Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR014W (BUD22)51951018690.0
Scas_709.544705054524e-50
Sklu_2168.34795154228e-46
Kwal_26.81704935253702e-38
KLLA0D11220g4775143542e-36
ABR052W5095233131e-30
CAGL0M07678g4732252012e-16
KLLA0F00462g62895780.19
Scas_710.46*295043657.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR014W
         (510 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...   724   0.0  
Scas_709.54                                                           178   4e-50
Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           167   8e-46
Kwal_26.8170                                                          147   2e-38
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   140   2e-36
ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...   125   1e-30
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...    82   2e-16
KLLA0F00462g complement(33094..34980) weakly similar to sp|Q9HFC...    35   0.19 
Scas_710.46*                                                           30   7.6  

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/510 (73%), Positives = 373/510 (73%)

Query: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXX 60
           MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIG                
Sbjct: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLEL 60

Query: 61  XXXXXXXXXSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXXXXXDAQKNKSPSIDIEK 120
                    SYSKLLNNKIHYYETHL                    DAQKNKSPSIDIEK
Sbjct: 61  KTLDKELDESYSKLLNNKIHYYETHLSKCIKEQIQKISKKNSSKVKDAQKNKSPSIDIEK 120

Query: 121 MLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSK 180
           MLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSK
Sbjct: 121 MLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSK 180

Query: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAR 240
           WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAR
Sbjct: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAR 240

Query: 241 EKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEYXXXXX 300
           EKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEY     
Sbjct: 241 EKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEYEGMLG 300

Query: 301 XXXXXXXXXXYLNPNINYNEVTXXXXXXXXXXXXXXXXXXXXXXXXXPRRKKPKLHNLPE 360
                     YLNPNINYNEVT                         PRRKKPKLHNLPE
Sbjct: 301 SSGDEGEGGGYLNPNINYNEVTDEEPSEASSDEDDSDERFSDSEENEPRRKKPKLHNLPE 360

Query: 361 LMAGYYSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEPXXXXXXXXXXXXXIW 420
           LMAGYYSGNDTEEESDED          RDTAEDRTAREQMSNEP             IW
Sbjct: 361 LMAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQMSNEPKRKNRRGQRARRKIW 420

Query: 421 EKKYGSQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNN 480
           EKKYGSQAKHVQRELEKEMEDRKQRQIEY                             NN
Sbjct: 421 EKKYGSQAKHVQRELEKEMEDRKQRQIEYEARVAKREAKAASLEASRSREREDRRTETNN 480

Query: 481 KKEKESASTGEEHPSWIAKRLAEEKLQKAK 510
           KKEKESASTGEEHPSWIAKRLAEEKLQKAK
Sbjct: 481 KKEKESASTGEEHPSWIAKRLAEEKLQKAK 510

>Scas_709.54
          Length = 470

 Score =  178 bits (452), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 153/505 (30%), Positives = 217/505 (42%), Gaps = 53/505 (10%)

Query: 9   IYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXXXXXXXXXX 68
           ++KLD LEYQ HYL  +L  FEPR  +T K YN  G                        
Sbjct: 7   LFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIEDVERQLN 66

Query: 69  XSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXXXXXDAQKNKSPSIDIEKMLATQLSL 128
               ++ + KIH++E +L                    +++  K+      + +  Q  +
Sbjct: 67  EIKLEIFDKKIHHFENNLTKNLIKLLENE---------NSKLIKNFDKTTLEAIKNQYGI 117

Query: 129 DDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSKWNPSNIWN 188
              A  +   + IK+   +I  KSKKIE   +   W   ++Y     DK +++NPS IWN
Sbjct: 118 PQFAKLLCLSKSIKLTTGKIVPKSKKIE---DTPQWFVKHNYWEIYQDKNNEFNPSRIWN 174

Query: 189 EVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAREKTA--NA 246
           EVI K+   + L +LI   K V+++ +SF+  + +  G +    K KK   REK     A
Sbjct: 175 EVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGIN----KGKKL-QREKNGLNKA 229

