +++ + +  +     K    +M + +   Q
Sbjct: 20  SNFLDPDAPRILSQYLQLIFNAALASLAFYLLVRFVQLIHTDVQLKLKQKSMDLVQAALQ 79

Query: 281 MAKDHIAAGGKP---VCVMDAWCKLMHDAKNSNDDDSRIYHR 319
            A+++   G +P   V  ++A C   +   N+ D D+R++ R
Sbjct: 80  CAREYERNGCEPSKRVPALEAQCNHWYRCMNNQDTDTRVHQR 121

>AAR028W [214] [Homologous to ScYGR112W (SHY1) - SH]
           complement(391187..392317) [1131 bp, 376 aa]
          Length = 376

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 331 FTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTN 390
            T + A    S  L  W  + +  + +++AK  E+QL  R   +  +   ++ E+ +Y  
Sbjct: 63  LTLMCAIPVVSFYLGMWQLRRLKWKTELIAKC-EDQLTYRPVPLPQKFTPEMCEQWEYRR 121

Query: 391 MVIKETLRYRPPVLMVPYV 409
           +V+K   R+   + + P V
Sbjct: 122 VVVKGAFRHEEEIFVGPRV 140

>AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH]
           complement(472535..474505) [1971 bp, 656 aa]
          Length = 656

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 35/67 (52%)

Query: 296 MDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADR 355
           +  W +++ D+     ++  +     T+  ++EA F   FA+ D  SS  C   Q+V++ 
Sbjct: 430 LTVWTEVLQDSFLDLFENGSLEFATATSIRLTEAGFEKFFANWDEYSSKLCLRSQVVSNS 489

Query: 356 PDVLAKI 362
           P+++ ++
Sbjct: 490 PEMIRRL 496

>YDR060W (MAK21) [911] chr4 (570644..573721) Protein required for
           60S ribosomal subunit biogenesis [3078 bp, 1025 aa]
          Length = 1025

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 15/93 (16%)

Query: 239 DYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDA 298
           D  L+T    + +  +IIPY K WY +   D  +   ++  +++K+ I            
Sbjct: 196 DGGLITQTTIISSDKLIIPYDKPWY-EIPLDPQVGQNDDVEELSKEQIE----------- 243

Query: 299 WCKLMHDAKNSNDDDSRIYHREFTNKEISEAVF 331
             KL    K + + D++ Y+ EFT K+ S+A F
Sbjct: 244 --KLFERGKQTLEADNQTYYEEFT-KDSSQAKF 273

>Sklu_1987.2 YBL015W, Contig c1987 2738-4309
          Length = 523

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/67 (19%), Positives = 36/67 (53%)

Query: 296 MDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADR 355
           ++ W +++ D+     ++  + +   T+  ++EA F   F + D+ S   C   Q+V++ 
Sbjct: 297 LNVWTEVLQDSFLDLFENGSLDYATATSIRLTEAGFERFFENWDSFSKKLCLRSQVVSNN 356

Query: 356 PDVLAKI 362
           P+++ ++
Sbjct: 357 PEIIRRL 363

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,519,880
Number of extensions: 760662
Number of successful extensions: 2032
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2058
Number of HSP's successfully gapped: 29
Length of query: 529
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 423
Effective length of database: 12,926,601
Effective search space: 5467952223
Effective search space used: 5467952223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)