Query: 247 NQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEYXXX-XXXXXXX 305
           + +++ ++   DD +E + +  +  A+  +T+   +   ++E L   +Y           
Sbjct: 230 SSSNNEVEMQEDDASEDDELTERP-ALRRETRDEDQEIDEDEIL--NQYEGMLAASDDEE 286

Query: 306 XXXXXYLNPNINYNEVTXXXXXXXXXXXXXXXXXXXXXXXXXPRRKKPKLHNLPELMAGY 365
                 L+  INYNEVT                           RKKPKL   PELM GY
Sbjct: 287 GEEASGLDKTINYNEVTDEEPSDDEDSESEEPS-----------RKKPKL---PELMGGY 332

Query: 366 YSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEPXXXXXXXXXXXXXIWEKKYG 425
           YSG    E SD             D  ED+ AREQMSN+P             IWEKKYG
Sbjct: 333 YSGG---ESSD-------------DEKEDKIAREQMSNKPQRKNRRGQRARRKIWEKKYG 376

Query: 426 SQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNKKEKE 485
           SQAKHVQRE+EKE E+RKQRQI Y                                K  +
Sbjct: 377 SQAKHVQREVEKEFEERKQRQIAYEERAAKRAAKEEAFQKMVREHELERESKQGQSKWPK 436

Query: 486 SASTGEEHPSWIAKRLAEEKLQKAK 510
                 EHPSW+AKR+AEEK + AK
Sbjct: 437 VKEPQAEHPSWVAKRVAEEKEKNAK 461

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  167 bits (422), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 135/515 (26%), Positives = 213/515 (41%), Gaps = 50/515 (9%)

Query: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXX 60
           MP E+   I+KLD LEYQYHYL  +L  F+PR   T KL++  G                
Sbjct: 1   MPKENL--IFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATL 58

Query: 61  XXXXXXXXXSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXXXXXDAQKNKSPSIDIEK 120
                         L  K+++ +  L                      + +K     +E 
Sbjct: 59  DSVSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALED 118

Query: 121 MLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSK 180
            + +  +    +  + + ++++++  +I       E   N   W  ++D      DK  +
Sbjct: 119 -IKSDFTFTKFSQLIAKSKIVRLVISKITPTKTLKE---NPPQWFESSDILHVYRDKEDE 174

Query: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSA-MKAKKYGA 239
            NPSN+WN+V+ K+  CEKL +++  SK  + L +SFD  + +  G +    ++ KK  A
Sbjct: 175 CNPSNVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEA 234

Query: 240 REKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEY---- 295
            +K++NA    S  D+ TDDG      D + +A         E ++ +E+ L+++Y    
Sbjct: 235 NKKSSNALDDDSGEDF-TDDG----VSDREDDA---------EFSTADEEALVQQYKGML 280

Query: 296 XXXXXXXXXXXXXXXYLNPNINYNEVTXXXXXXXXXXXXXXXXXXXXXXXXXPRRKKPKL 355
                          +L+PN++YNEVT                           + +   
Sbjct: 281 AGSDEEDDADEQQGYHLDPNVDYNEVTDEEPTDNESELEEEEKLEEPPKKKQKNKAQ--- 337

Query: 356 HNLPELMAGYYSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEPXXXXXXXXXX 415
             LPELMAGY+SG   +E  D                 DR A+EQ+SNEP          
Sbjct: 338 --LPELMAGYFSGGSDDEIED-----------------DRIAKEQLSNEPKRKNRRGQRA 378

Query: 416 XXXIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXXXXXXXXXXXX 475
              IWEKKYG  AKHVQR+ EK+ E+R++RQ+EY                          
Sbjct: 379 RQKIWEKKYGKNAKHVQRQHEKDKEEREKRQVEYEERVAKRAANSVRLAEEAREKAQRLE 438

Query: 476 XXXNNKKEKESASTGEEHPSWIAKRLAEEKLQKAK 510
                ++EK +      HPSW AK+ AEE+L+  K
Sbjct: 439 ERKRQQEEKRNDPI---HPSWQAKKQAEERLKNVK 470

>Kwal_26.8170
          Length = 493

 Score =  147 bits (370), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 136/525 (25%), Positives = 204/525 (38%), Gaps = 55/525 (10%)

Query: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXX 60
           MP E+   I+KLD LEYQYH+L  SL  F+PR   TAK +N  G                
Sbjct: 1   MPKENL--IFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNL 58

Query: 61  XXXXXXXXXSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXXXXXDAQKNKSPSIDIEK 120
                       +++  K ++ E  L                    +  K++  ++    
Sbjct: 59  TEVSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTL---A 115

Query: 121 MLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSK 180
            L    ++   +  + ++R  K+L  ++   +K +  D     WL +N+Y    NDK + 
Sbjct: 116 TLEKSYTIPGFSKLIAKYRTCKLLVPKL-LFTKALREDP--PQWLKDNEYVTIFNDKNNT 172

Query: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAR 240
            NP  +WNEVI     CE+L +L    K ++ L   FD ++ L        M  KK   R
Sbjct: 173 HNPGKVWNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLF-------MNKKK--ER 223

Query: 241 EKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSD----NEDLLIKEYX 296
           E + N     S       + +E+++ D   +   A + S  E        +ED ++K+Y 
Sbjct: 224 EASQNNTNEQSKPSRAVPETDERSSEDENGDNDFASSSSEGEDADGSALIDEDEILKQYE 283

Query: 297 XXXXXXXXXXXXXXY--LNPNINYNEVTXXXXXXXXXXXXXXXXXXXXXXXXXPRRKKPK 354
                            LNP+INYNEVT                          ++K+ +
Sbjct: 284 GMLVASDEEGEDLTMPSLNPDINYNEVTDEEPSESENDSDISLSDGEEDVPPLKKQKRSQ 343

Query: 355 LH---------NLPELMAGYYSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEP 405
                      NLPELM GYYSG   +E                  +ED  A +Q SNEP
Sbjct: 344 EREDDQSKVKTNLPELMTGYYSGGSDDE-----------------ISEDEVAAKQASNEP 386

Query: 406 XXXXXXXXXXXXXIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXX 465
                        IWEKKYG  AKHVQR++E E  +R++++ EY                
Sbjct: 387 KRKNRRGQRARQKIWEKKYGHNAKHVQRQVEAEKSERERKKQEY------EARVAKRAAR 440

Query: 466 XXXXXXXXXXXXXNNKKEKESASTGEEHPSWIAKRLAEEKLQKAK 510
                        + K  +  A     HPSW AK++AEEK + AK
Sbjct: 441 AQDREATTRKRPSDPKTWEAPAKDAPIHPSWEAKKMAEEKQKGAK 485

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  140 bits (354), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 136/514 (26%), Positives = 210/514 (40%), Gaps = 64/514 (12%)

Query: 9   IYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXXXXXXXXXX 68
           I+KLD LEYQ HY+    ++F+PR+ +T + +N                           
Sbjct: 7   IFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQKINGEIS 66

Query: 69  XSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXXXXXDAQKNKSPSIDIEKMLATQLSL 128
               K+L+ KIH+    L                         K+P I  E  +A ++  
Sbjct: 67  SLRLKILDQKIHHVLQRLQTHWI--------------------KNPLILREPEVA-KIGA 105

Query: 129 DDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSKWNPSNIWN 188
           +    +M+  +L+K+    +        G+     W   +++    NDKT++ NPS I+N
Sbjct: 106 EQFIKYMSYSKLVKLTMSLMG-------GNKTCPEWFREHEFYQISNDKTNELNPSRIYN 158

Query: 189 EVITKLPSCEKLNALIGQ---SKIVQNLTESFDLSICLIFGFDVSAMK-AKKYGAREKTA 244
            V +K     KLN+L+ +   +K V++L ++++  I +I        K       ++   
Sbjct: 159 GVFSK----NKLNSLVSKLLNNKNVKDLIQTYENGIHVILNEKDKIQKDTTTASTKQSKT 214

Query: 245 NANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETT---SDNEDLLIKEYXXXXXX 301
            +  T ++ + D     EK A +S+S +   +  S +E     S+ E+LL K+Y      
Sbjct: 215 KSEDTSTDKNIDGVSKTEKGATESESESDLLEENSEREAPELDSETEELLSKQYDGLLVG 274

Query: 302 XXXXXXXXXYLNPNINYNEVTXXXXXXXXXXXXXXXXXXXXXXXXXPRRKKPKLHNLPEL 361
                     L+P I+YN+VT                         P  KKPK +NLPEL
Sbjct: 275 SDEESEPEFQLDPTIDYNQVTDEEDKEEYSADEDDEENSDSDSGE-PSNKKPK-YNLPEL 332

Query: 362 MAGYYSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEPXXXXXXXXXXXXXIWE 421
           M GY SG D EE+ D                 D+ AR+Q++  P             IWE
Sbjct: 333 MNGYISG-DEEEDLD-----------------DKVARKQIAAVPVKKNRRGQRARQKIWE 374

Query: 422 KKYGSQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXXXXXXXXXX---XXXXX 478
           KKYGSQAKHVQR+LEKE ++R+ RQ EY                                
Sbjct: 375 KKYGSQAKHVQRQLEKEHKERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSSTS 434

Query: 479 NNKKEKESASTGEE--HPSWIAKRLAEEKLQKAK 510
           N     +   T ++  HPSW AKR+AEEK +  K
Sbjct: 435 NIPPPPQPVITADKPIHPSWEAKRIAEEKQKNVK 468

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score =  125 bits (313), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 124/523 (23%), Positives = 200/523 (38%), Gaps = 36/523 (6%)

Query: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXX 60
           MP      +YKLD  EYQYH L  ++ +F PR   TAK YN  G                
Sbjct: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60

Query: 61  XXXXXXXXXSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXX-XXXDAQKNKSPSIDIE 119
                      ++LL++K+H+ E+ L                     D Q+N    + + 
Sbjct: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSK--LQVL 118

Query: 120 KMLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTS 179
           + +      +     + R +++KI+  +I   +K ++ D     W  N+       +K  
Sbjct: 119 EGVQRGPGFEQFVRLIVRSKVVKIVLGKI-CPTKALKNDP--PAWFQNHRILQQFGNKED 175

Query: 180 KWNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGA 239
           + NP  +W EV+  +   E+L + +  +K  ++L  + + S+ L+ G      + +   A
Sbjct: 176 ECNPGRVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLG--TKKERRQNSDA 233

Query: 240 REKTANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNK---ETTSDNEDLLIKEYX 296
            EKTA A ++    D  +   N  + ID  + +   +  S+     + S +ED L+ +Y 
Sbjct: 234 AEKTAVAARSAEGEDDSSSSDNAASDIDEGAASESEEENSDDEAARSPSVDEDALVSQYA 293

Query: 297 XXXXXXXXXXXXXX--YLNPNINYNEVTXXXXXXXXXXXXXXXXXXXXXXXXXPRR-KKP 353
                           +L+PN++YNEVT                             KK 
Sbjct: 294 GMLAASDEEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQPDADDSSDSDSSAPPLKKQ 353

Query: 354 KLH----NLPELMAGYYSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEPXXXX 409
           K       LP LMAGYYSG+D  +  + D                   + +    P    
Sbjct: 354 KTSKTKVQLPALMAGYYSGDDDSDAEEHDL----------------AGKAEPLEPPKRKN 397

Query: 410 XXXXXXXXXIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXXXXXX 469
                    IWEKKYG  AKH+Q++ EKE E+R ++Q EY                    
Sbjct: 398 RRGQRARQKIWEKKYGRNAKHIQQQFEKEREERARKQREYEERAAKRPAKEAELARTRPA 457

Query: 470 XXXXXXXXXNNKKEKESAS--TGEEHPSWIAKRLAEEKLQKAK 510
                         K +A     E HPSW AK+L++EK + AK
Sbjct: 458 FKDSAIRAAEPGAAKSAAKPVAQELHPSWEAKKLSQEKQKAAK 500

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 95/225 (42%), Gaps = 15/225 (6%)

Query: 9   IYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGXXXXXXXXXXXXXXXXXXXXXXXX 68
           + KLD+LEYQ+HYL ++ +KFEPR+P T + +N  G                        
Sbjct: 7   LLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKNNKKVTKILESSDKEKVRSDLK 66

Query: 69  XSYSKLLNNKIHYYETHLXXXXXXXXXXXXXXXXXXXXDAQKNKSPSIDI--EKMLATQL 126
               ++LN KIH  E H+                           P ++    K  A   
Sbjct: 67  EVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVF-------QPVLEAVEAKYGAGDA 119

Query: 127 SLDDLALFMTRFRLIKILHQRIKQKSKKIEG------DTNNKTWLNNNDYSGYINDKTSK 180
            L D    +T+ + IK +  ++++ S  I        D     W  +++Y     DK +K
Sbjct: 120 GLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYVKMWTDKNNK 179

Query: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIF 225
           +NPS +WNE +TK+ SC+ L + +   K  + + + FD S+ L  
Sbjct: 180 YNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFL 224

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 68/150 (45%), Gaps = 20/150 (13%)

Query: 361 LMAGYYSGNDTEEESDEDXXXXXXXXXXRDTAEDRTAREQMSNEPXXXXXXXXXXXXXIW 420
           LM GY SG   EE                    D  A+EQ+  +P             IW
Sbjct: 335 LMVGYVSGGSDEE-----------------IEVDDIAKEQIEIKPQKKNRRGQRARRKIW 377

Query: 421 EKKYGSQAKHVQRELEKEMEDRKQRQIEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNN 480
           E+KYGS+AKHVQRE+EKEME +++RQ EY                              +
Sbjct: 378 EQKYGSKAKHVQREIEKEMEKKRKRQAEYEERVAKRAARAEQNEEYQAKKAEIKREKEEH 437

Query: 481 KKEKESASTGEEHPSWIAKRLAEEKLQKAK 510
           +K+ E     E+HPSW+AK++AE+K + AK
Sbjct: 438 RKKLEKI---EDHPSWVAKKMAEDKEKNAK 464

>KLLA0F00462g complement(33094..34980) weakly similar to sp|Q9HFC6
           Yarrowia lipolytica Calnexin precursor, hypothetical
           start
          Length = 628

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 193 KLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAREK------TANA 246
           K+ SC+ L   I     V +L + F +S  ++    +S M   K+    +      ++NA
Sbjct: 498 KIKSCKTLQTFIAWFLQVDDLYKGFLISAFMVVVVSISCMGMLKFLMWSQGIDLSSSSNA 557

Query: 247 NQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNK 281
           ++    I+ +T DG   N +   + + G  T S+K
Sbjct: 558 SRKPKKIENETSDGPSANTVTEIAASTGYSTPSSK 592

>Scas_710.46*
          Length = 2950

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 243 TANANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTS 285
           T N     SNIDYD +D +  +++  KS A    T S++ + S
Sbjct: 352 TFNVTSLLSNIDYDINDNHLVSSVKKKSRASSFDTGSDRSSIS 394

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.126    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,492,701
Number of extensions: 504549
Number of successful extensions: 1988
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1987
Number of HSP's successfully gapped: 35
Length of query: 510
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 404
Effective length of database: 12,926,601
Effective search space: 5222346804
Effective search space used: 5222346804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 64 (29.3 bits)